Basic Information | |
---|---|
Family ID | F070482 |
Family Type | Metagenome |
Number of Sequences | 123 |
Average Sequence Length | 41 residues |
Representative Sequence | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDELYQT |
Number of Associated Samples | 85 |
Number of Associated Scaffolds | 123 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 81.30 % |
% of genes near scaffold ends (potentially truncated) | 93.50 % |
% of genes from short scaffolds (< 2000 bps) | 91.87 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.854 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.520 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.089 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.341 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 123 Family Scaffolds |
---|---|---|
PF03401 | TctC | 3.25 |
PF13356 | Arm-DNA-bind_3 | 2.44 |
PF00816 | Histone_HNS | 2.44 |
PF00589 | Phage_integrase | 2.44 |
PF13924 | Lipocalin_5 | 1.63 |
PF00072 | Response_reg | 0.81 |
PF04862 | DUF642 | 0.81 |
PF04392 | ABC_sub_bind | 0.81 |
PF04851 | ResIII | 0.81 |
PF00034 | Cytochrom_C | 0.81 |
PF03050 | DDE_Tnp_IS66 | 0.81 |
PF05050 | Methyltransf_21 | 0.81 |
PF01471 | PG_binding_1 | 0.81 |
PF13467 | RHH_4 | 0.81 |
PF01381 | HTH_3 | 0.81 |
PF00590 | TP_methylase | 0.81 |
PF00884 | Sulfatase | 0.81 |
PF01545 | Cation_efflux | 0.81 |
PF01527 | HTH_Tnp_1 | 0.81 |
PF03466 | LysR_substrate | 0.81 |
PF13185 | GAF_2 | 0.81 |
COG ID | Name | Functional Category | % Frequency in 123 Family Scaffolds |
---|---|---|---|
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 3.25 |
COG2916 | DNA-binding protein H-NS | Transcription [K] | 2.44 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.81 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.81 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.81 |
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.81 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.81 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.85 % |
Unclassified | root | N/A | 34.15 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573001|GZR05M102HHUBG | Not Available | 526 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10082319 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 805 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1025697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1100 | Open in IMG/M |
3300000955|JGI1027J12803_100661696 | Not Available | 783 | Open in IMG/M |
3300000956|JGI10216J12902_110128452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
3300005332|Ga0066388_102309245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
3300005332|Ga0066388_104492607 | Not Available | 710 | Open in IMG/M |
3300005332|Ga0066388_107028653 | Not Available | 566 | Open in IMG/M |
3300005434|Ga0070709_10198455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1419 | Open in IMG/M |
3300005435|Ga0070714_100550542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1104 | Open in IMG/M |
3300005435|Ga0070714_100717426 | Not Available | 965 | Open in IMG/M |
3300005436|Ga0070713_100067571 | All Organisms → cellular organisms → Bacteria | 3010 | Open in IMG/M |
3300005436|Ga0070713_101906770 | Not Available | 576 | Open in IMG/M |
3300005586|Ga0066691_10260960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1018 | Open in IMG/M |
3300005713|Ga0066905_100749760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
3300005764|Ga0066903_100114284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3719 | Open in IMG/M |
3300005764|Ga0066903_100394471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2272 | Open in IMG/M |
