NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F071106

Metagenome Family F071106

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071106
Family Type Metagenome
Number of Sequences 122
Average Sequence Length 43 residues
Representative Sequence PRADARPFGIAVDAGNNVWYTDLSGWLGRLDADRARAR
Number of Associated Samples 113
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.82 %
% of genes near scaffold ends (potentially truncated) 97.54 %
% of genes from short scaffolds (< 2000 bps) 90.16 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.361 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(18.852 % of family members)
Environment Ontology (ENVO) Unclassified
(31.967 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.984 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 22.73%    Coil/Unstructured: 77.27%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF03824NicO 24.59
PF13386DsbD_2 7.38
PF13795HupE_UreJ_2 6.56
PF03773ArsP_1 4.92
PF01717Meth_synt_2 3.28
PF02683DsbD 2.46
PF07452CHRD 1.64
PF13145Rotamase_2 1.64
PF00296Bac_luciferase 1.64
PF00753Lactamase_B 1.64
PF04392ABC_sub_bind 0.82
PF14885GHL15 0.82
PF03150CCP_MauG 0.82
PF01471PG_binding_1 0.82
PF02630SCO1-SenC 0.82
PF13546DDE_5 0.82
PF01551Peptidase_M23 0.82
PF04909Amidohydro_2 0.82
PF13358DDE_3 0.82
PF10282Lactonase 0.82
PF01548DEDD_Tnp_IS110 0.82
PF01266DAO 0.82
PF13442Cytochrome_CBB3 0.82
PF02899Phage_int_SAM_1 0.82
PF13577SnoaL_4 0.82
PF03466LysR_substrate 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0701Uncharacterized membrane protein YraQ, UPF0718 familyFunction unknown [S] 4.92
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 3.28
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.64
COG1225PeroxiredoxinPosttranslational modification, protein turnover, chaperones [O] 0.82
COG1858Cytochrome c peroxidasePosttranslational modification, protein turnover, chaperones [O] 0.82
COG1999Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC familyPosttranslational modification, protein turnover, chaperones [O] 0.82
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.82
COG3547TransposaseMobilome: prophages, transposons [X] 0.82
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.82
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.36 %
UnclassifiedrootN/A1.64 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000550|F24TB_10423636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1390Open in IMG/M
3300000956|JGI10216J12902_105878810All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria530Open in IMG/M
3300004643|Ga0062591_100459538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis1077Open in IMG/M
3300005176|Ga0066679_10847740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium580Open in IMG/M
3300005177|Ga0066690_10058631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2371Open in IMG/M
3300005180|Ga0066685_10550071All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300005186|Ga0066676_10390883All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65936Open in IMG/M
3300005330|Ga0070690_101255163All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis592Open in IMG/M
3300005364|Ga0070673_102180806All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium526Open in IMG/M
3300005446|Ga0066686_10074701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2132Open in IMG/M
3300005447|Ga0066689_10715564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium626Open in IMG/M
3300005536|Ga0070697_102066361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium510Open in IMG/M
3300005540|Ga0066697_10700908All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium554Open in IMG/M
3300005549|Ga0070704_101042057All Organisms → cellular organisms → Bacteria → Proteobacteria741Open in IMG/M
3300005555|Ga0066692_10776203All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
3300005575|Ga0066702_10633970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis640Open in IMG/M
3300005617|Ga0068859_100490034All Organisms → cellular organisms → Bacteria → Proteobacteria1324Open in IMG/M
