Basic Information | |
---|---|
Family ID | F071044 |
Family Type | Metagenome |
Number of Sequences | 122 |
Average Sequence Length | 40 residues |
Representative Sequence | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALLRLA |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 96.72 % |
% of genes near scaffold ends (potentially truncated) | 95.08 % |
% of genes from short scaffolds (< 2000 bps) | 90.16 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (74.590 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.246 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.197 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.180 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 85.00% β-sheet: 0.00% Coil/Unstructured: 15.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF07883 | Cupin_2 | 3.28 |
PF04392 | ABC_sub_bind | 3.28 |
PF16694 | Cytochrome_P460 | 1.64 |
PF03713 | DUF305 | 1.64 |
PF08281 | Sigma70_r4_2 | 1.64 |
PF01596 | Methyltransf_3 | 1.64 |
PF03330 | DPBB_1 | 0.82 |
PF00239 | Resolvase | 0.82 |
PF13827 | DUF4189 | 0.82 |
PF02371 | Transposase_20 | 0.82 |
PF07750 | GcrA | 0.82 |
PF03797 | Autotransporter | 0.82 |
PF04542 | Sigma70_r2 | 0.82 |
PF02597 | ThiS | 0.82 |
PF13193 | AMP-binding_C | 0.82 |
PF03466 | LysR_substrate | 0.82 |
PF02777 | Sod_Fe_C | 0.82 |
PF01738 | DLH | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.28 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 1.64 |
COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 1.64 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 1.64 |
COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 1.64 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.82 |
COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.82 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.82 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.82 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.82 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.82 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.82 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.82 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.82 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.82 |
COG5352 | Uncharacterized conserved protein | Function unknown [S] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 74.59 % |
Unclassified | root | N/A | 25.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_16989912 | Not Available | 1255 | Open in IMG/M |
2088090014|GPIPI_17046948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Cp5.3 | 2951 | Open in IMG/M |
2166559005|cont_contig62844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10068801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 898 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10108947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 680 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10166931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
3300000655|AF_2010_repII_A100DRAFT_1035185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 915 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1043948 | Not Available | 630 | Open in IMG/M |
3300001867|JGI12627J18819_10203181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 800 | Open in IMG/M |
3300005164|Ga0066815_10068693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 618 | Open in IMG/M |
3300005174|Ga0066680_10506219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
3300005332|Ga0066388_107948922 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005764|Ga0066903_106175107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 626 | Open in IMG/M |