3300005764|Ga0066903_101373345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1325 | Open in IMG/M |
3300005764|Ga0066903_103201245 | Not Available | 885 | Open in IMG/M |
3300005764|Ga0066903_104267638 | Not Available | 764 | Open in IMG/M |
3300005764|Ga0066903_104657932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
3300005764|Ga0066903_105849645 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300005764|Ga0066903_107677728 | Not Available | 555 | Open in IMG/M |
3300005764|Ga0066903_108420927 | Not Available | 526 | Open in IMG/M |
3300005764|Ga0066903_108882910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
3300005764|Ga0066903_108890699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 509 | Open in IMG/M |
3300006173|Ga0070716_100776569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 739 | Open in IMG/M |
3300006755|Ga0079222_12324726 | Not Available | 535 | Open in IMG/M |
3300006791|Ga0066653_10505541 | Not Available | 612 | Open in IMG/M |
3300006854|Ga0075425_101147934 | Not Available | 884 | Open in IMG/M |
3300006904|Ga0075424_101451364 | Not Available | 728 | Open in IMG/M |
3300006904|Ga0075424_101864268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 635 | Open in IMG/M |
3300007076|Ga0075435_101190726 | Not Available | 667 | Open in IMG/M |
3300009137|Ga0066709_104114047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
3300009147|Ga0114129_11630044 | Not Available | 789 | Open in IMG/M |
3300010048|Ga0126373_11029454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 889 | Open in IMG/M |
3300010048|Ga0126373_13307901 | Not Available | 501 | Open in IMG/M |
3300010358|Ga0126370_11429204 | Not Available | 654 | Open in IMG/M |
3300010361|Ga0126378_10638685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1178 | Open in IMG/M |
3300010361|Ga0126378_11205609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 855 | Open in IMG/M |
3300010398|Ga0126383_12482319 | Not Available | 603 | Open in IMG/M |
3300010398|Ga0126383_13379876 | Not Available | 521 | Open in IMG/M |
3300012198|Ga0137364_11130022 | Not Available | 589 | Open in IMG/M |
3300012208|Ga0137376_11579739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 547 | Open in IMG/M |
3300012355|Ga0137369_10232530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1404 | Open in IMG/M |
3300012356|Ga0137371_10686035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 784 | Open in IMG/M |
3300012357|Ga0137384_11279646 | Not Available | 580 | Open in IMG/M |
3300012359|Ga0137385_10331844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1304 | Open in IMG/M |
3300012360|Ga0137375_10207183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1849 | Open in IMG/M |
3300012971|Ga0126369_10126741 | All Organisms → cellular organisms → Bacteria | 2362 | Open in IMG/M |
3300012971|Ga0126369_11216513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 843 | Open in IMG/M |
3300012971|Ga0126369_11508948 | Not Available | 762 | Open in IMG/M |
3300012971|Ga0126369_13627490 | Not Available | 506 | Open in IMG/M |
3300015371|Ga0132258_12483276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1297 | Open in IMG/M |
3300016270|Ga0182036_10845044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 748 | Open in IMG/M |
3300016294|Ga0182041_10205354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1572 | Open in IMG/M |
3300016294|Ga0182041_10614036 | Not Available | 956 | Open in IMG/M |
3300016294|Ga0182041_11095428 | Not Available | 723 | Open in IMG/M |
3300016319|Ga0182033_10098321 | Not Available | 2146 | Open in IMG/M |
3300016319|Ga0182033_10146176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1817 | Open in IMG/M |
