NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F070953

Metagenome / Metatranscriptome Family F070953

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F070953
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 44 residues
Representative Sequence MLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALR
Number of Associated Samples 100
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.54 %
% of genes near scaffold ends (potentially truncated) 99.18 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.15

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.066 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil
(30.328 % of family members)
Environment Ontology (ENVO) Unclassified
(54.918 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(64.754 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.15
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.07 %
UnclassifiedrootN/A13.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004467|Ga0068978_1235359All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila605Open in IMG/M
3300004468|Ga0068977_1007747All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila768Open in IMG/M
3300004470|Ga0068967_1327204All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila753Open in IMG/M
3300004505|Ga0068941_1153333All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300004598|Ga0068975_1262204All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila761Open in IMG/M
3300004599|Ga0068933_1269552All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila816Open in IMG/M
3300004609|Ga0068958_1003487All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila622Open in IMG/M
3300004615|Ga0068926_1000900All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila761Open in IMG/M
3300004964|Ga0072331_1003619All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
3300005640|Ga0075035_1015416Not Available608Open in IMG/M
3300006860|Ga0063829_1004127All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila707Open in IMG/M
3300006861|Ga0063777_1025703All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila581Open in IMG/M
3300010164|Ga0063827_137540All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila803Open in IMG/M
3300010859|Ga0126352_1083185All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila576Open in IMG/M
3300010860|Ga0126351_1075043All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila654Open in IMG/M
3300010860|Ga0126351_1190932All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila672Open in IMG/M
3300010877|Ga0126356_10913854All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila625Open in IMG/M
3300011017|Ga0138558_116923All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila741Open in IMG/M
3300011021|Ga0138529_122910All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila814Open in IMG/M
3300011024|Ga0138530_112337All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila718Open in IMG/M
3300011028|Ga0138577_138800All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila801Open in IMG/M
3300011039|Ga0138593_155476All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila795Open in IMG/M
3300011040|Ga0138587_145910All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila807Open in IMG/M
3300011043|Ga0138528_116494All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila704Open in IMG/M
3300011044|Ga0138545_164057All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila510Open in IMG/M
3300011045|Ga0138598_138497All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila643Open in IMG/M
3300011047|Ga0138553_164681All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila590Open in IMG/M
3300011050|Ga0138571_178488All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila783Open in IMG/M
3300011051|Ga0138540_133439All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila797Open in IMG/M
3300011056|Ga0138538_1086491Not Available544Open in IMG/M
3300011058|Ga0138541_1038370All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila791Open in IMG/M
3300011060|Ga0138583_1066021All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila540Open in IMG/M
3300011063|Ga0138537_1118794All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila765Open in IMG/M
3300011069|Ga0138592_1000812All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila765Open in IMG/M
3300011072|Ga0138563_1035301Not Available621Open in IMG/M
3300011073|Ga0138584_1153230Not Available665Open in IMG/M
3300011074|Ga0138559_1114342All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila811Open in IMG/M
3300011075|Ga0138555_1117836Not Available578Open in IMG/M
3300011075|Ga0138555_1139441All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila603Open in IMG/M
3300011078|Ga0138565_1069978All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila628Open in IMG/M
3300011080|Ga0138568_1133376Not Available645Open in IMG/M
3300011120|Ga0150983_14007061All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia601Open in IMG/M
3300011120|Ga0150983_16645876All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila836Open in IMG/M
