NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070357

Metagenome / Metatranscriptome Family F070357

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070357
Family Type Metagenome / Metatranscriptome
Number of Sequences 123
Average Sequence Length 39 residues
Representative Sequence NSVPELKTFGWHETHSNDESGVAAAIERFALREAQSCA
Number of Associated Samples 106
Number of Associated Scaffolds 123

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.81 %
% of genes near scaffold ends (potentially truncated) 99.19 %
% of genes from short scaffolds (< 2000 bps) 89.43 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.374 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(25.203 % of family members)
Environment Ontology (ENVO) Unclassified
(31.707 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.967 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.30%    β-sheet: 0.00%    Coil/Unstructured: 69.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 123 Family Scaffolds
PF01464SLT 86.18
PF14534DUF4440 1.63
PF00437T2SSE 1.63
PF05137PilN 0.81
PF00482T2SSF 0.81
PF14863Alkyl_sulf_dimr 0.81
PF08282Hydrolase_3 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 123 Family Scaffolds
COG3166Type IV pilus assembly protein PilNCell motility [N] 1.63
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.81
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.81
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.81
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.81
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.81

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.37 %
UnclassifiedrootN/A1.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c1143949All Organisms → cellular organisms → Bacteria → Acidobacteria789Open in IMG/M
3300002245|JGIcombinedJ26739_101841462All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300005174|Ga0066680_10373694All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300005176|Ga0066679_10254907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1131Open in IMG/M
3300005334|Ga0068869_100211198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli1534Open in IMG/M
3300005436|Ga0070713_101667858All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005466|Ga0070685_10916269All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300005537|Ga0070730_10090786All Organisms → cellular organisms → Bacteria2126Open in IMG/M
3300005537|Ga0070730_11006645All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300005541|Ga0070733_10517393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli798Open in IMG/M
3300005542|Ga0070732_10641644All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300005557|Ga0066704_10543643All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005560|Ga0066670_10459935All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300005598|Ga0066706_11114827All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300005602|Ga0070762_10823469All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300006162|Ga0075030_101369163All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300006176|Ga0070765_100249975All Organisms → cellular organisms → Bacteria1626Open in IMG/M
3300006800|Ga0066660_10068367All Organisms → cellular organisms → Bacteria2399Open in IMG/M
3300006806|Ga0079220_11864973All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300006904|Ga0075424_100039326All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4919Open in IMG/M
3300007076|Ga0075435_101260060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli647Open in IMG/M