3300016319|Ga0182033_11065742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
3300016341|Ga0182035_10471067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1068 | Open in IMG/M |
3300016341|Ga0182035_11755798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 561 | Open in IMG/M |
3300016404|Ga0182037_11121351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
3300018433|Ga0066667_11000731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 721 | Open in IMG/M |
3300021168|Ga0210406_10268101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1397 | Open in IMG/M |
3300021439|Ga0213879_10216078 | Not Available | 573 | Open in IMG/M |
3300021475|Ga0210392_10214106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1351 | Open in IMG/M |
3300021560|Ga0126371_10059237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3688 | Open in IMG/M |
3300021560|Ga0126371_10678552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
3300025898|Ga0207692_10010412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 3918 | Open in IMG/M |
3300025898|Ga0207692_10021746 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2939 | Open in IMG/M |
3300025905|Ga0207685_10249547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
3300025915|Ga0207693_10481700 | Not Available | 969 | Open in IMG/M |
3300025915|Ga0207693_10686641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300025915|Ga0207693_11176524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
3300025916|Ga0207663_10740540 | Not Available | 780 | Open in IMG/M |
3300025929|Ga0207664_11832856 | Not Available | 529 | Open in IMG/M |
3300026310|Ga0209239_1205274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
3300028878|Ga0307278_10238775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 807 | Open in IMG/M |
3300031543|Ga0318516_10275680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 972 | Open in IMG/M |
3300031545|Ga0318541_10257480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 970 | Open in IMG/M |
3300031546|Ga0318538_10060223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1881 | Open in IMG/M |
3300031549|Ga0318571_10358419 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
3300031561|Ga0318528_10279158 | Not Available | 896 | Open in IMG/M |
3300031572|Ga0318515_10508503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 643 | Open in IMG/M |
3300031679|Ga0318561_10129014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 1348 | Open in IMG/M |
3300031679|Ga0318561_10242941 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
3300031679|Ga0318561_10312975 | Not Available | 859 | Open in IMG/M |
3300031680|Ga0318574_10548573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
3300031681|Ga0318572_10683627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 611 | Open in IMG/M |
3300031719|Ga0306917_10079776 | Not Available | 2295 | Open in IMG/M |
3300031719|Ga0306917_10898113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 693 | Open in IMG/M |
3300031723|Ga0318493_10303512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 862 | Open in IMG/M |
3300031736|Ga0318501_10313029 | Not Available | 840 | Open in IMG/M |
3300031736|Ga0318501_10441879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 705 | Open in IMG/M |
3300031768|Ga0318509_10234005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1025 | Open in IMG/M |
3300031769|Ga0318526_10301560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
3300031770|Ga0318521_10599350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
3300031777|Ga0318543_10525062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
3300031780|Ga0318508_1113223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 758 | Open in IMG/M |
