NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070815

Metagenome / Metatranscriptome Family F070815

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070815
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 71 residues
Representative Sequence VGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTFPKELKIFDEGLEEHINSITGLFRSGDQC
Number of Associated Samples 72
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 8.93 %
% of genes near scaffold ends (potentially truncated) 25.41 %
% of genes from short scaffolds (< 2000 bps) 91.80 %
Associated GOLD sequencing projects 72
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (90.984 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(73.770 % of family members)
Environment Ontology (ENVO) Unclassified
(92.623 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(90.984 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.76%    β-sheet: 27.45%    Coil/Unstructured: 60.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF02992Transposase_21 7.38
PF13960DUF4218 2.46
PF13963Transpos_assoc 1.64



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.80 %
UnclassifiedrootN/A8.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005617|Ga0068859_102738496All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum542Open in IMG/M
3300005841|Ga0068863_102343313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300009092|Ga0105250_10350008All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum647Open in IMG/M
3300009101|Ga0105247_11243543All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum595Open in IMG/M
3300009972|Ga0105137_103645All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum696Open in IMG/M
3300009976|Ga0105128_107143All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum707Open in IMG/M
3300009976|Ga0105128_108673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum671Open in IMG/M
3300009981|Ga0105133_116200All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum622Open in IMG/M
3300009981|Ga0105133_118778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum598Open in IMG/M
3300009989|Ga0105131_102042All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1358Open in IMG/M
3300009989|Ga0105131_105422All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum970Open in IMG/M
3300009990|Ga0105132_113025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum735Open in IMG/M
3300009990|Ga0105132_122350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum633Open in IMG/M
3300009992|Ga0105120_1016896All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum774Open in IMG/M
3300009992|Ga0105120_1052551All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum517Open in IMG/M
3300009992|Ga0105120_1056590All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300009994|Ga0105126_1033128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum614Open in IMG/M
3300009995|Ga0105139_1050398All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum731Open in IMG/M
3300009995|Ga0105139_1077609All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum623Open in IMG/M
3300009995|Ga0105139_1105951All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum542Open in IMG/M
3300010371|Ga0134125_11474140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum741Open in IMG/M
3300010396|Ga0134126_12653006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300014326|Ga0157380_11681683All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum692Open in IMG/M
3300015270|Ga0182183_1029877All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum721Open in IMG/M