3300005764|Ga0066903_109119228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
3300006028|Ga0070717_10039182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3855 | Open in IMG/M |
3300006028|Ga0070717_11585005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
3300006038|Ga0075365_10824985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
3300006796|Ga0066665_11490197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
3300006880|Ga0075429_101860452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 522 | Open in IMG/M |
3300006904|Ga0075424_100498501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1300 | Open in IMG/M |
3300009143|Ga0099792_11264457 | Not Available | 503 | Open in IMG/M |
3300009792|Ga0126374_11173378 | Not Available | 613 | Open in IMG/M |
3300010337|Ga0134062_10369580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 695 | Open in IMG/M |
3300010358|Ga0126370_10180866 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300010358|Ga0126370_10478236 | Not Available | 1046 | Open in IMG/M |
3300010360|Ga0126372_10880389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 896 | Open in IMG/M |
3300010376|Ga0126381_102205099 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300010868|Ga0124844_1052728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1436 | Open in IMG/M |
3300010868|Ga0124844_1067552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1307 | Open in IMG/M |
3300010868|Ga0124844_1098768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1107 | Open in IMG/M |
3300011271|Ga0137393_11165387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
3300012189|Ga0137388_11685106 | Not Available | 568 | Open in IMG/M |
3300012210|Ga0137378_10124919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2376 | Open in IMG/M |
3300012350|Ga0137372_11092287 | Not Available | 548 | Open in IMG/M |
3300012930|Ga0137407_11580709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
3300012951|Ga0164300_10107258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1238 | Open in IMG/M |
3300012971|Ga0126369_10513523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1258 | Open in IMG/M |
3300012971|Ga0126369_13512415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 513 | Open in IMG/M |
3300015371|Ga0132258_10400813 | All Organisms → cellular organisms → Bacteria | 3408 | Open in IMG/M |
3300016270|Ga0182036_10408121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1060 | Open in IMG/M |
3300016270|Ga0182036_10916891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
3300016270|Ga0182036_10919951 | Not Available | 718 | Open in IMG/M |
3300016294|Ga0182041_10482509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1071 | Open in IMG/M |
3300016294|Ga0182041_11791886 | Not Available | 569 | Open in IMG/M |
3300016294|Ga0182041_12224977 | Not Available | 512 | Open in IMG/M |
3300016341|Ga0182035_11665923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
3300016341|Ga0182035_12072365 | Not Available | 517 | Open in IMG/M |
3300016357|Ga0182032_10802503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 795 | Open in IMG/M |
3300016371|Ga0182034_10532207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Azotobacter group → Azotobacter → Azotobacter beijerinckii | 984 | Open in IMG/M |
3300016371|Ga0182034_10791658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 811 | Open in IMG/M |
3300016371|Ga0182034_11356065 | Not Available | 621 | Open in IMG/M |
3300016387|Ga0182040_10284981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1257 | Open in IMG/M |
3300016422|Ga0182039_10758407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 859 | Open in IMG/M |