3300031792|Ga0318529_10274156 | Not Available | 785 | Open in IMG/M |
3300031821|Ga0318567_10340881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 847 | Open in IMG/M |
3300031821|Ga0318567_10745001 | Not Available | 555 | Open in IMG/M |
3300031890|Ga0306925_10560396 | Not Available | 1211 | Open in IMG/M |
3300031896|Ga0318551_10422837 | Not Available | 759 | Open in IMG/M |
3300031897|Ga0318520_10294609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 976 | Open in IMG/M |
3300031910|Ga0306923_10167005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2513 | Open in IMG/M |
3300031941|Ga0310912_10421050 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
3300031942|Ga0310916_10231638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1553 | Open in IMG/M |
3300031945|Ga0310913_10349499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1046 | Open in IMG/M |
3300031947|Ga0310909_11469828 | Not Available | 543 | Open in IMG/M |
3300031954|Ga0306926_11061274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 960 | Open in IMG/M |
3300032010|Ga0318569_10432409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
3300032025|Ga0318507_10154217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 983 | Open in IMG/M |
3300032025|Ga0318507_10214553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 832 | Open in IMG/M |
3300032041|Ga0318549_10388548 | Not Available | 629 | Open in IMG/M |
3300032044|Ga0318558_10455013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 638 | Open in IMG/M |
3300032066|Ga0318514_10457748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
3300033289|Ga0310914_10235849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1641 | Open in IMG/M |
3300033289|Ga0310914_11354681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
3300033289|Ga0310914_11422277 | Not Available | 596 | Open in IMG/M |
3300033290|Ga0318519_10628882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 653 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.20% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 12.20% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.57% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.94% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.69% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.06% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.25% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.44% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.44% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.81% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.81% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.81% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.81% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FD2_00197120 | 2189573001 | Grass Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPALTDEVYQTWREV |
AF_2010_repII_A1DRAFT_100823191 | 3300000597 | Forest Soil | MNLDDSQLIVRFQRLVTEVLVEKRLGQRRPELTDELYQAWREV |
AF_2010_repII_A100DRAFT_10256971 | 3300000655 | Forest Soil | MNLDDSQLIVRFQRLVTEVLVEKRLGQRRPELTDE |
JGI1027J12803_1006616962 | 3300000955 | Soil | VVGVRMNSDDSRLIVRFQRLITEMLVEKQLGQRRPELTDEL |
JGI10216J12902_1101284521 | 3300000956 | Soil | MNMDDSRLIARFQRLITEILIEKRLGQRRPELTDEFYQTWL |
Ga0066388_1023092452 | 3300005332 | Tropical Forest Soil | MHMDDSRLIARFQRLTTELLIEKRLGQRRPELTDELYQTWIKLDQRGL |
Ga0066388_1044926073 | 3300005332 | Tropical Forest Soil | MRMNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLYQ |
Ga0066388_1070286533 | 3300005332 | Tropical Forest Soil | LEVPNSDFGAVVGVRMNMEDGWLIARFQRLITELLIEKELGQRRPELTDE |
Ga0070709_101984553 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDELYQTWARS* |