3300007265|Ga0099794_10429821All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300009038|Ga0099829_10160796All Organisms → cellular organisms → Bacteria → Acidobacteria1798Open in IMG/M
3300009038|Ga0099829_11696048All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300009137|Ga0066709_102655119All Organisms → cellular organisms → Bacteria → Acidobacteria669Open in IMG/M
3300009143|Ga0099792_10231063All Organisms → cellular organisms → Bacteria → Acidobacteria1067Open in IMG/M
3300009545|Ga0105237_10538352All Organisms → cellular organisms → Bacteria → Acidobacteria1174Open in IMG/M
3300009792|Ga0126374_10817770All Organisms → cellular organisms → Bacteria → Acidobacteria714Open in IMG/M
3300010320|Ga0134109_10072315All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1171Open in IMG/M
3300010359|Ga0126376_10666031All Organisms → cellular organisms → Bacteria → Acidobacteria996Open in IMG/M
3300010359|Ga0126376_11566757All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300010867|Ga0126347_1194612All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300011120|Ga0150983_10247488All Organisms → cellular organisms → Bacteria → Acidobacteria815Open in IMG/M
3300011120|Ga0150983_15563425All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300011269|Ga0137392_10116389All Organisms → cellular organisms → Bacteria → Acidobacteria2125Open in IMG/M
3300011270|Ga0137391_11422291All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300012189|Ga0137388_10478721All Organisms → cellular organisms → Bacteria → Acidobacteria1156Open in IMG/M
3300012203|Ga0137399_11461532All Organisms → cellular organisms → Bacteria → Acidobacteria570Open in IMG/M
3300012205|Ga0137362_10162171All Organisms → cellular organisms → Bacteria → Acidobacteria1916Open in IMG/M
3300012205|Ga0137362_10730338All Organisms → cellular organisms → Bacteria → Acidobacteria850Open in IMG/M
3300012205|Ga0137362_11597665All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300012209|Ga0137379_10093534All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2892Open in IMG/M
3300012209|Ga0137379_11294570All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium635Open in IMG/M
3300012285|Ga0137370_10976368All Organisms → cellular organisms → Bacteria → Acidobacteria522Open in IMG/M
3300012354|Ga0137366_10469507All Organisms → cellular organisms → Bacteria → Acidobacteria911Open in IMG/M
3300012361|Ga0137360_10035168All Organisms → cellular organisms → Bacteria → Acidobacteria3500Open in IMG/M
3300012361|Ga0137360_10954935All Organisms → cellular organisms → Bacteria → Acidobacteria739Open in IMG/M
3300012361|Ga0137360_11060035All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300012362|Ga0137361_10285061All Organisms → cellular organisms → Bacteria → Acidobacteria1510Open in IMG/M
3300012362|Ga0137361_10381192All Organisms → cellular organisms → Bacteria → Acidobacteria1295Open in IMG/M
3300012685|Ga0137397_10128168All Organisms → cellular organisms → Bacteria → Acidobacteria1872Open in IMG/M
3300012918|Ga0137396_11105357All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300012925|Ga0137419_11803795All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300012929|Ga0137404_12324989All Organisms → cellular organisms → Bacteria → Acidobacteria502Open in IMG/M
3300012977|Ga0134087_10028238All Organisms → cellular organisms → Bacteria → Acidobacteria2104Open in IMG/M
3300014150|Ga0134081_10325837All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300015053|Ga0137405_1356611All Organisms → cellular organisms → Bacteria → Acidobacteria2643Open in IMG/M