3300020579|Ga0210407_11080945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 609 | Open in IMG/M |
3300021560|Ga0126371_11619011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 773 | Open in IMG/M |
3300025905|Ga0207685_10594164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
3300025915|Ga0207693_10762097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
3300025916|Ga0207663_10423873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1022 | Open in IMG/M |
3300025928|Ga0207700_10970772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 760 | Open in IMG/M |
3300025929|Ga0207664_10719778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 898 | Open in IMG/M |
3300026551|Ga0209648_10437377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 824 | Open in IMG/M |
3300027071|Ga0209214_1033390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 682 | Open in IMG/M |
3300027874|Ga0209465_10115203 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1323 | Open in IMG/M |
3300031545|Ga0318541_10082892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1698 | Open in IMG/M |
3300031561|Ga0318528_10366018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 774 | Open in IMG/M |
3300031640|Ga0318555_10381981 | Not Available | 763 | Open in IMG/M |
3300031682|Ga0318560_10202571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1060 | Open in IMG/M |
3300031719|Ga0306917_10747880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 767 | Open in IMG/M |
3300031719|Ga0306917_11082689 | Not Available | 624 | Open in IMG/M |
3300031719|Ga0306917_11209340 | Not Available | 586 | Open in IMG/M |
3300031719|Ga0306917_11465846 | Not Available | 525 | Open in IMG/M |
3300031723|Ga0318493_10773310 | Not Available | 540 | Open in IMG/M |
3300031724|Ga0318500_10008858 | All Organisms → cellular organisms → Bacteria | 3423 | Open in IMG/M |
3300031724|Ga0318500_10362450 | Not Available | 717 | Open in IMG/M |
3300031724|Ga0318500_10515896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
3300031744|Ga0306918_10046414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2859 | Open in IMG/M |
3300031744|Ga0306918_10918530 | Not Available | 681 | Open in IMG/M |
3300031744|Ga0306918_11283725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
3300031771|Ga0318546_10089150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2004 | Open in IMG/M |
3300031771|Ga0318546_10161942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1513 | Open in IMG/M |
3300031793|Ga0318548_10463108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
3300031796|Ga0318576_10622411 | Not Available | 508 | Open in IMG/M |
3300031798|Ga0318523_10266554 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
3300031805|Ga0318497_10079080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1740 | Open in IMG/M |
3300031819|Ga0318568_10422653 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
3300031832|Ga0318499_10119357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1025 | Open in IMG/M |
3300031833|Ga0310917_10334537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1026 | Open in IMG/M |
3300031835|Ga0318517_10010805 | All Organisms → cellular organisms → Bacteria | 3260 | Open in IMG/M |
3300031846|Ga0318512_10123265 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1234 | Open in IMG/M |
3300031846|Ga0318512_10282778 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
3300031859|Ga0318527_10197370 | Not Available | 851 | Open in IMG/M |
3300031859|Ga0318527_10388954 | Not Available | 594 | Open in IMG/M |
3300031879|Ga0306919_10517012 | Not Available | 920 | Open in IMG/M |