Ga0070714_1005505421 | 3300005435 | Agricultural Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDELYQTWR |
Ga0070714_1007174263 | 3300005435 | Agricultural Soil | MHIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDELYQTWR |
Ga0070713_1000675717 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIDDSRLFVRFQRLITEMLVEKRLGQRRPELTDELYQTWARS* |
Ga0070713_1019067701 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VLGVRMNIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDEL |
Ga0066691_102609602 | 3300005586 | Soil | MNIDDSRLIAQFQRLISEMLVEKRLGYRRPELTDE |
Ga0066905_1007497602 | 3300005713 | Tropical Forest Soil | MNMDDGQLIARFQRLTTELLIEKRLGQRRPELTDELYQTWLELDQRRLKESPEYR |
Ga0066903_1001142847 | 3300005764 | Tropical Forest Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDELYQTWRER* |
Ga0066903_1003944713 | 3300005764 | Tropical Forest Soil | MNIDDSRLIVRFQRLMTEMLVEKRLGQRRPGLTDD |
Ga0066903_1013733453 | 3300005764 | Tropical Forest Soil | ESRLIARFQRLTTELLIEKRLGQRRPELTDELYQTWLEVDQGGLNKTPSTETSC* |
Ga0066903_1032012452 | 3300005764 | Tropical Forest Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDL |
Ga0066903_1042676382 | 3300005764 | Tropical Forest Soil | MRGVRMNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDD |
Ga0066903_1046579322 | 3300005764 | Tropical Forest Soil | VRGVRMNIDDSRLIVRFQRLMTEMLVEKRLGQRRPGLTDD* |
Ga0066903_1058496451 | 3300005764 | Tropical Forest Soil | MNMDESQLIARFQRLTTELLIEKRLGQRRPELTDELYQTWLEVDQG |
Ga0066903_1076777281 | 3300005764 | Tropical Forest Soil | MNIDDSRLIVRFQRLLTEMLVEKRLGQRRLGLTDDL |
Ga0066903_1084209271 | 3300005764 | Tropical Forest Soil | MEDGRLIARFQRLTTELVIEKRLGRRRPELTDELYQ |
Ga0066903_1088829102 | 3300005764 | Tropical Forest Soil | MNIDDSRHCAVPTLDTEMLVEKRLGHRRPELTDELY |
Ga0066903_1088906991 | 3300005764 | Tropical Forest Soil | MNREDSRLIAQFQRLTTELLIEKRLGRRRPELTDELYRTWLE |
Ga0070716_1007765693 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDEL |
Ga0079222_123247262 | 3300006755 | Agricultural Soil | MRAQRVVVRFQRLITEMPVEKRLGHRRPELTDELYETSREA |
Ga0066653_105055412 | 3300006791 | Soil | MNIEDSWLIAPFQRFITEFLIEKRLGQRRPELTDEL |
Ga0075425_1011479342 | 3300006854 | Populus Rhizosphere | MNIDDSRLIVRFRRLITEMLVEKRLGQRRPELTDEL |
Ga0075424_1014513642 | 3300006904 | Populus Rhizosphere | MNIDDSRLIARFQGLIIEMLVERLLGERRPELADELYQ |
Ga0075424_1018642681 | 3300006904 | Populus Rhizosphere | VRFQRLITEMLVEKRLGQRRPELTDELYQTWARS* |
Ga0075435_1011907262 | 3300007076 | Populus Rhizosphere | MNIDDSRLIVRFRRLITEMLVEKRLGQRRPELTDELHQTW |
Ga0066709_1041140471 | 3300009137 | Grasslands Soil | MNMDDSRLIARFQRLTTELLIEKQLGPGRPELTSELYQTWLEAEQRGLKKT |
Ga0114129_116300441 | 3300009147 | Populus Rhizosphere | MNIDDSRLIVRFQGLIIEMLVEKQLGQRRPELTDEVYQTWRDV |
Ga0126373_110294541 | 3300010048 | Tropical Forest Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLYQT |
Ga0126373_133079011 | 3300010048 | Tropical Forest Soil | MNMDEIRLIARFQRLTTELLIEKRLGRRRSELTDELY |
Ga0126370_114292041 | 3300010358 | Tropical Forest Soil | MNIDDSRLIVRFQRLLTEMLVEKRLGQRRPGLTDDLYQM |
Ga0126378_106386852 | 3300010361 | Tropical Forest Soil | MNMDESRLIARFQRLTTELLIEKRLGQRRPELTDELYQTWLEVDQGGLNKT |
Ga0126378_112056091 | 3300010361 | Tropical Forest Soil | MNMNDSWLTARFQRLITELLIEKRLGQRRPELTDELYQTWLEVDQR |
Ga0126383_124823192 | 3300010398 | Tropical Forest Soil | MNMEDSRLIAQYQRLTTELLIEKRLGRRRPELTDELYR |
Ga0126383_133798761 | 3300010398 | Tropical Forest Soil | MNMEDSRLIAQLQRLTTELLIEKRLGRRRPELTDELYRTWL |
Ga0137364_111300221 | 3300012198 | Vadose Zone Soil | MDASRLIVRLQRLITEMLIEKRLGQRRPELTDELYQIWRE |
Ga0137376_115797392 | 3300012208 | Vadose Zone Soil | MNIDDSRLIVRFQRLITDMLVEKRLGQRRPELTDEVYQ |
Ga0137369_102325302 | 3300012355 | Vadose Zone Soil | MNMDDSRLIARFQRLTTELLIEKQLGQGRPELTSEVYQTWLEVEQ |