3300015270|Ga0182183_1051314All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum614Open in IMG/M
3300015273|Ga0182102_1005768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum859Open in IMG/M
3300015278|Ga0182099_1069293All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum513Open in IMG/M
3300015280|Ga0182100_1009397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1048Open in IMG/M
3300015280|Ga0182100_1060337All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum601Open in IMG/M
3300015280|Ga0182100_1090332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum521Open in IMG/M
3300015284|Ga0182101_1026477All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum777Open in IMG/M
3300015284|Ga0182101_1063277All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum591Open in IMG/M
3300015290|Ga0182105_1063646All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum608Open in IMG/M
3300015290|Ga0182105_1095511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum527Open in IMG/M
3300015290|Ga0182105_1103765All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300015293|Ga0182103_1005552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1187Open in IMG/M
3300015297|Ga0182104_1079941All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
3300015301|Ga0182184_1003299All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1491Open in IMG/M
3300015301|Ga0182184_1045075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum662Open in IMG/M
3300015306|Ga0182180_1045386All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum654Open in IMG/M
3300015306|Ga0182180_1057597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum602Open in IMG/M
3300015309|Ga0182098_1069512All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum625Open in IMG/M
3300015309|Ga0182098_1091392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum569Open in IMG/M
3300015310|Ga0182162_1051744All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum703Open in IMG/M
3300015310|Ga0182162_1103828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum547Open in IMG/M
3300015312|Ga0182168_1029417All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum873Open in IMG/M
3300015312|Ga0182168_1054563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum711Open in IMG/M
3300015313|Ga0182164_1088529All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum597Open in IMG/M
3300015313|Ga0182164_1129581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum515Open in IMG/M
3300015315|Ga0182120_1056095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum710Open in IMG/M
3300015316|Ga0182121_1027483All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum936Open in IMG/M
3300015317|Ga0182136_1007985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1291Open in IMG/M
3300015317|Ga0182136_1131870All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum517Open in IMG/M
3300015318|Ga0182181_1029668All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum796Open in IMG/M
3300015319|Ga0182130_1007084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1281Open in IMG/M
3300015319|Ga0182130_1016639All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1013Open in IMG/M
3300015319|Ga0182130_1100628All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum566Open in IMG/M
3300015320|Ga0182165_1127888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum533Open in IMG/M
3300015324|Ga0182134_1106086All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum574Open in IMG/M