3300031879|Ga0306919_10881309 | Not Available | 686 | Open in IMG/M |
3300031890|Ga0306925_10179863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2278 | Open in IMG/M |
3300031896|Ga0318551_10908608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
3300031910|Ga0306923_10470240 | All Organisms → cellular organisms → Bacteria | 1424 | Open in IMG/M |
3300031941|Ga0310912_10185151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1587 | Open in IMG/M |
3300031941|Ga0310912_10555074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 894 | Open in IMG/M |
3300031942|Ga0310916_11376895 | Not Available | 578 | Open in IMG/M |
3300031942|Ga0310916_11477209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
3300031945|Ga0310913_10851194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 642 | Open in IMG/M |
3300031945|Ga0310913_11004943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
3300031946|Ga0310910_10172203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1667 | Open in IMG/M |
3300031946|Ga0310910_10744690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 773 | Open in IMG/M |
3300031947|Ga0310909_10011330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6108 | Open in IMG/M |
3300031947|Ga0310909_11665519 | Not Available | 504 | Open in IMG/M |
3300031954|Ga0306926_11306262 | Not Available | 846 | Open in IMG/M |
3300031959|Ga0318530_10065524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1396 | Open in IMG/M |
3300031981|Ga0318531_10192304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 919 | Open in IMG/M |
3300031981|Ga0318531_10522801 | Not Available | 537 | Open in IMG/M |
3300032001|Ga0306922_12282621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
3300032035|Ga0310911_10173461 | Not Available | 1220 | Open in IMG/M |
3300032039|Ga0318559_10312046 | Not Available | 730 | Open in IMG/M |
3300032041|Ga0318549_10374610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
3300032052|Ga0318506_10003490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4529 | Open in IMG/M |
3300032065|Ga0318513_10025468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2515 | Open in IMG/M |
3300032076|Ga0306924_10355533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1679 | Open in IMG/M |
3300032174|Ga0307470_10391967 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 979 | Open in IMG/M |
3300032205|Ga0307472_101883933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
3300032261|Ga0306920_101856911 | Not Available | 848 | Open in IMG/M |
3300033289|Ga0310914_10698004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 910 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.77% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.74% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.92% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.28% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.64% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.64% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.64% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.82% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.82% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_00995510 | 2088090014 | Soil | MLIAIAIAVVLVMAAIDRLAARVMMRPEEMALLRLARAAT |
GPIPI_00182180 | 2088090014 | Soil | MLLYEILIAIGIALVLVVAAIDRLAARVIMGPEEMALLRLARA |
cont_0844.00004240 | 2166559005 | Simulated | MLLYEMLIAIGIAVVLVVAAIDRLAARVMMGPEDWRCCG |
AF_2010_repII_A1DRAFT_100688011 | 3300000597 | Forest Soil | MLLYEMFAIGIAVVLVVVAIGGLAAREMMGPEETALSRLARA |
AF_2010_repII_A1DRAFT_101089472 | 3300000597 | Forest Soil | MLLYEMFAIGIVGVLVVAAIGGLAARVMMGPEETALL |