3300011305|Ga0138532_1021833All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila619Open in IMG/M
3300012411|Ga0153880_1054840All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila811Open in IMG/M
3300012411|Ga0153880_1190609All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila603Open in IMG/M
3300012411|Ga0153880_1371308All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila752Open in IMG/M
3300012411|Ga0153880_1392421All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila748Open in IMG/M
3300014156|Ga0181518_10470962All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila598Open in IMG/M
3300016700|Ga0181513_1015968All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia507Open in IMG/M
3300016700|Ga0181513_1153222All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila719Open in IMG/M
3300016701|Ga0181509_1152375All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila546Open in IMG/M
3300016701|Ga0181509_1182246Not Available540Open in IMG/M
3300016701|Ga0181509_1314470All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila526Open in IMG/M
3300016705|Ga0181507_1218677All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila798Open in IMG/M
3300016705|Ga0181507_1223566All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila624Open in IMG/M
3300016705|Ga0181507_1224250All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia608Open in IMG/M
3300016750|Ga0181505_10539724All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila751Open in IMG/M
3300016750|Ga0181505_10726370All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila816Open in IMG/M
3300019158|Ga0184580_103365All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila805Open in IMG/M
3300019163|Ga0184581_119867All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila783Open in IMG/M
3300019177|Ga0184592_118250All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300019179|Ga0184593_112424All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila782Open in IMG/M
3300019181|Ga0184594_127766All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila769Open in IMG/M
3300019185|Ga0184587_103936All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila770Open in IMG/M
3300019188|Ga0184599_118589All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia653Open in IMG/M
3300019189|Ga0184585_151452All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila806Open in IMG/M
3300019192|Ga0184603_100225All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila732Open in IMG/M
3300019240|Ga0181510_1034399All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia698Open in IMG/M
3300019240|Ga0181510_1113297All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila581Open in IMG/M
3300019240|Ga0181510_1287080All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila591Open in IMG/M
3300019242|Ga0181502_1048411All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia527Open in IMG/M
3300019256|Ga0181508_1633886All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia610Open in IMG/M
3300019258|Ga0181504_1075806All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia718Open in IMG/M
3300019258|Ga0181504_1215675All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila555Open in IMG/M
3300019260|Ga0181506_1148436Not Available575Open in IMG/M
3300019260|Ga0181506_1182848All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia747Open in IMG/M
3300019260|Ga0181506_1447133All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia586Open in IMG/M
3300019268|Ga0181514_1144521All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia749Open in IMG/M
3300019268|Ga0181514_1443626Not Available780Open in IMG/M
3300019270|Ga0181512_1032183All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia747Open in IMG/M
3300019275|Ga0187798_1030555All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila762Open in IMG/M
3300019275|Ga0187798_1248352All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila712Open in IMG/M
3300019275|Ga0187798_1501721Not Available794Open in IMG/M
3300019284|Ga0187797_1849801Not Available663Open in IMG/M
3300021858|Ga0213852_1270536All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila543Open in IMG/M
3300021860|Ga0213851_1812339All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila754Open in IMG/M
3300022498|Ga0242644_1011556All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila800Open in IMG/M
3300022499|Ga0242641_1015284Not Available732Open in IMG/M
3300022501|Ga0242645_1022304All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila568Open in IMG/M
3300022507|Ga0222729_1017959Not Available813Open in IMG/M
3300022508|Ga0222728_1027034Not Available866Open in IMG/M
3300022512|Ga0242676_1035274Not Available579Open in IMG/M
3300022513|Ga0242667_1038198All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia574Open in IMG/M
3300022522|Ga0242659_1045718Not Available761Open in IMG/M
3300022523|Ga0242663_1057876All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila698Open in IMG/M