3300015325|Ga0182148_1092944All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum599Open in IMG/M
3300015325|Ga0182148_1100114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum583Open in IMG/M
3300015326|Ga0182166_1010382All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1179Open in IMG/M
3300015326|Ga0182166_1018815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1002Open in IMG/M
3300015327|Ga0182114_1038440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum872Open in IMG/M
3300015327|Ga0182114_1074357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum689Open in IMG/M
3300015328|Ga0182153_1014916All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1111Open in IMG/M
3300015328|Ga0182153_1108462All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum577Open in IMG/M
3300015328|Ga0182153_1147508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300015329|Ga0182135_1042667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum813Open in IMG/M
3300015330|Ga0182152_1059174All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum729Open in IMG/M
3300015331|Ga0182131_1037787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum854Open in IMG/M
3300015332|Ga0182117_1026026All Organisms → Viruses → Predicted Viral1031Open in IMG/M
3300015333|Ga0182147_1081200All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum679Open in IMG/M
3300015334|Ga0182132_1055601All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum783Open in IMG/M
3300015334|Ga0182132_1132576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum558Open in IMG/M
3300015334|Ga0182132_1134509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum555Open in IMG/M
3300015335|Ga0182116_1047817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum859Open in IMG/M
3300015335|Ga0182116_1062310All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum779Open in IMG/M
3300015335|Ga0182116_1097762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum654Open in IMG/M
3300015335|Ga0182116_1103783All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum638Open in IMG/M
3300015336|Ga0182150_1061829All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum739Open in IMG/M
3300015336|Ga0182150_1144452All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300015337|Ga0182151_1145738All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300015338|Ga0182137_1061925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum780Open in IMG/M
3300015338|Ga0182137_1140151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum560Open in IMG/M
3300015339|Ga0182149_1102351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum628Open in IMG/M
3300015339|Ga0182149_1145453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum542Open in IMG/M
3300015340|Ga0182133_1102751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum658Open in IMG/M
3300015348|Ga0182115_1177784All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum682Open in IMG/M
3300015348|Ga0182115_1189160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum660Open in IMG/M
3300015349|Ga0182185_1210843All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum588Open in IMG/M
3300015349|Ga0182185_1247454All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300015352|Ga0182169_1157490All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum742Open in IMG/M
3300015352|Ga0182169_1285442All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum534Open in IMG/M
3300015352|Ga0182169_1302420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum516Open in IMG/M