AF_2010_repII_A1DRAFT_101669311 | 3300000597 | Forest Soil | MLLYEMFALGIAVVLVVAAIDRLAARIMMGPEEMALLRLAR |
AF_2010_repII_A100DRAFT_10351853 | 3300000655 | Forest Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALMRLAR |
AP72_2010_repI_A100DRAFT_10439481 | 3300000837 | Forest Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVTMGPEETALLRLA |
JGI12627J18819_102031812 | 3300001867 | Forest Soil | MLLYEMLIAIGIAVVLVVAAIDRLAARVITGPEEMALLRLA |
Ga0066815_100686931 | 3300005164 | Soil | MLLYEMLFATAIGIAVVLVVAAIDRLATRVMMGPEEMALLR |
Ga0066680_105062191 | 3300005174 | Soil | MLLYEMLIAIGIAVVLVVAAIDRLAARVMMGPEDMALLRLARAA |
Ga0066388_1079489222 | 3300005332 | Tropical Forest Soil | MFLYEMLIAIGIAGVLVVAAIDRLATRVMMGPYELAALHSITSSTSP* |
Ga0066903_1061751072 | 3300005764 | Tropical Forest Soil | MLLYEMLIAIGIAVVLVVAAIDRLAARVMMGPEEMALLRLARAAAAQH |
Ga0066903_1091192281 | 3300005764 | Tropical Forest Soil | MLLYEMFAIGIAAVLVVAAIGGLARVMMGPEETALL |
Ga0070717_100391821 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLYEMLIAIGIAVVLVVAAIDRLATRVMMGPEEMALLRLARA |
Ga0070717_115850051 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLYEMLIAIGIAVVLVVAAIDRLAARVMMGPEEMALLRLARAA |
Ga0075365_108249852 | 3300006038 | Populus Endosphere | MLLYEMFAIVIAVVCVVAAIGGLAARAMMGPEEMSLLRLARAAE |
Ga0066665_114901971 | 3300006796 | Soil | MFLYEMLIAIGIAVVLVVAAIDRLAARVMMGPEEMALLRLARA |
Ga0075429_1018604521 | 3300006880 | Populus Rhizosphere | MLLFEMLIAIGIVVVLVVAAIDRLAARVMMGPEDMALFRLARA |
Ga0075424_1004985011 | 3300006904 | Populus Rhizosphere | MLLYEMLMIGIAVVLVMAAIDRLAARVMMGPEEMALLRL |
Ga0099792_112644571 | 3300009143 | Vadose Zone Soil | MLIAIGIAVVLVAAAIGELAARLMMGPEERALLRAARAAA |
Ga0126374_111733781 | 3300009792 | Tropical Forest Soil | MLLYEMFAIGIVVVLVVAAIGGLAAREMMGPEETAL |
Ga0134062_103695801 | 3300010337 | Grasslands Soil | MLIAIGIAVVLVVAAIDRLAARVMMGPEEMALLRLARAAEAQRRL |
Ga0126370_101808662 | 3300010358 | Tropical Forest Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALLRL |
Ga0126370_104782361 | 3300010358 | Tropical Forest Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALLRLV |
Ga0126372_108803893 | 3300010360 | Tropical Forest Soil | MLLYEMFAIGIAAVLVVAAISSLARVMMGPEETALLRLARA |
Ga0126381_1022050992 | 3300010376 | Tropical Forest Soil | MLLDEMLIAIGIAVVLVLAIGGLAARVKMGPEEMALSRAARAAAA |
Ga0124844_10527282 | 3300010868 | Tropical Forest Soil | MMLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALSRR* |
Ga0124844_10675523 | 3300010868 | Tropical Forest Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALSRR* |
Ga0124844_10987681 | 3300010868 | Tropical Forest Soil | EMFAIGIAVVLVVAAIGGLAARVMMGPEETALSRR* |
Ga0137393_111653871 | 3300011271 | Vadose Zone Soil | MLLYEMVIAIGIAVVLVVAAIDRLATRVMMGPEEMALLRLARAAA |
Ga0137388_116851061 | 3300012189 | Vadose Zone Soil | MGEANMFLYEMLIAIGIAVVLVVAAIDRLAARVMM |
Ga0137378_101249194 | 3300012210 | Vadose Zone Soil | MLLYEMLIMLIMLIAIGIAVVLVGAAIDRLAARVMMGPEEM |
Ga0137372_110922872 | 3300012350 | Vadose Zone Soil | MSLYEMVIAIGIAVVLVAAAIGELAARLMMGPEERALLRAA |
Ga0137407_115807091 | 3300012930 | Vadose Zone Soil | MLIAIGIAVVLVVAAIDRLAARVIARVMMGPEEMALLRLA |
Ga0164300_101072584 | 3300012951 | Soil | MLLYEIFAIGIAVVLVVAAIGGLATRVMMGPEEMALLRLARAAA |
Ga0126369_105135231 | 3300012971 | Tropical Forest Soil | MLLYEMLIAIGIAVVLVVAAIDRLATRVMMGPEEMAL |
Ga0126369_135124152 | 3300012971 | Tropical Forest Soil | MLLYEMFAIGIAVALVVAAIGGLAARVMMGPEETALLRLAR |
Ga0132258_104008136 | 3300015371 | Arabidopsis Rhizosphere | MLLYETLALGIAVVLVGAAIGGLAGPGIRGPEETGLA |
Ga0182036_104081211 | 3300016270 | Soil | MLLLYEMVIAIPVVLVVTAIVGLAARVMMGPEEMALL |
Ga0182036_109168911 | 3300016270 | Soil | MLLYEMLIAIVIAVVLVVAAIDRLATRVMMGPEEMALLRLARA |