3300015054|Ga0137420_1424939All Organisms → cellular organisms → Bacteria → Acidobacteria769Open in IMG/M
3300015245|Ga0137409_10467057All Organisms → cellular organisms → Bacteria → Acidobacteria1083Open in IMG/M
3300015264|Ga0137403_11033250All Organisms → cellular organisms → Bacteria → Acidobacteria668Open in IMG/M
3300016294|Ga0182041_10327774All Organisms → cellular organisms → Bacteria → Acidobacteria1279Open in IMG/M
3300016387|Ga0182040_11036417All Organisms → cellular organisms → Bacteria → Acidobacteria685Open in IMG/M
3300016422|Ga0182039_10659770All Organisms → cellular organisms → Bacteria → Acidobacteria919Open in IMG/M
3300016445|Ga0182038_10570677All Organisms → cellular organisms → Bacteria → Acidobacteria974Open in IMG/M
3300018089|Ga0187774_11011781All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300018482|Ga0066669_10001370All Organisms → cellular organisms → Bacteria → Acidobacteria9231Open in IMG/M
3300019887|Ga0193729_1004290All Organisms → cellular organisms → Bacteria6925Open in IMG/M
3300020579|Ga0210407_11258016All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300020581|Ga0210399_10352769All Organisms → cellular organisms → Bacteria → Acidobacteria1228Open in IMG/M
3300020581|Ga0210399_10592956All Organisms → cellular organisms → Bacteria → Acidobacteria917Open in IMG/M
3300021046|Ga0215015_10361400All Organisms → cellular organisms → Bacteria → Acidobacteria645Open in IMG/M
3300021086|Ga0179596_10457485All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300021168|Ga0210406_10266080All Organisms → cellular organisms → Bacteria → Acidobacteria1403Open in IMG/M
3300021170|Ga0210400_11237116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300021170|Ga0210400_11292913All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300021171|Ga0210405_10814885All Organisms → cellular organisms → Bacteria → Acidobacteria714Open in IMG/M
3300021180|Ga0210396_11319616All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300021180|Ga0210396_11662017All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300021181|Ga0210388_10963963All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300021406|Ga0210386_10196711All Organisms → cellular organisms → Bacteria1705Open in IMG/M
3300021406|Ga0210386_10424405All Organisms → cellular organisms → Bacteria → Acidobacteria1147Open in IMG/M
3300021475|Ga0210392_11340886All Organisms → cellular organisms → Bacteria → Acidobacteria535Open in IMG/M
3300022533|Ga0242662_10333729All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300025926|Ga0207659_11205468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales651Open in IMG/M
3300025930|Ga0207701_11234381Not Available615Open in IMG/M
3300025934|Ga0207686_10154640All Organisms → cellular organisms → Bacteria → Acidobacteria1601Open in IMG/M
3300026309|Ga0209055_1150920All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300026313|Ga0209761_1316268All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300026334|Ga0209377_1150123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium883Open in IMG/M
3300026529|Ga0209806_1183670All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium753Open in IMG/M
3300026538|Ga0209056_10323884All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1040Open in IMG/M
3300026551|Ga0209648_10432061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium834Open in IMG/M
3300026855|Ga0208404_1004318All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300027101|Ga0208727_101260All Organisms → cellular organisms → Bacteria → Acidobacteria736Open in IMG/M