3300015352|Ga0182169_1314846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum502Open in IMG/M
3300015353|Ga0182179_1110779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum829Open in IMG/M
3300015353|Ga0182179_1131530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum770Open in IMG/M
3300015354|Ga0182167_1156250All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum841Open in IMG/M
3300015354|Ga0182167_1165021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum816Open in IMG/M
3300015354|Ga0182167_1233221All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum667Open in IMG/M
3300015354|Ga0182167_1244536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum648Open in IMG/M
3300015354|Ga0182167_1268036All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum613Open in IMG/M
3300017691|Ga0182212_1068774All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum784Open in IMG/M
3300017691|Ga0182212_1073779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum757Open in IMG/M
3300017694|Ga0182211_1145939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum562Open in IMG/M
3300028139|Ga0268355_1001060All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1185Open in IMG/M
3300028149|Ga0268353_116565All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum547Open in IMG/M
3300028151|Ga0268308_1000622All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1810Open in IMG/M
3300028470|Ga0268307_1019561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300028472|Ga0268315_1010433All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum680Open in IMG/M
3300032591|Ga0214484_1024051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1223Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere73.77%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated13.11%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere5.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.46%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015318Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300028139Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028149Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028151Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028470Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028472Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028474Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028476Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068859_10273849613300005617Switchgrass RhizosphereVGATLTLPFALPGQITMSRIVIDGVHQHNMQSEVLIDDSIPNLHTILKELKIFDERLEEHINSITGLFRSGD*
Ga0068863_10234331313300005841Switchgrass RhizosphereQIMMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFQSGDQC*
Ga0068858_10210577013300005842Switchgrass RhizosphereMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEVLEEHINSITGLFWSRDQC*
Ga0105250_1035000813300009092Switchgrass RhizosphereVGATLTLPFALPEQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTFPKELKIIYEGPEEDINSITGLFRSRDQY*
Ga0105247_1124354323300009101Switchgrass RhizosphereMGATLTIPFALPGQITMSRIVIDGGHQHNMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFRS
Ga0105248_1315513023300009177Switchgrass RhizosphereTRNMSLKNSESNLDPSFALPGQITMSRIATDGGHQHSMQSEVLIDDNIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQY*
Ga0105137_10364523300009972Switchgrass AssociatedVGATLTLPFALPGQITMNRIVTNGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQC*
Ga0105128_10714313300009976Switchgrass AssociatedVGATLNLPFALPGQIMMSWIVTDGGHQHSMQSEVLIDDSIPNLHTLPKELKIIYEGLEKDINFITGLFRSGDQC*