Ga0182036_109199512 | 3300016270 | Soil | MLLYETLIAIGIAVVLVVAAIDRLAARVMMGLDEMAL |
Ga0182041_104825092 | 3300016294 | Soil | LYEMFAIGIAVVLLVAAIDGLAARLMGPEETALLRLA |
Ga0182041_117918861 | 3300016294 | Soil | VMLYEMFAIGIAVVLLVAAIDGLAARLMGPEETALL |
Ga0182041_122249771 | 3300016294 | Soil | MLLYEMFAIGIAVVLLVAAIDGLAARLMGPEETALLRLARA |
Ga0182035_116659231 | 3300016341 | Soil | MLLYEMLIAIGIAVVLVVAALGRLATRVMMGPEEMALLRLAQAAAAQ |
Ga0182035_120723651 | 3300016341 | Soil | MLYEMFAIGIAVVLLVAAIDGLAARLMGPEETALLRL |
Ga0182032_108025031 | 3300016357 | Soil | MLLYEMLIAIVIAVVLVVAAIDRLATRVMMGPEEMALLRLARAAA |
Ga0182034_105322071 | 3300016371 | Soil | MLLYEMLMAIGIAVVLVLAMGGLAARVKMCPEEMALSRAARAAAA |
Ga0182034_107916581 | 3300016371 | Soil | MLLYEMLIAIVIAVVLVVAAIDRLATRVMMGPEEMALL |
Ga0182034_113560652 | 3300016371 | Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALLRLARAAPA |
Ga0182040_102849812 | 3300016387 | Soil | MLLYEMFAIGIAVVLVVAAIGSLAARVMMGPEETALLRLARA |
Ga0182039_107584071 | 3300016422 | Soil | MLLLYEMVIAIPVVLVVTAIVGLAARVMMGPEEMALLRE |
Ga0210407_110809452 | 3300020579 | Soil | MLLYEMLIAIGIAVVLVVAAIDRLAARVMMGPEKM |
Ga0126371_116190111 | 3300021560 | Tropical Forest Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETA |
Ga0207685_105941641 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLYEILIAIGIALVLVVAAIDRLAARVIMGPEEMALLR |
Ga0207693_107620972 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLYEMLIAIGIAVVLVVAAIDRLAARVMMGPGEMSLLRLARAATA |
Ga0207663_104238731 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLYEMLIAIGIAVVLVVAAIDRLAARVMMGPGESLL |
Ga0207700_109707722 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLYEMLIAIGIAVVLVVAAIDRLAARVMMGPEEMALLRLAR |
Ga0207664_107197782 | 3300025929 | Agricultural Soil | MLLYEMLIAIGIAVVLVVAAIDRLATRVMMGPEEMALLRLAR |
Ga0209648_104373771 | 3300026551 | Grasslands Soil | MLLYEMLIAIGIAVVLVVAAIDRLATRVMMGPEEW |
Ga0209214_10333901 | 3300027071 | Forest Soil | MLLYEMLIAIGIAVVLAVAAIDRLATRVMMGPEEMAL |
Ga0209465_101152031 | 3300027874 | Tropical Forest Soil | MFLYEMLIAIGIAGVLVVAAIDRLATRVMMGPYELAALHSITSS |
Ga0318541_100828921 | 3300031545 | Soil | MLLYEMFALGIAVVLVVAAIGGLAARVMMGPEETALLR |
Ga0318528_103660182 | 3300031561 | Soil | MLLYETLIAIGIAVVLVVAAIDRLAARVMMGLDEMALL |
Ga0318555_103819811 | 3300031640 | Soil | MLLYEMFAIGIAVVLLVAAIDGLAARLMGPEETALLRLA |
Ga0318560_102025711 | 3300031682 | Soil | MLLYETLIAIGIAVVLVVAAIDRLAARVMMGLDEM |
Ga0306917_107478801 | 3300031719 | Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALLRLARA |
Ga0306917_110826891 | 3300031719 | Soil | MLLYEMFAIGIAVILVVAAIGGLAARVMMGPEGTALLR |
Ga0306917_112093401 | 3300031719 | Soil | VMLYEMFAIGIAVVLLVAAIDGLAARLMGPEETALLRLAR |
Ga0306917_114658461 | 3300031719 | Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMRGPEETALLRLA |
Ga0318493_107733101 | 3300031723 | Soil | VMLLYEMFAIGIAVVLVVAAIGGLAALVMMGPEETAL |
Ga0318500_100088581 | 3300031724 | Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALLR |
Ga0318500_103624501 | 3300031724 | Soil | MLLYEMFAIGIAVILVVAAIGGLAARVMMGPEETALLRLARAAPA |
Ga0318500_105158962 | 3300031724 | Soil | MLLYEMLAIGIAVVLVVAAIGGLAARVMSGPEETALLRLARA |
Ga0306918_100464141 | 3300031744 | Soil | MLLYEMFAIGIAVVLVVAAIDGLAARVMMGPEETALLRRA |
Ga0306918_109185301 | 3300031744 | Soil | MLLYEMFAIGIAVVLVVAAIGGLAVRVMMGPEETALLRLARAVPAQ |
Ga0306918_112837252 | 3300031744 | Soil | MFLYEMLIAIGIAVVLVVAAIDRLATRVMMGPEEMALLRL |
Ga0318546_100891501 | 3300031771 | Soil | MLLYEMFAIGIAVVLVVAAIGGLAALVMMGPEETALSRLARAAPA |
Ga0318546_101619421 | 3300031771 | Soil | MLLYEMFAIGIALVLVVAAIGGLAALVMMGPEETALSRLARAAPA |
Ga0318548_104631081 | 3300031793 | Soil | MLLYEMLIAIGIAVVLVVAAIDRLATRVMIGPEEMALLRLARAAAAQH |