3300027105|Ga0207944_1020037All Organisms → cellular organisms → Bacteria → Acidobacteria580Open in IMG/M
3300027610|Ga0209528_1077034All Organisms → cellular organisms → Bacteria → Acidobacteria738Open in IMG/M
3300027768|Ga0209772_10004702All Organisms → cellular organisms → Bacteria3565Open in IMG/M
3300027846|Ga0209180_10748232All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300027903|Ga0209488_10603088All Organisms → cellular organisms → Bacteria → Acidobacteria796Open in IMG/M
3300027908|Ga0209006_11490566Not Available513Open in IMG/M
3300030509|Ga0302183_10423113All Organisms → cellular organisms → Bacteria → Acidobacteria509Open in IMG/M
3300031231|Ga0170824_115471449All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300031573|Ga0310915_11022261All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300031663|Ga0307484_101482All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1193Open in IMG/M
3300031713|Ga0318496_10458095All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300031718|Ga0307474_10006373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8527Open in IMG/M
3300031718|Ga0307474_10013555All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5901Open in IMG/M
3300031753|Ga0307477_10564453All Organisms → cellular organisms → Bacteria → Acidobacteria769Open in IMG/M
3300031792|Ga0318529_10496207All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300031795|Ga0318557_10538492All Organisms → cellular organisms → Bacteria → Acidobacteria536Open in IMG/M
3300031820|Ga0307473_11382544All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300031823|Ga0307478_10978537All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300031823|Ga0307478_11226886All Organisms → cellular organisms → Bacteria → Acidobacteria624Open in IMG/M
3300031832|Ga0318499_10267069All Organisms → cellular organisms → Bacteria → Acidobacteria663Open in IMG/M
3300031837|Ga0302315_10591773All Organisms → cellular organisms → Bacteria → Acidobacteria593Open in IMG/M
3300031890|Ga0306925_11359333All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300031945|Ga0310913_10269132All Organisms → cellular organisms → Bacteria → Acidobacteria1199Open in IMG/M
3300032065|Ga0318513_10399087All Organisms → cellular organisms → Bacteria → Acidobacteria671Open in IMG/M
3300032180|Ga0307471_100881026All Organisms → cellular organisms → Bacteria → Acidobacteria1062Open in IMG/M
3300032180|Ga0307471_103822145All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300032205|Ga0307472_100590398All Organisms → cellular organisms → Bacteria → Acidobacteria978Open in IMG/M
3300032829|Ga0335070_11747403All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300033289|Ga0310914_10748893All Organisms → cellular organisms → Bacteria → Acidobacteria874Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil25.20%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.89%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.94%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil8.13%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.06%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.25%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.25%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.44%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.63%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.63%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.63%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.81%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.81%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.81%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.81%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.81%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.81%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.81%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026855Soil and rhizosphere microbial communities from Laval, Canada - mgLMA (SPAdes)EnvironmentalOpen in IMG/M