Ga0105128_10867313300009976Switchgrass AssociatedVGANFTLPFALPGQIMMSQIVTDGGHQHSMQSEVLIDDSIPNLHTFPKVLKIFDEGLVEHINSITGLFRSGDQY*
Ga0105133_11620013300009981Switchgrass AssociatedMGATLTLPFALPGQIMMCRIVTDGGYQHSMQSEVLIDDSIPNDHTFPKELKIIYEGPEEHINSITRLFWSRDQC
Ga0105133_11877823300009981Switchgrass AssociatedMGATLILPFALPGQITMSRIVTNGGHQHSMQSEVFIDDSIPNHHTFPKELKIFDEGLEEHINSITGLFRSGDQC*
Ga0105131_10204213300009989Switchgrass AssociatedVGATLALPFALPGQITMSRIVTDGSHQHSMQSEVLIDDSIPNLHSFPKELKIFDERLEEHINSITGLFRSED*
Ga0105131_10542213300009989Switchgrass AssociatedVGATLTIPFALPGQITMSRVVTDGGHQHSMQSEVLIDDSIPNDHTFPKELEIIYEGSEEHINFITGLFRSRDQC*
Ga0105132_11302523300009990Switchgrass AssociatedALPGQITMSRIVTNGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFRFGDQC*
Ga0105132_12235023300009990Switchgrass AssociatedVGATLTLPFALTGQIMMSRIVTDGGHRHSMQSEVQIDDSMPNLHTMPKELKIIYAGLQEDINSITGL
Ga0105120_101689623300009992Switchgrass AssociatedVGATLTLPFALPGQITMSRIVIDGGHQHSMQSEVLIDNDIPNLHTFPKQLKIFDERLEEHINSITGLFQSGDQY*
Ga0105120_105255123300009992Switchgrass AssociatedVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITRLFQSGDQC*
Ga0105120_105659013300009992Switchgrass AssociatedVGATLTLPFALTGQITMSWIVTDGGHQHSMQSEVLVDDSIPNLHTLPKELKIIYEGLEKDINFITGLFRSGDQC*
Ga0105126_103312823300009994Switchgrass AssociatedVGATLTLPFALPGQIAMSQIITDGGHQHSMQSEALIDDSIPNLHTFPKKLKIIYEGPEEDINSITGLFRSRDQY*
Ga0105139_105039813300009995Switchgrass AssociatedVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSIIRLFRSGDQC*
Ga0105139_107760913300009995Switchgrass AssociatedVGATLTLPFALPGQITMSRVVTDGGHQHSMQSEVLIDDSIPNLHTLPKELKIIYEGLEEDINFITGLFWSGD*
Ga0105139_110595113300009995Switchgrass AssociatedLTLPFALPEQITMSRIVAYGGHQHSMQSEVLIDDSIPNLHTFPKELKIFDEGLEEHINSITGLFRSRDQC*
Ga0134125_1147414023300010371Terrestrial SoilVGATLTLPFALPGQITMSWIIIDGGHQHSMQTEALIDDSIPNLHTFPKELKIIYEGPEEDINSITGLFRSRDQY*
Ga0134126_1265300623300010396Terrestrial SoilVGATLTLPFALPGQITMSRIVTNGGHQHSMQSEVLIGDSIPNLHTIPKELKIFDEGLEEH
Ga0157380_1168168313300014326Switchgrass RhizosphereLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFLSRDQC*
Ga0182183_102987713300015270Switchgrass PhyllosphereVGETLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTFPKELKIFDEGLEEHINSITGLFRSG
Ga0182183_105131413300015270Switchgrass PhyllosphereVGATLTIPFALPGQITMSRVVTDGGHQHSMQSEVLIDDSIPNLHTLPKELKIIYEGLEEDINFITGLFRSRDQY*
Ga0182102_100576823300015273Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTFPKELKIFDEGLE
Ga0182099_106929313300015278Switchgrass PhyllosphereMSLTRNGAALTFSFALPGQIMMSRIITDGGHQHSMQSEALIDDIIPILHTFPKELKIIYEGLEEDINSIIGLFQFGDQC*
Ga0182100_100939733300015280Switchgrass PhyllosphereVGATLTLPFALPGQITMSWIVTDGVHQHSVQSEVLIDDSIPNLHTFPKELKIFDEGLEEHINSITGLFWCGDQC*
Ga0182100_106033713300015280Switchgrass PhyllosphereVGATLTLPFALPGQITMSWIITDCGHQHNTQGEVLIDDSIPKDHTYPKELEIIYEGPEEHINSITMLFRSREQC*
Ga0182100_109033223300015280Switchgrass PhyllosphereVGATLTLLFALPGQITMSRIVTDGGHQHSMQSEVLIDDSVPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQC*
Ga0182101_102647713300015284Switchgrass PhyllosphereVGATLTLPFALSGQITMSRIVIDGGHQHNMQSEVLIDDSITNLHTFPKELKIIYQGPKEHINSIIGLFQSRDQC*
Ga0182101_106327723300015284Switchgrass PhyllosphereVGATLTLPFALLGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQY*
Ga0182105_106364613300015290Switchgrass PhyllosphereVGATLTLPFALPGQITMSRVITDGGHQHSIQSEPLIDDSIPNLHTLPKELKIIYEGQEEDINFITGLFRFGD*
Ga0182105_109551113300015290Switchgrass PhyllosphereVGATLTLPFAMPGQNMMSRIITDGGHHHSMQSKMLIDDNIPNLHTFPKNLKIIYEGPKEHINSITRLFLSRDKC*
Ga0182105_110376523300015290Switchgrass PhyllosphereMFLTSSGSSLTLPFALPKQITMSRIVTGGGYQHRMQSEVLIDYSIPNLHTFPKELK