3300022532|Ga0242655_10132771All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila715Open in IMG/M
3300022709|Ga0222756_1088352All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila516Open in IMG/M
3300022711|Ga0242674_1017996All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila804Open in IMG/M
3300022711|Ga0242674_1018257Not Available800Open in IMG/M
3300022712|Ga0242653_1032009All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila792Open in IMG/M
3300022713|Ga0242677_1057144All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia586Open in IMG/M
3300022714|Ga0242671_1032483All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila796Open in IMG/M
3300022720|Ga0242672_1038244All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia761Open in IMG/M
3300022722|Ga0242657_1074538All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila794Open in IMG/M
3300023539|Ga0247555_101197All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila782Open in IMG/M
3300023547|Ga0247554_102767All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila666Open in IMG/M
3300023558|Ga0247526_110283All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila805Open in IMG/M
3300028573|Ga0265334_10101748All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1040Open in IMG/M
3300030535|Ga0210285_1453168All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila760Open in IMG/M
3300030586|Ga0265393_1029548All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila891Open in IMG/M
3300030589|Ga0210255_10846181All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila792Open in IMG/M
3300030743|Ga0265461_10566788All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila966Open in IMG/M
3300030762|Ga0265775_103746All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila831Open in IMG/M
3300030863|Ga0265766_1005447All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila808Open in IMG/M
3300030880|Ga0265776_102923All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila810Open in IMG/M
3300030880|Ga0265776_113272All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila510Open in IMG/M
3300030978|Ga0265757_102854All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila812Open in IMG/M
3300031018|Ga0265773_1010523All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila782Open in IMG/M
3300031591|Ga0310116_113445All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila735Open in IMG/M
3300031866|Ga0316049_105892All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila814Open in IMG/M
3300034652|Ga0316598_139946All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila679Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil30.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland18.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.39%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment3.28%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland3.28%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil3.28%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.64%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.64%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.82%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.82%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.82%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004467Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 75 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004468Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004470Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 59 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004505Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 29 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004598Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004599Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004609Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004615Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 11 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004964Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 77 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300005640Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_052 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006860Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006861Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010164Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010860Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011017Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 39 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011021Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 7 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011024Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 8 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011028Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 64 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011039Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 20 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011040Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 