Ga0137371_106860351 | 3300012356 | Vadose Zone Soil | MNMDDGRLIAQFRRLITEMLVEKRLGQRRSELTDEL |
Ga0137384_112796461 | 3300012357 | Vadose Zone Soil | MNMEDSRLIARFQRLTTELLIEKQLGPGRPELTSEL |
Ga0137385_103318442 | 3300012359 | Vadose Zone Soil | MRMNIEDSWLIARFQRFITEFLIEKQLGQRRARS* |
Ga0137375_102071833 | 3300012360 | Vadose Zone Soil | MNMDDSRLIARFQRLITEILIEKRLGQRRPELTDEFYQTWLEVEQRGLKK |
Ga0126369_101267411 | 3300012971 | Tropical Forest Soil | MNIDDSRLIARFQRLITEMLIEKRLGPRRPELTDELYQAWREVERRG |
Ga0126369_112165131 | 3300012971 | Tropical Forest Soil | MNMEDSRLIAQFQRLTTELLIEKRLGRRRPELTDELYRSG* |
Ga0126369_115089481 | 3300012971 | Tropical Forest Soil | MNIDDSRLIVRFQRLMTEMLVEKRLGQRRPGLTDDL |
Ga0126369_136274902 | 3300012971 | Tropical Forest Soil | MNIDDSRLIVRFQRLMTEMLVEKRLGQRRPGLTDDLYQT |
Ga0132258_124832761 | 3300015371 | Arabidopsis Rhizosphere | MNMDDGGLIARFQRLTTELLIEKRLGRRRPELTDELYRT |
Ga0182036_108450442 | 3300016270 | Soil | MNMDDSRLIARFQRLTNELLVEKRLGQRRPELTDELCRTWLELDQ |
Ga0182041_102053541 | 3300016294 | Soil | MNMNDSWLTARFQRLITELLIEKRLGQRRPELTDELYQTWLEVD |
Ga0182041_106140362 | 3300016294 | Soil | MNMDESRLIARFQRLITELLIEKRLGQRRPELTDELY |
Ga0182041_110954281 | 3300016294 | Soil | MDDSWLTARFQRLITELLIEKRLGQRRPELTDELYQTWLEVD |
Ga0182033_100983214 | 3300016319 | Soil | MHGKDGRVPMNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLYQ |
Ga0182033_101461763 | 3300016319 | Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLYQTW |
Ga0182033_110657421 | 3300016319 | Soil | MDDSWLTARFQRLITELLIEKRLGQRRPELTDELYQTWLEVDQRGLKETPAYR |
Ga0182035_104710672 | 3300016341 | Soil | VRVRMNMDESRLIARFQRLITELLIEKRLGQRRPELTDELYQTW |
Ga0182035_117557981 | 3300016341 | Soil | MNMDESRLIARFQRLTTELLIEKRLGQRRPELTDELYQ |
Ga0182037_111213511 | 3300016404 | Soil | MNMDDSWLTARFQRLITELLIEKRLGQRRPELTDELYQTWLEVDQRGLKETP |
Ga0066667_110007311 | 3300018433 | Grasslands Soil | MNMDDSRLIARFQRLTTELLIEKQLGPGRPELTSELYQTWL |
Ga0210406_102681011 | 3300021168 | Soil | MNIDDSYLIVRFQRLITEMLVEKQLGQRRPELTDE |
Ga0213879_102160782 | 3300021439 | Bulk Soil | MNIDDSRLIARVQRLITEMLIEKRLGQRRPELTDELYHTW |
Ga0210392_102141064 | 3300021475 | Soil | MHIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDEL |
Ga0126371_100592379 | 3300021560 | Tropical Forest Soil | MNIDDSRLIVRFQCLITEMLVEKRLGQRRPGLTDDLYQTWR |
Ga0126371_106785521 | 3300021560 | Tropical Forest Soil | MNMDESRLIARFQRLTTELLIEKRLGQRRPELTDELYQAWLEVDQGGLNK |
Ga0207692_100104123 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDELYQ |
Ga0207692_100217461 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VRMNIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDEVYQTWARS |
Ga0207685_102495471 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIDDSRLITRFQRLITEMLVEKRLGQRRPELTDEVYQTWREVEQR |
Ga0207693_104817001 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNKDDSRLIVRFQRLITEMLVEIQLGQRRPELTDELY |
Ga0207693_106866411 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDELYQT |
Ga0207693_111765243 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LIVRFQRLITEMLVEKRLGQRRPELTDELYQTWARS |
Ga0207663_107405402 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MNIDDSQLIARFQGLITEMLVERRLGERRPELTDELY |
Ga0207664_118328561 | 3300025929 | Agricultural Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPELTDELYQTWAR |
Ga0209239_12052741 | 3300026310 | Grasslands Soil | MKLEDSRIIARFQCLMTGLMVAKRLGQRRPELTDELYQTWLEVDQRGLK |
Ga0307278_102387752 | 3300028878 | Soil | MNMDDSRLIARFQRLITEILIEKRLGQRRPELTDEFCQTWLEVEQ |
Ga0318516_102756802 | 3300031543 | Soil | MNMDESRLIARFQRLTTELLIEKRLGQRRPELTDELYQAWLQV |
Ga0318541_102574802 | 3300031545 | Soil | MNMNDSWLTARFQRLITELLIEKRLGQRRPELTDEL |