3300005719|Ga0068861_100902431All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300005764|Ga0066903_100355408All Organisms → cellular organisms → Bacteria2372Open in IMG/M
3300005843|Ga0068860_101220807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium772Open in IMG/M
3300005844|Ga0068862_101830731All Organisms → cellular organisms → Bacteria → Proteobacteria616Open in IMG/M
3300006049|Ga0075417_10150815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis1082Open in IMG/M
3300006755|Ga0079222_10635780All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis825Open in IMG/M
3300006794|Ga0066658_10188362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium arachidis1083Open in IMG/M
3300006845|Ga0075421_101624414All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300006852|Ga0075433_10021546All Organisms → cellular organisms → Bacteria5405Open in IMG/M
3300006852|Ga0075433_11334945All Organisms → cellular organisms → Bacteria → Proteobacteria621Open in IMG/M
3300006854|Ga0075425_101965462Not Available654Open in IMG/M
3300006871|Ga0075434_100501668All Organisms → cellular organisms → Bacteria → Proteobacteria1234Open in IMG/M
3300007255|Ga0099791_10118503All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300009038|Ga0099829_10302360All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1312Open in IMG/M
3300009088|Ga0099830_11011618All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300009090|Ga0099827_10571661All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium974Open in IMG/M
3300009137|Ga0066709_100233650All Organisms → cellular organisms → Bacteria2446Open in IMG/M
3300009147|Ga0114129_10080449All Organisms → cellular organisms → Bacteria → Proteobacteria4529Open in IMG/M
3300009147|Ga0114129_10501326All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1586Open in IMG/M
3300009162|Ga0075423_11172217All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium819Open in IMG/M
3300009176|Ga0105242_12237606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas592Open in IMG/M
3300009177|Ga0105248_10781114All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1078Open in IMG/M
3300009553|Ga0105249_13269178All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium521Open in IMG/M
3300009678|Ga0105252_10008013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3802Open in IMG/M
3300009810|Ga0105088_1074473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria601Open in IMG/M
3300010303|Ga0134082_10562797All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300010336|Ga0134071_10718786All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium530Open in IMG/M
3300010358|Ga0126370_10389089All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1141Open in IMG/M
3300010359|Ga0126376_10475298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1149Open in IMG/M
3300010360|Ga0126372_10233374All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium1563Open in IMG/M
3300010360|Ga0126372_10592363All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300010360|Ga0126372_12997137All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300010361|Ga0126378_11878608All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300010366|Ga0126379_12951970All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300010376|Ga0126381_104061190Not Available569Open in IMG/M
3300010403|Ga0134123_11933767All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium647Open in IMG/M
3300011416|Ga0137422_1006366All Organisms → cellular organisms → Bacteria2674Open in IMG/M
3300012096|Ga0137389_11033811All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium704Open in IMG/M
3300012096|Ga0137389_11236412All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300012189|Ga0137388_10493771All Organisms → cellular organisms → Bacteria → Proteobacteria1137Open in IMG/M
3300012199|Ga0137383_10345516All Organisms → cellular organisms → Bacteria1090Open in IMG/M
3300012202|Ga0137363_11132009All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria666Open in IMG/M
3300012205|Ga0137362_11079727All Organisms → cellular organisms → Bacteria → Proteobacteria682Open in IMG/M