3300027101Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF027 (SPAdes)EnvironmentalOpen in IMG/M
3300027105Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes)EnvironmentalOpen in IMG/M
3300027610Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031663Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_114394922228664022SoilNSVPELKTFGWHETHSNDESGVAAAIERFALREAQSCA
JGIcombinedJ26739_10184146223300002245Forest SoilGIPVVMENCVAELKTFGWHETSSNDNDGVAAAIELFALREAPSCA*
Ga0066680_1037369413300005174SoilVMANGVEELKNLGWRQTLSNDESGVAAAIENYASEAPDIK*
Ga0066679_1025490713300005176SoilMGNCVPELRNFGWHETASNDHNGVAAAIELFALREVAPCG*
Ga0068869_10021119813300005334Miscanthus RhizosphereVVMGNGVPELKTYGWHETHSNDESGVAAAIEKFALREAESCA*
Ga0070713_10166785813300005436Corn, Switchgrass And Miscanthus RhizosphereMQNCVAELKSYGWHETDSNEDSGVAAAIERFALSEATSCA*
Ga0070685_1091626913300005466Switchgrass RhizosphereMGNSVPELKTFGWHETHSNDESGVAAAIERFALREAESCT*
Ga0070730_1009078643300005537Surface SoilMGNSVPELKSYGWHETESNDENGVAAAIERFALREAASCA*
Ga0070730_1100664513300005537Surface SoilPVVMGNGVNELKGFGWHETASNDEGGVAAAIEHFALREAAPCA*
Ga0070733_1051739313300005541Surface SoilVVMGNSVPELKSYGWHETDSNDENGVAAAIERFALREAASCA*
Ga0070732_1064164423300005542Surface SoilNCVPELRAFGWHETNSNDEGGVATAIERFALREVGPCA*
Ga0066704_1054364313300005557SoilEELKNLGWRQTLSNDESGVAAAIENYASEAPDIK*
Ga0066670_1045993513300005560SoilVPALKTYGWHETGTNDENGVASAIEHFALREAAPCL*
Ga0066706_1111482723300005598SoilGNSVPALKTYGWHETGTNDENGVALAIEQFALREAAPCL*
Ga0070762_1082346913300005602SoilPVVMGNGVAELKNFGWHETASNDEGGVAAAIEHFALREAAPCT*
Ga0075030_10136916313300006162WatershedsVMGNSVPELKTQGWHVTGTNDEEGVASAIERFAFEERVACT*
Ga0070765_10024997513300006176SoilVMGNGVAELKNFGWHQTASNDENGVAVAIEKFALREAASCA*
Ga0066660_1006836713300006800SoilVPELKTFGWHETRTNDENGVAHAIEQFALREAAPCA*
Ga0079220_1186497313300006806Agricultural SoilVPELKEHGWHETGSNDENGVATAIERFVLSKAESCA*
Ga0075424_10003932613300006904Populus RhizosphereSVPELKMFGWHETHSNDEGGVAAAIERFALREAESCA*
Ga0075435_10126006013300007076Populus RhizosphereMGNSVPELKTFGWHETHSNDESGVAAAIERFALREAGSCA*
Ga0099794_1042982123300007265Vadose Zone SoilVPALKTYGWHETGTNDENGVALAIEQFALREASPCV*
Ga0099829_1016079643300009038Vadose Zone SoilVPELKTFGWHETGTNDESGVAAAIEHFAFREAASCA*
Ga0099829_1169604823300009038Vadose Zone SoilAPELKTYGWHETHSNDESGVAAAIEKFALSKAASCA*
Ga0066709_10265511923300009137Grasslands SoilVMRNSVPELKAFGWHETGTNDESGVAAAIEHFAFREAASCA*
Ga0099792_1023106333300009143Vadose Zone SoilPSLKTYGWHETGTNDENGVALAIEQFALREAAPCV*
Ga0105237_1053835233300009545Corn RhizosphereMGNGVPELKTYGWHETHSNDESGVAAAIEKFALREAESCA*
Ga0126374_1081777013300009792Tropical Forest SoilVMANGVPELKVHGWHETLSNDESGVAAAIERFALSEAACA*
Ga0134109_1007231513300010320Grasslands SoilPALKTYGWHETGTNDENGVASAIEHFALREAAPCL*
Ga0126376_1066603123300010359Tropical Forest SoilPVVMASGVPELKIHGWHETLSNDESGVAAAIERFALSEAACA*
Ga0126376_1156675713300010359Tropical Forest SoilMGNSVPELKAFGWHEPLSNNDSGVAAAIHRFALPEVAPCA*
Ga0126347_119461223300010867Boreal Forest SoilVVMGNCVSALTCYGWHQTASNDDGGVAAAIERFALSEAASCA*
Ga0150983_1024748823300011120Forest SoilVVMGNGVAELKTFGWHETASNDDGGVAAAIEHFALREATPCA*
Ga0150983_1556342513300011120Forest SoilPELRNFGWHETASNDHNGVAAAIEQFALREVAPCG*
Ga0137392_1011638913300011269Vadose Zone SoilELKTFGWHETGTNDESGVAAAIEHFAFREAASCA*