Ga0318538_100602231 | 3300031546 | Soil | MNMEDSRLIAQFQRLTTELLIEKRLGRRRPELTDELYRTWLEV |
Ga0318571_103584192 | 3300031549 | Soil | MNMDDSRLIARFQRLTTELLIEKRLGQRRPELTDELHQTWLEVDHRGLKETPEYQN |
Ga0318528_102791583 | 3300031561 | Soil | MNMGESRLIARFQRLTTELLIEKRLGQRRSELTDELYRTWGLSRPLLN |
Ga0318515_105085031 | 3300031572 | Soil | MEDSRLIAQFQRLTTELLIEKRLGRRRPELTDELY |
Ga0318561_101290141 | 3300031679 | Soil | MNMDDSRLIARFQRLTTELLIEKRLGQRRPELTGELCQ |
Ga0318561_102429412 | 3300031679 | Soil | MNIDDSRLIALFQRLTTELLIEKRLGRRRPELTDELY |
Ga0318561_103129751 | 3300031679 | Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLYQTWRE |
Ga0318574_105485732 | 3300031680 | Soil | MNMDESRLIARFQRLTTELLIEKRLGQRRPELTDELYQTWLEVDQ |
Ga0318572_106836271 | 3300031681 | Soil | MNMDESRLIARFQRLTTELLIEKRLGQRRSELTDELYQTWLEV |
Ga0306917_100797763 | 3300031719 | Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLY |
Ga0306917_108981132 | 3300031719 | Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLYQMWRE |
Ga0318493_103035121 | 3300031723 | Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLYQTWR |
Ga0318501_103130291 | 3300031736 | Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLYR |
Ga0318501_104418791 | 3300031736 | Soil | MDDSWLTARFQRLITELLIEKRLGQRRPELTDELYQTWLEVDQRGLKETPVP |
Ga0318509_102340052 | 3300031768 | Soil | MNMDESRLIARFQRLITELLIEKRLGQRRPELTDELYQTWLEV |
Ga0318526_103015602 | 3300031769 | Soil | MNMDDSRLIARFQRLTTELLIEKRLGQRRPELTDELHQTWLEVDHRGLKE |
Ga0318521_105993502 | 3300031770 | Soil | MNMEDSRLIAQFQRLTTELLIEKRLGRRRPELTDELYRTW |
Ga0318543_105250621 | 3300031777 | Soil | MDDSWLTARFQRLITELLIEKRLGQRRPELTDELYQTWLEVDQRGLKET |
Ga0318508_11132232 | 3300031780 | Soil | MDDSRLIARFQRLTTELLIEKRLGQRRPELTDELHQTWLEVDHRGLK |
Ga0318529_102741561 | 3300031792 | Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDD |
Ga0318567_103408811 | 3300031821 | Soil | MNMEDSRLIAQFQRLTTELLIEKRLGRRRPELTDE |
Ga0318567_107450011 | 3300031821 | Soil | MNMGESRLIARFQRLTTELLIEKRLGQRRSELTDELY |
Ga0306925_105603962 | 3300031890 | Soil | MDDSWLTARFQRLITELLIEKRLGQRRPELTDELYQ |
Ga0318551_104228371 | 3300031896 | Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLYQ |
Ga0318520_102946091 | 3300031897 | Soil | MNMDESRLIARFQRLTTELLIEKRLGQRRPELTDELYQTWLEVDQGGLNKTPEY |
Ga0306923_101670051 | 3300031910 | Soil | MHGKDGRVPMNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLYQT |
Ga0310912_104210502 | 3300031941 | Soil | MNIDDSRLIALFQRLTTELLIEKRLGRRRPELTDEL |
Ga0310916_102316383 | 3300031942 | Soil | MNMNDSWLTARFQRLITELLIETRLGQRRPELTDELYQ |
Ga0310913_103494992 | 3300031945 | Soil | MNMNDSWLTARFQRLITELLIEKRLGQRRPELTDELYQTW |
Ga0310909_114698281 | 3300031947 | Soil | MNIDDSLLIARFQLLITETLVEKRLGQRRPELTDELYQTWREVEQRGLK |
Ga0306926_110612741 | 3300031954 | Soil | MNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLYQMWREVGRR |
Ga0318569_104324091 | 3300032010 | Soil | MNIDDSRLIALFQRLTTELLIEKRLGRRRPELADELYK |
Ga0318507_101542171 | 3300032025 | Soil | MNMEDSRLIAQFQRLTTELLIEKRLGRRRPELTDELYRT |
Ga0318507_102145531 | 3300032025 | Soil | MNMDESRLIARFQRLTTELLIEKRLGQRRPELTDELYQTWLEVDQGGL |
Ga0318549_103885481 | 3300032041 | Soil | MNMDESRLIARFQRLITELLIEKRLGQRRPELTDELYQ |
Ga0318558_104550131 | 3300032044 | Soil | MEDSRLIAQFQRLTTELLIEKRLGRRRPELTDELYRTWLE |
Ga0318514_104577481 | 3300032066 | Soil | MNMDESRLIARFQRLTTELLIEKRLGQRRPELTDELYQAWLQVD |
Ga0310914_102358493 | 3300033289 | Soil | MHGKDGRVPMNIDDSRLIVRFQRLITEMLVEKRLGQRRPGLTDDLY |
Ga0310914_113546811 | 3300033289 | Soil | MDDSRLIARFQRLTTELLIEKRLGQRRPELTGELCQTWLKLDQRGL |
Ga0310914_114222771 | 3300033289 | Soil | MDDSWLTARFQRLITELVIEKRLGQRRPELTDELY |
Ga0318519_106288821 | 3300033290 | Soil | MNMDESRLIARFQRLITELLIEKRLGQRRPELTDELYQTWLE |
⦗Top⦘ |