Ga0182103_100555223300015293Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQC*
Ga0182104_107994123300015297Switchgrass PhyllosphereVGATLTLPFALPEQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTLPKELKIIYEGQEEDINFITGLFRFRDQY*
Ga0182184_100329923300015301Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIQKELKIFDEGLEEHINSITGLFRSGDQC*
Ga0182184_104507513300015301Switchgrass PhyllosphereVGATLTLPFALPGQITMSWIITDCGHQHSTQGEVLIDDSIPKYHTYPKELEIIYEGPEEHINSITMLFRSREQC*
Ga0182180_104538613300015306Switchgrass PhyllosphereMPGQITMSRIVTNGGHQHSMQSEVLIDDSIPNDHTFPKELKIIYEGPKEHMNSITRLFRSRDQC*QH
Ga0182180_105759713300015306Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTFPKELKIFDEGLEEHINSITGLFRSGDQC*
Ga0182098_106951213300015309Switchgrass PhyllosphereVGATLTLPFALPGQITKSRIVTDGGHQHSMQSEVLIGDSIPNLHTIPKELKIFDEGLQEHINSITGLFRSGDQC*
Ga0182098_109139213300015309Switchgrass PhyllosphereMGATLILPFALPGQITMSWIVTDGVHQHSVQSEVLIDDSIPNLHTSPKELKIFDEGLEEHINSITGLFRCGDQC*
Ga0182162_105174413300015310Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDIIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQC*
Ga0182162_110382813300015310Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVNDGGHQHSMQSEVLIDDSIPNLHTFPKELKIFDEGLEEHINSITGLFRSGDQC*
Ga0182168_102941723300015312Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDIIPNLHNFPKELKIFDEGLEEHINSITGLFQSEDQC*
Ga0182168_105456323300015312Switchgrass PhyllosphereMGATLILPFALPGQIMMSRIVTDGGHKHNMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGFIWSGDQC*
Ga0182164_108852913300015313Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHCMQNEVLIDDSIPNLHTVPNELKIFDEGLEEHVNSITGLFRSGDQC*
Ga0182164_112958113300015313Switchgrass PhyllosphereVGATLTLPFSLPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHSIPKELKIFDEGLEEHINSITGLFRSGDQC*
Ga0182120_105609523300015315Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVFIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFWSGDQC*
Ga0182120_111753013300015315Switchgrass PhyllosphereMSRIVTDGGHQHSMQSEVLIDDSIPNLHTLPKELKIIYEGLEEDINFITGLFRSRD*
Ga0182121_102748313300015316Switchgrass PhyllosphereMGATLTLSFALPGEITMSRIVTDGGHQHSIQSEVLIDDSIPNLHTLPKELKIFYEGLEEDINSIIGLFQFGDQC*
Ga0182136_100798513300015317Switchgrass PhyllosphereVGATLTLPFALRGQIMMSRIVTDGGHRHSMQSEVRVDDSIPNLHTIPKELKIFDEGLEEHINSITGLFW
Ga0182136_113187013300015317Switchgrass PhyllosphereMSLTRNGAALTVSFALPGQIMMSRIITDGGHQHSMQSKMLIDDNIPNLHTFPKDLKIIYEGPKEHINSITRLFLSRDKC*
Ga0182181_102966833300015318Switchgrass PhyllosphereVGATLTLPFALPRQITMSQINTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQY*
Ga0182130_100708413300015319Switchgrass PhyllosphereVGATLTLPFALSGQIAMSQIITDGGHQHSMQSEALIDDSIPNLHTFPKELKIIYEGPKEHINSITGLFRSRDQY*
Ga0182130_101663933300015319Switchgrass PhyllosphereVGATLTLAFALPGQIMMSQIVTDGGHQHSMQSEVLIDDSIPNDHTFPKELKIIYEGPKEHMNSITRLFRSRDQC*
Ga0182130_110062823300015319Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVNDGGHQHSMQSEVLIDDSIPNLHTFPKELKIFDEGGGGRPPYTSGL
Ga0182165_112788813300015320Switchgrass PhyllosphereMSLTRNGAALTVSFALPGQIMMSRIITDGGHQHSMQSEALIDDSIPNLHTFPKELKIIYEGPKEHINSITRLFQSRDQC*
Ga0182134_110608613300015324Switchgrass PhyllosphereVGATLTLPFALPGQITISLIVTDGGHQHSMQSEALVDDSISNLHTFPKELKIIYEGPEEDINSITGLFRSRDQY*
Ga0182148_109294413300015325Switchgrass PhyllosphereVGATLTLPFALPGQIMMSRIVTDGGHQHSMQSEVLIDNSIPNLHTIPNELKIFDERLEEHINSISGLFRSGDQY*
Ga0182148_110011413300015325Switchgrass PhyllosphereVGATLTLPFALPRQIMMSRIVTDGGHQHSVQNEVLIDDSIPNLHTFPKELKIFDEGLE
Ga0182166_101038223300015326Switchgrass PhyllosphereMGATLTIPFALPGQITMSRVVTDGGHQHSMQSSVLIDDSIPNLHTLPKELKIIYEGLEEDINFITGLFRSGDQY*