Ga0137391_1142229123300011270Vadose Zone SoilVMQNGVPELKSYGWHETHSNDESGVAAAIARFALSEAASCR*
Ga0137388_1047872133300012189Vadose Zone SoilVPELKTFGWHETGTNDEGGVAAAIEHFAFREAASCA*
Ga0137399_1146153223300012203Vadose Zone SoilANGVPELKVHGWHETLSNDESGVAAAIERFALSEAACA*
Ga0137362_1016217143300012205Vadose Zone SoilVPELKVHGWHETLSNDESGVAAAIERFALSEAACA*
Ga0137362_1073033813300012205Vadose Zone SoilNCVPELRNFGWHETASNDHNGVAAAIELFALREVAPCG*
Ga0137362_1159766513300012205Vadose Zone SoilVPVVMGNCVPELRNFGWHETASNDHNGVAAAIKLFALREVAPCG*
Ga0137379_1009353413300012209Vadose Zone SoilPELKTYGWHETRTNDENGVAHAIEQFALREAAPCA*
Ga0137379_1129457023300012209Vadose Zone SoilLPIVMANGVEELKNLGWRQTLSNDESGVAAAIENYASEAPEIK*
Ga0137370_1097636823300012285Vadose Zone SoilVMANGVPELKTHGWHETLSNDESGVAAAIERFALSEAACA*
Ga0137366_1046950723300012354Vadose Zone SoilIPVVMQNCVPELKSYGWHETDSNDDSGVAAAIERFALSEAASCA*
Ga0137360_1003516863300012361Vadose Zone SoilVPELKTHGWHETLSNDESGVAAAIERFALSEAACA*
Ga0137360_1095493523300012361Vadose Zone SoilMGNSVAELKTFGWHETASNDHNGVAAAIEQFALREVAPCG*
Ga0137360_1106003523300012361Vadose Zone SoilMQNCVPELKTYGWHQTHSNDESGVAAAIERFALSEAASCA*
Ga0137361_1028506133300012362Vadose Zone SoilPELRNFGWHETASNDDNGVAAAIEQFALREEAPCG*
Ga0137361_1038119213300012362Vadose Zone SoilMGNCVAELRNFGWHETTSNDHNGVAAAIELFALREVAPCG*
Ga0137397_1012816813300012685Vadose Zone SoilELRNFGWHETASNDHNGVAAAIELFALREVAPCG*
Ga0137396_1110535713300012918Vadose Zone SoilMGNCVAELRNFGWHETASNDHNGVAAAIELFALREVAPCG*
Ga0137419_1180379513300012925Vadose Zone SoilVAALKTYGWHETGTNDENGVALAIEQFALREAAPCV*
Ga0137404_1232498913300012929Vadose Zone SoilENAVPELKTRGWHVTQTNDNDGVAAAIERFALPELPECA*
Ga0134087_1002823843300012977Grasslands SoilNGVPALKTYGWHETGTNDENGVALAIEQFALREAAPCL*
Ga0134081_1032583723300014150Grasslands SoilGNSVPPLKTYGWHETGTNDENGVASAIEHFALREAAPCL*
Ga0137405_135661113300015053Vadose Zone SoilVMQNCVPELKTYGWHETYSNDESGVAAAIERFALSEAASCA*
Ga0137420_142493923300015054Vadose Zone SoilNCVAELRNFGWHETASNDHNGVAAAIELFALREVAPCG*
Ga0137409_1046705733300015245Vadose Zone SoilVPELKTRGWHVTHTNDNDGVAAAIERFALPELPECA*
Ga0137403_1103325023300015264Vadose Zone SoilMGNSVPELKTFGWHETGTNDESGVAAAIEHFAFREAASCA*
Ga0182041_1032777413300016294SoilVVMGNSVAELKAFGWHETHTNDENGVAHAIEHFALREAAPCA
Ga0182040_1103641713300016387SoilAVPELKTRGWHVTQSNDDDGVAVAIERFALREAPECA
Ga0182039_1065977023300016422SoilIMQNSVPELKTFGWHETHSNDESGVAAAIERFALCRAESCA
Ga0182038_1057067723300016445SoilVMQNSVPELKSFGWYETRSNDESGVAAAIERFALRGAQSCA
Ga0187774_1101178123300018089Tropical PeatlandVPELKAFGWHETLSNDDSGVAAAIHRFALPEAASCA
Ga0066669_1000137013300018482Grasslands SoilVPALKTYGWHETGTNDENGVASAIEHFALREAAPCL
Ga0193729_100429023300019887SoilMQNCVPELKTYGWHETHSNDESGVAAAIERFALSEAASCA
Ga0210407_1125801623300020579SoilVVMGNCVPELRNFGWHETASNDHNGVAAAIEQFALREVAPCG
Ga0210399_1035276933300020581SoilAVPELKTRGWHVTHTNDNDGVAAAIERFALRELPECA
Ga0210399_1059295613300020581SoilVAELTTYGWHETGTNDENGVALAIEKFALRVAASCA
Ga0215015_1036140023300021046SoilGNSVPELKTFGWHETSTNDDNGVAAAIEQIALREATPCA
Ga0179596_1045748513300021086Vadose Zone SoilVRGNCVAELRNFGWHETASNDHNGVAAAIELFALREVAPCG
Ga0210406_1026608033300021168SoilGVAELKCFGWHQTGSNDESGVALAIQQFALSEAAACV
Ga0210400_1123711623300021170SoilNSVPVLKTYGWHETGTNDENGVALAIEQFALREASPCV
Ga0210400_1129291323300021170SoilAELKGFGWHETASNDDGGVAAAIEHFALREAAPCA
Ga0210405_1081488523300021171SoilNAVPELKTRGWHVTHTNDNDGVAAAIERFALPELPECA
Ga0210396_1131961623300021180SoilGIPVVMGNGVAELKGFGWHETASNDDGGVAAAIEHFALREEAPCA
Ga0210396_1166201723300021180SoilVMGNGVAELKGFGWHETASNDDSGVAAAIEHFALREAAPCA
Ga0210388_1096396323300021181SoilGNGVAELKNFGWHQTASNDENGVAVAIEKFALCEAASCA