3300012207|Ga0137381_10053093All Organisms → cellular organisms → Bacteria3351Open in IMG/M
3300012349|Ga0137387_10509593All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300012350|Ga0137372_10362207All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1107Open in IMG/M
3300012359|Ga0137385_11009214All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria686Open in IMG/M
3300012360|Ga0137375_11311766All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria545Open in IMG/M
3300012582|Ga0137358_10703990All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria675Open in IMG/M
3300012918|Ga0137396_10233283All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300012927|Ga0137416_10653000All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300012929|Ga0137404_11369850All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria653Open in IMG/M
3300013306|Ga0163162_12882771All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria553Open in IMG/M
3300014325|Ga0163163_12993911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium527Open in IMG/M
3300015356|Ga0134073_10235724All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria625Open in IMG/M
3300015373|Ga0132257_100456224All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1562Open in IMG/M
3300016341|Ga0182035_10341564All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1241Open in IMG/M
3300016357|Ga0182032_10671794All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300016404|Ga0182037_10642084All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300016404|Ga0182037_11569949All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium585Open in IMG/M
3300016445|Ga0182038_10536435All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1003Open in IMG/M
3300017657|Ga0134074_1070179All Organisms → cellular organisms → Bacteria → Proteobacteria1191Open in IMG/M
3300018433|Ga0066667_12007198All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium532Open in IMG/M
3300021078|Ga0210381_10411486All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300021559|Ga0210409_10944376All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300021560|Ga0126371_11856229All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria723Open in IMG/M
3300025900|Ga0207710_10485456All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria640Open in IMG/M
3300025910|Ga0207684_11367502All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300025930|Ga0207701_11121133All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300026298|Ga0209236_1091372All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300026313|Ga0209761_1037900All Organisms → cellular organisms → Bacteria2819Open in IMG/M
3300026318|Ga0209471_1151619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium957Open in IMG/M
3300026324|Ga0209470_1335865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium545Open in IMG/M
3300026326|Ga0209801_1171546All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium899Open in IMG/M
3300026538|Ga0209056_10070026All Organisms → cellular organisms → Bacteria3015Open in IMG/M
3300027527|Ga0209684_1013607All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1281Open in IMG/M
3300027655|Ga0209388_1058280All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1114Open in IMG/M
3300027875|Ga0209283_10223359All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria1251Open in IMG/M
3300027882|Ga0209590_10774892All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria610Open in IMG/M
3300028381|Ga0268264_12165587All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium564Open in IMG/M
3300028536|Ga0137415_11006675All Organisms → cellular organisms → Bacteria → Proteobacteria645Open in IMG/M
3300028587|Ga0247828_10155862All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300030336|Ga0247826_10008743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4029Open in IMG/M
3300031170|Ga0307498_10111883All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium857Open in IMG/M
3300031561|Ga0318528_10125884All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1357Open in IMG/M