79 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011043Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011044Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 26 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011045Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 66 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011047Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011050Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 56 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011051Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011056Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 16 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011058Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011060Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011063Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011069Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011072Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011073Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011074Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011075Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011078Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011080Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 53 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011305Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300012411Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300016700Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016701Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019158Soil microbial communities from Bohemian Forest, Czech Republic ? CSI1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019163Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019177Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019179Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019181Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZI3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019185Soil microbial communities from Bohemian Forest, Czech Republic ? CSE2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019188Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019189Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019192Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZA3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019242Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019260Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019275Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022498Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022499Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022501Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022508Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-19-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022512Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022513Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022522Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022711Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022720Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023539Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023547Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023558Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300030535Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO749-VDE026SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030586Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE041SO (Eukaryote Community Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300030589Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR019SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030762Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030863Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030880Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030978Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSA4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031018Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031591Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031866Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300034652Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068978_123535923300004467Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCFRRGFQA
Ga0068977_100774723300004468Peatlands SoilMLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHTAALRLF
Ga0068967_132720423300004470Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFQAA
Ga0068941_115333313300004505Peatlands SoilMLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHTAALRL
Ga0068975_126220423300004598Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFHAAALR
Ga0068933_126955213300004599Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAALRLF
Ga0068958_100348723300004609Peatlands SoilMLPFDRGFTRIEGEGGTSCRRPFPGCPGLSQSCSRRVFHAAALRL
Ga0068926_100090023300004615Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAALR
Ga0072331_100361923300004964Peatlands SoilMLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHTAALRLFY
Ga0075035_101541613300005640Permafrost SoilVIVPFDSGFTHSEGEGGTSCHHPFPGHPGLSQSCS
Ga0063829_100412713300006860Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRR
Ga0063777_102570313300006861Peatlands SoilVISPIDRGFTRIAGEGGTSCRRPFPGRPGLSQSCSRRVFHAAALRLF
Ga0063827_13754013300010164Peatlands SoilMLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHTAALR
Ga0126352_108318513300010859Boreal Forest SoilVPVDCGYIRLEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF
Ga0126351_107504313300010860Boreal Forest SoilVPVDCGYIRLEGEGGTSCHRPFPGHPGLSQSCFRRGFQTAELRL
Ga0126351_119093213300010860Boreal Forest SoilVPFDSGFTHSEGEGGTSCHLPFPGHQGLSQSCSRRVFHTAAPRL
Ga0126356_1091385413300010877Boreal Forest SoilVPFDCGFTRPEGDGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF
Ga0138558_11692323300011017Peatlands SoilMLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHT
Ga0138529_12291013300011021Peatlands SoilMLPFDTGFTRFEGEDGTSCHPPFPGNPGLSQSCSRRIFHTAALRL
Ga0138530_11233713300011024Peatlands SoilVILPADRGFTRIEGEGGTSCHLPFPGRPGLSQPCSRRVFHAAALRLF
Ga0138577_13880023300011028Peatlands SoilMLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRR
Ga0138593_15547613300011039Peatlands SoilMLPFDTGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFH
Ga0138587_14591013300011040Peatlands SoilMLPFDTGFTRFEGEDGTSCHPPFPGRPRLSQSCSRRIFHTAALRL
Ga0138528_11649413300011043Peatlands SoilVILPADRGFTRIEGEGGTSCHLPFPGRPGLSQPCSRRVFHAAALR
Ga0138545_16405713300011044Peatlands SoilVILPADRGFTRIEGEGGTSCHLPFPGRPGLSRPRSRRVFQAAAL
Ga0138598_13849713300011045Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQPCFRRGFQAFTLRL
Ga0138553_16468123300011047Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFHAAAL
Ga0138571_17848823300011050Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLPQSCSRRVFQAAALR
Ga0138540_13343913300011051Peatlands SoilVISPIDRGFTRIAGEGGTSCRRPFPGRPGLSQSCSRRIFHTAALRLF
Ga0138538_108649113300011056Peatlands SoilVPVDCGFIRLEGEGGTSCHRPFPGHPGLSQPCFRR
Ga0138541_103837023300011058Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVF
Ga0138583_106602113300011060Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQPCFRRGFQASALRL
Ga0138537_111879413300011063Peatlands SoilMLPFDRGFTRIEGEGGTSCRRPFPGCPGLSQSCSRRIFHSSALRLF
Ga0138592_100081213300011069Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRIFHTAALRL
Ga0138563_103530113300011072Peatlands SoilVPFDCGFTRLEGDGDTSCHRPFPGHPGLSQSCSRRVFHTAA
Ga0138584_115323013300011073Peatlands SoilVPFDCGFTRLEGDGDTSCHRPFPGHPGLSQSCSRRGFQAFALRLF
Ga0138559_111434213300011074Peatlands SoilVISPIDRGFTRIAGEGGTSCRRPFPGRPGLSQSCSRRVFHAAALRLFYQ
Ga0138555_111783613300011075Peatlands SoilVPFDCGFTRLEGDGDTSCHRPFPGHPGLSQSCSRRGFQAFALRL
Ga0138555_113944113300011075Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRVFQ
Ga0138565_106997823300011078Peatlands SoilMLPFDRGFTRTEGDDGTSCHRPFPGRPGLSQSCSRRIFHTAALRLF
Ga0138568_113337623300011080Peatlands SoilVPFDCGFIRLEGEGDTSCHLPFPGHPGLSQSCSRRVFHTAAPRLF
Ga0150983_1400706113300011120Forest SoilVPFDCGFIRLEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRL
Ga0150983_1664587623300011120Forest SoilMLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALRLLPR
Ga0138532_102183313300011305Peatlands SoilVPVDCGFIRLEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF
Ga0153880_105484013300012411Freshwater SedimentVILPADRGFTRIGGDGGTSCRLPFPGHPGLSQSCFRRVFHAAALRLF
Ga0153880_119060913300012411Freshwater SedimentMTPAEELVMLPFDRGFTRSEGDGGTSCHRPFPGRPGLSQSCIRRVFQAAALRL
Ga0153880_137130813300012411Freshwater SedimentVILPVDHGFTRIGGEDGTSCRLPFPGHPGLSQSCFRRVFHAAALRLFY
Ga0153880_139242113300012411Freshwater SedimentVPVDRGFTRIEGDGGTSCRRPFPGHPGLSQSCSRRVFHTAALRLF
Ga0181518_1047096223300014156BogMLPFDRGFTRFEGEDGTSCHPPFPGRPGLSQSCSRRIFHT
Ga0181513_101596813300016700PeatlandMLPFDRGFTRAEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAA
Ga0181513_115322213300016700PeatlandVILPADRGFTRIEGEGGTSCHLPFPGRPGLSQSCSRRVFHAAAL
Ga0181509_115237513300016701PeatlandMLPFDRGFTRFGGEGGTSCHRPFPGCPGLSQSCSRRVFHAAALR
Ga0181509_118224613300016701PeatlandMLPFDRGFTRFEGEGGTSCHHPFPGRPGLSQSCSRRVF
Ga0181509_131447013300016701PeatlandVILPADRGFTRIEGEGGTSCHLPFPGRPGLSQSCSRRVFHAAALRL
Ga0181507_121867713300016705PeatlandVILPADRGFTRIEGEGGTSCHLPFPGRPGLSQSCSRRVFHAAALRLLDR
Ga0181507_122356623300016705PeatlandMLPFDRGFTRAEGDGGTSCHRPFPGRPGLSQSCSRRVFQAAALRLRRNAVY
Ga0181507_122425013300016705PeatlandMLPFDRGFTRAEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAALRLR
Ga0181505_1053972413300016750PeatlandVILPADRGFTRIEGEGGTSCHLPFPGRPGLSQSCSRRVFHTA
Ga0181505_1072637023300016750PeatlandMLPFDRGFTRFGGEGGTSCHRPFPGCPGLSQSCSRRVFHAA
Ga0184580_10336513300019158SoilMLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALR
Ga0184581_11986713300019163SoilMLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRR
Ga0184592_11825013300019177SoilMLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALR
Ga0184593_11242413300019179SoilMLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSR
Ga0184594_12776613300019181SoilMLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALRLF
Ga0184587_10393623300019185SoilMLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVF
Ga0184599_11858913300019188SoilVPFDCGFIRLEGEGGTSCHLPFPGHPGLSQSCSRRVFHTAAPR
Ga0184585_15145213300019189SoilMLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHPAALR
Ga0184603_10022513300019192SoilVPFDCGFIRLEGEGGTSCHLPFPGHPGLSQSCSRRVFHTAAPRLF
Ga0181510_103439913300019240PeatlandVPCDNGLTHSEGEGGTSCHHPFPGHPGLSQSCSRRVFHTAA
Ga0181510_111329713300019240PeatlandVPFDLGFTRFEGDGGTSCHRPFPGHPGLSQSCSQRVFHTAALRLF
Ga0181510_128708013300019240PeatlandMLPFDRGFTRAEGDGGTSCHRPFPGRPGLSQSCSRRVFQAAA
Ga0181502_104841113300019242PeatlandMLPFDRGFTRAEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAALRLFYQG
Ga0181508_163388613300019256PeatlandMLPFDRGFTRAEGDDGTSCHRPFPGRPGLSQSCSRRVFQAAALRLF
Ga0181504_107580613300019258PeatlandVPCDNGLTHSEGEGGTSCHHPFPGHPGLSQSCSRRVFHT
Ga0181504_121567513300019258PeatlandMTPAEELVILPFDRGFARSEGDGGTSCHRPFPGRPGLSQSCSRRVFQAAAPR
Ga0181506_114843623300019260PeatlandVPFDLGFTRFEGDGGTSCHRPFPGHPGLSQSCSQRVFHTAALR
Ga0181506_118284813300019260PeatlandVPCDNGLTHSEGEGGTSCHHPFPGHPGLSQSCSRRVFHTAAPR
Ga0181506_144713313300019260PeatlandMLPFDRGFTRAEGDGGTSCHRPFPGRPGLSQSCSRRVF
Ga0181514_114452113300019268PeatlandVPCDNGLTHSEGEGGTSCHHPFPGHPGLSQSCSRRVFHTAAPRL
Ga0181514_144362613300019268PeatlandVPFDLGFTRFEGDGGTSCHSPFPGHPGLSQSCSQRVFHTAALR
Ga0181512_103218313300019270PeatlandVPCDNGLTHSEGEGGTSCHHPFPGHPGLSQSCSRRVFHTAALR
Ga0187798_103055513300019275PeatlandMLPIDRGFTRAAGEGGTSCRLPFPGCPGSSQSCSRRIFHIAALRL
Ga0187798_124835213300019275PeatlandVMVPSDRGLTRIEGGGGTSCRRPFPGHPGLSQSCSRRVFHAAALRLFY
Ga0187798_150172113300019275PeatlandMVPCDSGFTRFEGGGGTSCRRPFPGHPGLSQSCSRRVFH
Ga0187797_184980113300019284PeatlandMPAECGFARFGGEGGTSRRRPFPGRPGLSQPGTRRVFHAAAPRL
Ga0213852_127053613300021858WatershedsMTPAEELVILPFDRGFTRSEGDGGTSCHRPFPGRPGLSQSCSRRVFQAA
Ga0213851_181233913300021860WatershedsMLPFDLGFTRFEGEGDTSCHRPFPGRPGLSQSCSRRVFHTA
Ga0242644_101155613300022498SoilVIFACRIRAFARLEGEGGTSCRRPFPGRPGLSQPCSRRGFQTAALRL
Ga0242641_101528413300022499SoilVPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPRL
Ga0242645_102230413300022501SoilVPCDSGLTHSEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPR
Ga0222729_101795913300022507SoilVPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF
Ga0222728_102703423300022508SoilVPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFRTAAPRLF
Ga0242676_103527423300022512SoilVPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPR
Ga0242667_103819813300022513SoilVPFDRGFIRLEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF
Ga0242659_104571813300022522SoilVPYDSGLTRSEGDDGTSCHRPFPGNPGLSQSCSLRVFHTA
Ga0242663_105787613300022523SoilVPFDCGFIRIEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF
Ga0242655_1013277113300022532SoilVIFACRIRAFARLEGEGGTSCRRPFPGRPGLSQPCSRRGFQNAAL
Ga0222756_108835223300022709SoilVPFDRGLIRFEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF
Ga0242674_101799613300022711SoilVIFACRIRAFARLEGEGGTSCRRPFPGRPGLSQPCSRRGFQTAALR
Ga0242674_101825713300022711SoilVPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAA
Ga0242653_103200913300022712SoilVIFACRIRAFARLEGEGGTSCRRPFPGRPGLSQPCSRRGFQTAALRLF
Ga0242677_105714413300022713SoilVIVPFDRGLIRFEGEGGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLF
Ga0242671_103248323300022714SoilVPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLFYQ
Ga0242672_103824423300022720SoilVPFDCGFIRLEGEGDTSCHRPFPGHPGLSQSCSRRVFHTAAPR
Ga0242657_107453823300022722SoilVPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLFYQGT
Ga0247555_10119713300023539SoilMLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHPAALR
Ga0247554_10276713300023547SoilMLPSDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAA
Ga0247526_11028313300023558SoilMLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAAL
Ga0265334_1010174823300028573RhizosphereMLPFDRGLTRAEGEGGTSCHHPFPGRPGLSQSRSRRVFHTAALRLFYQGTLRS
Ga0210285_145316813300030535SoilVPYDSGLTRSEGDDGTSCHRPFPGHPGLSQSCSRRVFHTAAPRLFYQG
Ga0265393_102954813300030586SoilMLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCFRRVFQAFALRLFYQ
Ga0210255_1084618113300030589SoilMLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHPAALRLFYQ
Ga0265461_1056678813300030743SoilMLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHPAALRLFY
Ga0265775_10374613300030762SoilVILPFDCGFTRTEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALRLF
Ga0265766_100544713300030863SoilMLPFDSGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRVFHPAALRL
Ga0265776_10292313300030880SoilVILPFDCGFTRTEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALR
Ga0265776_11327213300030880SoilVPCDSGFTHSEGEDGTSCHLPFPGHPGLSQSCSRRVFHTAAPRLF
Ga0265757_10285413300030978SoilVILPFDCGFTRTEGEGGTSCHLPFPGRPGLSQSCSRRVFHTAALRL
Ga0265773_101052313300031018SoilVILPFDCGFTRTEGEGGTSCHLPFPGRPGLCQSCSRRVFHTAAL
Ga0310116_11344513300031591SoilVILPFDCGFTRTEGEGGTSCHLPFPGRPGLSQSCFRRVFQAFALRLF
Ga0316049_10589213300031866SoilMLPFDRGFTRSEGEGGTSCHLPFPGRPGLSQSCSRRGFQPAALRLF
Ga0316598_139946_2_1333300034652Untreated Peat SoilMPVIPLTRSGGEGGTNCRQPFPGRPGLSQSCSRRVFQAAALRLF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.