Ga0182166_101881513300015326Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTNGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFWSGDQC*
Ga0182114_103844023300015327Switchgrass PhyllosphereVGATLTLPFALPGQITMSWIVTDGVHQHSVQSEVLIDDSIPNLHTSPKELKIFDEGLEEHINSITGLFRCGDQC*
Ga0182114_107435723300015327Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLVDDSIPNLHTLPKELKIIYEGLEEDINSIIGLFQFGDQC*
Ga0182153_101491613300015328Switchgrass PhyllosphereMGATLTIPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSISNLHTMPKELKIIYEGLQEDINSITGLFRSRDQC*
Ga0182153_110846213300015328Switchgrass PhyllosphereVGATLTLPFALTGQIMMSRIVTDGGHRHSMQSEVLVDDSIPNLHTLPKELKIIYEGLEEDINFITGLFRSGD*
Ga0182153_114750823300015328Switchgrass PhyllosphereVGAILTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHSFPKELKIFDEGLEEHINS
Ga0182135_104266723300015329Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTNGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQY*
Ga0182152_105917423300015330Switchgrass PhyllosphereVGATLTLPFALPGQIMMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEH
Ga0182152_111665523300015330Switchgrass PhyllosphereMMSQIITDRGHQHSMQTEALIDDSIPNLHTFPKELKIIYQGPKEHINSIIGLFQSR
Ga0182131_103778723300015331Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFEEGLEEHITSITGLFRSGDQY*
Ga0182117_102602613300015332Switchgrass PhyllosphereVGATLTLTFALPEQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTFPKELKIIYQGPKEHINSIIGLFQSRDQC*
Ga0182147_108120023300015333Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVIDGGHQHNMQSEVLIDDSIPNLHTLPKELKIFYEGLEEDINSIIGLFWSGNQC*
Ga0182132_105560113300015334Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFWSGDQC*
Ga0182132_113257613300015334Switchgrass PhyllosphereVGATLTLPFALPGQITMSQIVTDGGHQHNMQNEVLIDDSIPNLHTLSKELKIFYEGLEEDINSITWLFWSRDQC
Ga0182132_113450913300015334Switchgrass PhyllosphereVGATLNLPFALPVQIMMSRIITDGGHQHSMQSEVLIDDSISNPHTFPKELKIIYEGMEEDINSIIGLFQSGDQC*
Ga0182116_104781723300015335Switchgrass PhyllosphereVGATLTLPFALTGQITMSRIVTDGGHQYSMQSEVLVDDSIPNLHTLPKELKIIYEGLEEDINFITGLFRSRDQY*
Ga0182116_106231013300015335Switchgrass PhyllosphereVGATLTLPFALPGQITISQIVTDGGHQHSMQSEVQIDDSIPNLHTFQKEMKIFYEGLEEDINSITGLFRSGDQC*
Ga0182116_109776213300015335Switchgrass PhyllosphereVGATLTLPFALLGQITMSWIVTDGVHQHSVQSEVLIDDSIPNLHTSPKELKVFDEGLEEHINSITGLFWCGDQC*
Ga0182116_110378323300015335Switchgrass PhyllosphereMSLTRNGAALTVSFALPGQIMMSRIITDGGHQHSMQSEALIDDIIPILHTFPKELKIIYEGPKEHINSITRLFQSRDQC*
Ga0182150_106182923300015336Switchgrass PhyllosphereVGAISTLPYYDEPIVTDGGHQHSMQSEVLIDDSIPNDHTFPKELKIIYEGPEEHINSITRLFWSREQC*
Ga0182150_114445223300015336Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLF
Ga0182151_114573813300015337Switchgrass PhyllosphereVGATLTLPFALPGQITISQIVTDGGHQHSMQSEMLIDDSIPNLHTIPKELKIFDEGLEEHINS
Ga0182137_106192523300015338Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQNEVLIDDSIPNLHTFPKELKIFDEGLEEHINSITELFRSGDQC*
Ga0182137_114015113300015338Switchgrass PhyllosphereVGATLTLPFALSGQITMSRIVTDGGHQHCMQSEVLIDDSIPNLHTMPKELKIIYAGLQEDINSITGLFRSRDQC*
Ga0182149_110235123300015339Switchgrass PhyllosphereLTLPFALPEQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHSFPKELKIFDEGLEEHINSITELFRSGDQC*
Ga0182149_114545313300015339Switchgrass PhyllosphereMGATLILPFALPGQITMSWIVTDGGHQHSMQSEVLVDDSIPNLHTLPKELKIIYEGLEEDINFITGLFRSGGQC*
Ga0182133_110275123300015340Switchgrass PhyllosphereVGATLTLPFALPGQIMMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGFFWSGDQC*
Ga0182133_116851013300015340Switchgrass PhyllosphereRIVTGGGHQHSMQSEVLIDYSIPNLHTFPKELKTFDEGLEEHINSITGLFRSGDQY*