3300031720|Ga0307469_10703408All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium916Open in IMG/M
3300031720|Ga0307469_11210972All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300031720|Ga0307469_11992100All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria563Open in IMG/M
3300031720|Ga0307469_12346002All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300031723|Ga0318493_10179151All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300031740|Ga0307468_100167823All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1437Open in IMG/M
3300031744|Ga0306918_10303097All Organisms → cellular organisms → Bacteria1231Open in IMG/M
3300031747|Ga0318502_10213685All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300031771|Ga0318546_10181611All Organisms → cellular organisms → Bacteria1430Open in IMG/M
3300031793|Ga0318548_10601188All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300031796|Ga0318576_10335309All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium714Open in IMG/M
3300031944|Ga0310884_10113281All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300032001|Ga0306922_10456253All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300032017|Ga0310899_10407721All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300032065|Ga0318513_10355233All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300032076|Ga0306924_11505883All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300032094|Ga0318540_10195189All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300032180|Ga0307471_101262448All Organisms → cellular organisms → Bacteria902Open in IMG/M
3300033158|Ga0335077_12011518All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300034115|Ga0364945_0218309All Organisms → cellular organisms → Bacteria584Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil18.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.30%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.38%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere7.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.56%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.10%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.28%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.28%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.46%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.64%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.82%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.82%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.82%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.82%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.82%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009810Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011416Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F24TB_1042363633300000550SoilGIVREFPLPRRDARPFGVAVDPANNVWYTDLSGWLGKLRADRARNE*
JGI10216J12902_10587881013300000956SoilGRVHAAAITEFVLPRDDARPFGIAVDAANNVWYTDLSGWLGRLDAERARVR*
Ga0062591_10045953823300004643SoilAHKLGRVRGGVIKEFALPRRDARPFGVAVDGANNVWYTDLSGWLGMLRGDRARAE*
Ga0066679_1084774023300005176SoilHDGVMAEFPLPRSDARPFDVAVDAANNVWYTDLSGWLGRLSAERARVR*
Ga0066690_1005863113300005177SoilVMAEFPLPRSDARPFDVAVDAANNVWYTDLSGWLGRLSAERARVR*
Ga0066685_1055007123300005180SoilEFRLPRPDARPFGVAVDRANNVWYTDLGGWLGMLRADRARFG*
Ga0066676_1039088323300005186SoilFRLPRPDARPFGVTVDRANNVWYTDLGGWLGMLRADHATSR*
Ga0070690_10125516323300005330Switchgrass RhizosphereTEYVLPRADARPFGITVDTGNNVWYTDLSGWLGRLDAERARAR*
Ga0070673_10218080623300005364Switchgrass RhizosphereITEFVLPRADARPFGIAVDVANNVWYTDLSGWLGRLDADQARVR*
Ga0066686_1007470133300005446SoilEFRLPRPDARPFGVTVDRANNVWYTDLGGWLGMLRADHATSR*
Ga0066689_1071556413300005447SoilRLRDGVMAEFPLPRADARPFDVAVDAANNVWYTDLSGWVGTLSAERARAR*
Ga0070697_10206636123300005536Corn, Switchgrass And Miscanthus RhizosphereFRLPRADARPFGVAVDTANNVWYTDLSGWLGMLPAVAAKAP*
Ga0066697_1070090813300005540SoilPDARPFGITVDAGNNVWYTDLGGWLGRLDADRARAR*
Ga0070704_10104205733300005549Corn, Switchgrass And Miscanthus RhizosphereELSRPNARPFGITVDGANNVWYSDLSGWLGRLDASRARGR*
Ga0066692_1077620313300005555SoilIPRDGARPFGVAVDAANNVWYTDLSGWLGMLPAASATSR*