Ga0318576_106224111 | 3300031796 | Soil | VMLLDEMFAIGIAVVLVVAAIGGLAARVMMGLEETALL |
Ga0318523_102665542 | 3300031798 | Soil | MLLYEMFAIGIAVVLVVAAIGSLAALVMMGPEETALSRLAR |
Ga0318497_100790801 | 3300031805 | Soil | MLLYEMFAIGIAVVLVVAAIGSLAARVMMGPEETA |
Ga0318568_104226532 | 3300031819 | Soil | MLLYEMFPIGIAVVLVVAAIGGLAALVMMGPEETALS |
Ga0318499_101193571 | 3300031832 | Soil | MLLYEMFAIGIAVVLVVAAIGSLAARVMMGPEETALL |
Ga0310917_103345372 | 3300031833 | Soil | MLLYEMFAIGIAVVLVMAAIGGLAPRVMMGPEETALLRLA |
Ga0318517_100108055 | 3300031835 | Soil | MLLYEMFALGIAVVLVVAAIGGLAARVMMGPEETALLRLAR |
Ga0318512_101232652 | 3300031846 | Soil | MLLYEMLIAIGIAVVLVVAAIDRLATRVMIGPEEMALLRL |
Ga0318512_102827781 | 3300031846 | Soil | MLLYEMFPIGIAVVLVVAAIGGLAALVMMGPEETALSRLARAA |
Ga0318527_101973701 | 3300031859 | Soil | MLLYEMFAIGIAVVLLVAAIDGLAARVMGPEETALLRLA |
Ga0318527_103889541 | 3300031859 | Soil | VMLLYEMFAIGIAVVLVVAAIGGLAALVMMGPEETALLRLARAAP |
Ga0306919_105170122 | 3300031879 | Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALSR |
Ga0306919_108813092 | 3300031879 | Soil | MLLYEMFAIGIAVVLLVAAIDGLAARLMGPEETAL |
Ga0306925_101798635 | 3300031890 | Soil | MLLYEMFAIGIAVAAIGSLAARVMMGPEETALLRLARAAPAQR |
Ga0318551_109086081 | 3300031896 | Soil | MLLYEMLIAIGIAGVLVVAAIDRLATRVMIGPEETALLRLARAAP |
Ga0306923_104702401 | 3300031910 | Soil | MMLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEET |
Ga0310912_101851511 | 3300031941 | Soil | MLYEMFAIGIAVVLLVAAIDGLAARLMGPEETALLRLARAAP |
Ga0310912_105550742 | 3300031941 | Soil | MLLYEMFAIGIVVVLVVAAIGGLAARVMMGSEETAL |
Ga0310916_113768951 | 3300031942 | Soil | VMLYEMFAIGIAVVLLVAAIDGLAARLMGPEETALLR |
Ga0310916_114772092 | 3300031942 | Soil | MLLYEMLIAIGIAVVLVVAVIDRLAARVMMGPEEMA |
Ga0310913_108511942 | 3300031945 | Soil | MLLLYEMVIAIPVVLVVTAIVGLAARVMMGPEEMALLREGRAAAA |
Ga0310913_110049432 | 3300031945 | Soil | MLLYEMFAIGIALVLVVAAIGGLAARVMMGPEETALSRLAR |
Ga0310910_101722031 | 3300031946 | Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMKGPEETAL |
Ga0310910_107446901 | 3300031946 | Soil | MLLLYEMVIAIPVVLVVTAIVGLAARVMMGPEEMALLR |
Ga0310909_100113301 | 3300031947 | Soil | MYEMVIAMGIAVVLVMAAIGGLAARVRMGPEETALL |
Ga0310909_116655191 | 3300031947 | Soil | MLLYEMFAIGIAVVLVVAAIGGLAARAMRVMMGPEETALLRLARAA |
Ga0306926_113062621 | 3300031954 | Soil | MLLYEMFAIGIAVVLVVAALGGLAARVMMGPEETALLRLARAAP |
Ga0318530_100655241 | 3300031959 | Soil | MLLYEMFAIGIAVVLVMAAMGGLAPRVMMGPEETALLRLARAV |
Ga0318531_101923043 | 3300031981 | Soil | MLLYEMFAIGIVVVLVVAAIGGLAARVIMGSEETALV |
Ga0318531_105228011 | 3300031981 | Soil | MLLYEMFAIGIAVALVVAAIGRLAARVGPEETALLREARAAV |
Ga0306922_122826211 | 3300032001 | Soil | MLLYEMFAIGIAVVLVVAAIDGLAARVMMGPEETALLRLARAAPA |
Ga0310911_101734611 | 3300032035 | Soil | MLYEMFAIGIAVVLLVAAIDGLAARLMGPEETALLRLA |
Ga0318559_103120462 | 3300032039 | Soil | MLLYEMFAIGIAVVLVMAAMGGLAPRVMMGPEETALLRLARAVPA |
Ga0318549_103746101 | 3300032041 | Soil | MLLYEMLIAIGIAVVLVVAAIDRLATRVMIGPEETALLRLAR |
Ga0318506_100034906 | 3300032052 | Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALLRLA |
Ga0318513_100254683 | 3300032065 | Soil | MLLYEMFAIGIAVVLLVAAIDGLAARVMGPEETALLRLARA |
Ga0306924_103555331 | 3300032076 | Soil | MLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALLRLARAA |
Ga0307470_103919671 | 3300032174 | Hardwood Forest Soil | MLLYEMLIAIGIAVVLVVAAIDRLAARVMMGPGEMSL |
Ga0307472_1018839331 | 3300032205 | Hardwood Forest Soil | MLLYEILIAIGIAVVLVVAAIDRLAARVITGPEEMALLRL |
Ga0306920_1018569111 | 3300032261 | Soil | MMLLYEMFAIGIAVVLVVAAIGGLAARVMMGPEETALSRLARA |
Ga0310914_106980043 | 3300033289 | Soil | MLLYEIFAIGIAVVLVVAAIGGLAARVMMGPEETALARLARAA |
⦗Top⦘ |