Ga0182115_117778413300015348Switchgrass PhyllosphereVGATLTLPFALPGQITMSWIITECGHQHSTQGEVLIDDSIPKAHTFPKESEIIYEGPEEHINSITR
Ga0182115_118916023300015348Switchgrass PhyllosphereMGATLTIPFALPEQITMSRVVTDGGHQHSMQSEVLIDDSIPNLHTMPKELKIIYEGLQEDINSITGLFQSGDQC*
Ga0182185_121084313300015349Switchgrass PhyllosphereVGATLTIHFALPGQITMSRVVTDGGHQHSMQSEVLIDDIIPNLHTLPKELKIIYEGLEEDINFITGLFRSRDQY*
Ga0182185_124745413300015349Switchgrass PhyllosphereTKSRIVTDGGHQHSMQSEVLIDDIIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQC*
Ga0182169_115749013300015352Switchgrass PhyllosphereVGATLTLPFALPGQITMSRIVTNGGHQHSMQSEVLIGDSIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQC*
Ga0182169_128544213300015352Switchgrass PhyllospherePFALPGQITMSRVVTDGGHQHSMQSEVLIDDIIPNLHTLPKELKIIYEGLEEDINFITGLFRSGDQY*
Ga0182169_130242013300015352Switchgrass PhyllosphereVGATLTLPFALSGQIAMSRIITDGGHQHSMQSEALIDDNIPNLHTFPKELKIIYEGPEEDINSITGLFWSTDQ*
Ga0182169_131484613300015352Switchgrass PhyllosphereMGATLTLSFALPGEITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFNEGLEEHINSITG
Ga0182179_111077923300015353Switchgrass PhyllosphereGATLTLPFALPGQIMMSQIVTDGGHQHSMQSEVLIDDSIPNLHTFPKELKIFDEGLEEHINSITGLFRFGDQW*
Ga0182179_113153013300015353Switchgrass PhyllosphereVGATVTLPFALPGQITMSWIITDCGHQHSTQGEVLIDDSIPKDHTYPKELEIIYEGPEEHINSITMLFRSREQC*
Ga0182167_115625013300015354Switchgrass PhyllosphereMSLTRNGAALTFSIALPGQIMMSRIITDGGHQHSMQSEALIGDSIPILHTFPKELKIFYEGPKEHINSITRL
Ga0182167_116502133300015354Switchgrass PhyllosphereVGATLTLPFALPKQITMSRIVTGGGHQHSMQSEVLIDDSIPNLHTFPKELKIFDEGLEEH
Ga0182167_123322123300015354Switchgrass PhyllosphereVGATLTLPFALPGQITMSWIIIDGGHQHSMQTEALIDDSIPNLHTFPKELKIIYQGPKEHINYHWVVSV*
Ga0182167_124453613300015354Switchgrass PhyllosphereVGATLTIPFALPRQIMMSRVVTDGGHQHSMQSEVLIDDSIPNLHTLPKELKIIYEGLEEDINFITGLFRSGD*
Ga0182167_126803623300015354Switchgrass PhyllosphereLNLPFALPGQIMMNRIVSDGGHQHSMQSEALIDDNIPNLHTFPKELKIIYEGPEEDINSITGLFRSRDQY*
Ga0182200_115795023300017439Switchgrass PhyllosphereMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFLS
Ga0182212_106877413300017691Switchgrass PhyllosphereVGATLTLPFALPGQITKSRIVIDGGHQHSMQSEVLIDDNIPNLHTFLKELKIFNEELEEHINSITGLF
Ga0182212_107377913300017691Switchgrass PhyllosphereVGATLTLPFALPEQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQC
Ga0182216_110638523300017693Switchgrass PhyllosphereMSRITTDGGHQHSMQSEALIDDSIPNLHTFPKELKIIYQGPKEHINSITGLFQSRDQCXQ
Ga0182211_114593913300017694Switchgrass PhyllosphereMGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDESIPNLHTIPKELKIFDEGLEEHINSIIGLF
Ga0268355_100106023300028139PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTFPTELKIFDEGLEEHINSITGLFRSGDQC
Ga0268353_11656513300028149PhyllosphereVGATLTLPFALPGQIMMSRIVTDGGHQHSMQSEVLIDDSIPNLHTFPKELKIFDKGLEEHINSITGLFRSGDQC
Ga0268308_100062223300028151PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSINGLFRS
Ga0268307_101956113300028470PhyllosphereVGATLTLPFALPGQITMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQC
Ga0268315_101043333300028472PhyllosphereIMMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFQSGDQC
Ga0268331_100754823300028474PhyllosphereMSRIVTDGGHQHSMQSEVLIDDSIPNLHTIPNELKIFDERLEEHINSI
Ga0268329_100790423300028476PhyllosphereMMSQIVTDGGHQHSMQSEVLIDDSIPNLHTIPKELKIFDEGLEEHINSITGLFRSGDQC
Ga0214484_102405133300032591Switchgrass PhyllosphereVGATLTLPFALPGQITMSLIVTDGGHQHSMQSEVIIDDSIPNLHSFPKELKIFEEGLEEHINSITGLFRSRNQC
Ga0214494_100631953300032699Switchgrass PhyllosphereMSRIVTDGGHQHSMQSEVIIDDSIPNLHSFPKELKIFEEGLEEHINSITGLFRSRNQC


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.