Ga0210386_1019671113300021406SoilVAELKTFGWHETRSNDNDGVAAAIELFALREAPSCA
Ga0210386_1042440513300021406SoilENAVPELKTRGWHVTHTNDNDGVAAAIERFALRELPECA
Ga0210392_1134088623300021475SoilFSGIPVVIGNGVAELKIFGWHETASNDHGGVAAAIEHFALREAASCA
Ga0242662_1033372923300022533SoilPVVMGNGVAELKEFGWHETASNDEGGVAAAIEQFALRGAAPCV
Ga0207659_1120546823300025926Miscanthus RhizospherePELKTFGWHETHSNDESGVAAAIERFALREAESCT
Ga0207701_1123438113300025930Corn, Switchgrass And Miscanthus RhizosphereNGLDELKTRGWPVTASNDDGGVAKAIETFILEAAS
Ga0207686_1015464033300025934Miscanthus RhizospherePELKTYGWHETHSNDDGGVAAAIERFALREAGSCA
Ga0209055_115092023300026309SoilNSVAALKTYGWHETGTNDENGVALAIEQFALREAAPCV
Ga0209761_131626813300026313Grasslands SoilGVEELKNLGWRQTLSNDESGVAAAIENYASEAPDIK
Ga0209377_115012323300026334SoilMGNSVPELKAYGWHQTGTNDENGVALAIEQFALREATPCV
Ga0209806_118367013300026529SoilPALKTYGWHETGTNDENGVALAIEQFALREAAPCL
Ga0209056_1032388413300026538SoilSVPALKTYGWHETGTNDENGVALAIEQFALREAAPCL
Ga0209648_1043206113300026551Grasslands SoilVVMGNGVRELKTYGWHETGSNDENGVALAIEQFALREVAPCL
Ga0208404_100431813300026855SoilVVMRNGVPELKSFGWHETLSNDESGVAAAIERFALSETTCV
Ga0208727_10126013300027101Forest SoilGVAELKTFGWHETASNDDGGVAAAIEHFALREATPCA
Ga0207944_102003723300027105Forest SoilNCVPELRNFGWHETCSNDENGVAAAIEQFALREVAPCA
Ga0209528_107703413300027610Forest SoilVAELKTFGWHETASNDHNGVAAAIEQFALREVAPCG
Ga0209772_1000470263300027768Bog Forest SoilIPVVMSNGVSALKCFGWHQTGSNDEGGVAAAIEHFVLREAASCV
Ga0209180_1074823223300027846Vadose Zone SoilNSAPELKTYGWHETHSNDESGVAAAIEKFALSKAASCA
Ga0209488_1060308823300027903Vadose Zone SoilNCVAELRNFGWHETASNDHNGVAAAIELFALREVAPCG
Ga0209006_1149056623300027908Forest SoilVMANGVAELKNFGWHQTASNDENGVAVAIEQFALREAASCA
Ga0302183_1042311313300030509PalsaGIPVVMSNGVAALKRFGWHETASNDEAGVAAAIELFALRKEAACA
Ga0170824_11547144923300031231Forest SoilGIPVVMENCVAELKTFGWHETRSNDNDGVAAAIELFALREAPSCA
Ga0310915_1102226113300031573SoilPELKTFGWHETQSNDESGVAAAIERFALRGAESCA
Ga0307484_10148233300031663Hardwood Forest SoilGNSVAELKTYGWHETGTNDENGVALAIEKFALPEAPSCV
Ga0318496_1045809513300031713SoilGNGVPALKEQGWHVTRSNDEDGVAAAIERFALSEAAECQ
Ga0307474_1000637313300031718Hardwood Forest SoilVAELKNFGWHQTASNDENGVAVAIEQFALRGAASCA
Ga0307474_1001355513300031718Hardwood Forest SoilNCVSALTCYGWHQTGSNDEGGVAAAIERFALSEAASCA
Ga0307477_1056445313300031753Hardwood Forest SoilGNSVPELKTFGWHETSSNDENGVAAAIEHFALREAAPCT
Ga0318529_1049620713300031792SoilVVMQNSVPELKSFGWYETRSNDESGVAAAIERFALRGAESCA
Ga0318557_1053849213300031795SoilNSVPELKSFGWYETRSNDESGVAAAIERFALRGAESCA
Ga0307473_1138254423300031820Hardwood Forest SoilGNSVPELKAFGWHETLSNDDSGVAAAIHRFALPEAAPCA
Ga0307478_1097853723300031823Hardwood Forest SoilENCVAELKTFGWHETRSNDNDGVAAAIELFALREAPSCA
Ga0307478_1122688623300031823Hardwood Forest SoilPELRNFGWHETASNDHNGVAAAIEQFALREVAPCG
Ga0318499_1026706923300031832SoilVPELKTFGWHETRTNDENGVAHAIEQFALREAAPCA
Ga0302315_1059177323300031837PalsaIPVVMGNGVSALKCFGWHLTSSNDEGGVAAAIEHFALREAASCA
Ga0306925_1135933313300031890SoilNSVPELKTFGWHETLTNDDSGVAAAIHRFALEGTAPCV
Ga0310913_1026913213300031945SoilMQNGVPELKTYGWHQTHSNDEGGVAAAIEKFALSPAASCA
Ga0318513_1039908723300032065SoilGNSVPELKTFGWHETRTNDENGVAHAIEQFALREAAPCA
Ga0307471_10088102623300032180Hardwood Forest SoilFAGIAVVMQNCVPELKTYGWHETHSNDESGVAAAIERFALNEAASCA
Ga0307471_10382214513300032180Hardwood Forest SoilVVMGNCVQELRNFGWHETASNDHNGVAAAIEQFALREVAPCG
Ga0307472_10059039823300032205Hardwood Forest SoilVMGNSVPELKAFGWHETASNDENGVAAAIEQFALRETTSCA
Ga0335070_1174740323300032829SoilNAVPELKARGWHVTQTNDEDGVAAAIERFVLRETPA
Ga0310914_1074889313300033289SoilPALKEQGWHVTRSNDEDGVAAAIERFALSEAAECQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.