Ga0066702_1063397013300005575SoilVTEFRLPRAEGRPFGVAVDMANNVWYTDLSGWLGMLPADRAKAR*
Ga0068859_10049003413300005617Switchgrass RhizosphereETRAHKLGRVRGGVIKEFALPRRDARPFGVAVDGANNVWYTDLSGWLGMLRGDRARAE*
Ga0068861_10090243123300005719Switchgrass RhizosphereRLRDGTITEFPLPRSDARPFGIAVDASGNVWFTDLSGGLGRLSAERTRGR*
Ga0066903_10035540813300005764Tropical Forest SoilRSDARPFGIAVDAAGNVWYTDLSGTLGRLSAQRARRR*
Ga0068860_10122080723300005843Switchgrass RhizospherePRADARPFGIAVDAGNNVWYTDLSGWLGRLDADRARAR*
Ga0068862_10183073123300005844Switchgrass RhizosphereLGRVQGSTIREFVLPREDARPFGIAVDAANNVWYTDLTGWVGRLDADRARGR*
Ga0075417_1015081523300006049Populus RhizosphereRLGRVHGGAITEYVLPRADARPFGIAVDAGNNVWYTDLSGWLGRLDADRARAR*
Ga0079222_1063578013300006755Agricultural SoilSRPFAVAVDAANNVWYTDLSGRLGMLPAAAAKAP*
Ga0066658_1018836213300006794SoilPRSDARPFDVAVDAANNVWYTDLTGWVGTLSAERARAR*
Ga0075421_10162441413300006845Populus RhizosphereSGARPFGIAVDGSGNVWYTDLNGGLGRLSAERARGR*
Ga0075433_1002154613300006852Populus RhizosphereLGRVHAGTITELVLPRVDARPFGIAVDAGNNVWYTDLSGWLGRLDAERARVR*
Ga0075433_1133494513300006852Populus RhizosphereDARPFGIAVDAAGNIWYTDLSGALGRLSAERARGR*
Ga0075425_10196546213300006854Populus RhizospherePRVDARPFGIAVDAGNNVWYTDLSGWLGRLDAERARVR*
Ga0075434_10050166833300006871Populus RhizosphereARPFGVAVDGAGNVWYTDLSGWLGRLSAERARGR*
Ga0099791_1011850333300007255Vadose Zone SoilRLPRPDARPFGVTVDRANNVWYTDLGGWLGMLRADYATGG*
Ga0099829_1030236023300009038Vadose Zone SoilTEFALPRRDARPFGITVDAGNNVWYTDLSGWLGRLDADRARVR*
Ga0099830_1101161813300009088Vadose Zone SoilHRLGRAHAGAITEFVLPRADARPVGVNVDAGNNVWYTDLSGWLGRLAADRARVR*
Ga0099827_1057166113300009090Vadose Zone SoilALPRRDARPFGITVDARNNVWYTDLSGWLGRLDADRARVR*
Ga0066709_10023365013300009137Grasslands SoilARPFGVAVDRANNVWYTDLGGWLGMLRADRARFG*
Ga0114129_1008044913300009147Populus RhizosphereHDGVITEFVLPRPDARPFGITVDARNNVWYTDLGGWLGRLGADRARVDGRHDGG*
Ga0114129_1050132643300009147Populus RhizosphereHDGVITEFVLPRPDARPFGITVDARNNVWYTDLGGWLGRLDADRARVDGRHDGG*
Ga0075423_1117221713300009162Populus RhizosphereVLPRPDARPFGIAVDAGNNVWYTDLSGWIGRLDADRARVR*
Ga0105242_1223760633300009176Miscanthus RhizosphereHAGAITEFVLPRGDARPFGIAVDAANNVWYTDLSGWVGRLEADRARVR*
Ga0105248_1078111413300009177Switchgrass RhizosphereITEFALPRPDARPFGIAVDARNNVWYTDLSGWIGRLAAERARGG*
Ga0105249_1326917813300009553Switchgrass RhizosphereITEYVLPRADARPFGIAVDAGNNVWYTDLSGWLGRLDADRARAR*
Ga0105252_1000801313300009678SoilIKEFALPRPDARPFGITVDGANNVWYSDLSGWLGRLDASRARDR*
Ga0105088_107447323300009810Groundwater SandFTELRAHKLGRVRGGVVKEFPLARRDARPFGVAVDAANNVWYTDLSGWLGMLPADRARGN
Ga0134082_1056279723300010303Grasslands SoilRDAARPFGVAVDAANNVWYTDLGGWLGVLPAASATSR*
Ga0134071_1071878623300010336Grasslands SoilGRVRAGEITEYVLPRPDARPFGITVDAGNNVWYTDLGGWLGRLAADRARAR*
Ga0126370_1038908913300010358Tropical Forest SoilARPFGIAVDGAGNVWYTDLSGWLGRLSAERARAR*
Ga0126376_1047529813300010359Tropical Forest SoilHADARPYSVAVDAAGNIWYTDISGWLGMLPAHRARSQ*
Ga0126372_1023337413300010360Tropical Forest SoilRPDARPIGIAVDAGNNVWYADLSGWLGRLDAGRARVR*
Ga0126372_1059236313300010360Tropical Forest SoilSRPFGVAVDAADNVWYTDLSGWLGMLPASAAQAP*
Ga0126372_1299713713300010360Tropical Forest SoilRSDARPFGIAVDAAGNVWYTDLSGRLGRLSAQRALRR*
Ga0126378_1187860813300010361Tropical Forest SoilFRLPRTERRPFGVAVDAANNVWYTDLSGWLGMLPAIAATGR*
Ga0126379_1295197033300010366Tropical Forest SoilPRPNSRPFGVAVDAANNVWYTDLAGWLGMLPASAAKAP*
Ga0126381_10406119023300010376Tropical Forest SoilDARPFGIAVDAAGNVWYTDLSGTLGRLSAQRARRR*
Ga0134123_1193376723300010403Terrestrial SoilARPFSVAVDGEGNVWYTDLHGWLGKLSAERARAR*
Ga0137422_100636623300011416SoilPDARPFGITVDSANNVWYSDLSGWLGRLDASRARDR*
Ga0137389_1103381123300012096Vadose Zone SoilVRDGIITEFTLPRSDARPFGIAVDARNNVWYTDLSGWIGRLAAERARGG*
Ga0137389_1123641213300012096Vadose Zone SoilGRVAEFRLPRADGRPFGVAVDAANNVWYTDLSGWFGMLPAGRAKAR*
Ga0137388_1049377113300012189Vadose Zone SoilHRLGRLHGGAITEFDLPRPDARPFGITVDAGNNVWYTDLSGWLGRLDAHRARVR*
Ga0137383_1034551633300012199Vadose Zone SoilVMEFRLPRTESRPFGVAVDAANNVWYTDLSGWLGMLPAVRAKAP*
Ga0137363_1113200913300012202Vadose Zone SoilIITEFALPRPDARPFGIAVDARNNVWYTDLSGWIGRLAAERARGG*
Ga0137362_1107972713300012205Vadose Zone SoilGRVRDGIITEFALPRPDARPFGIAVDARNNVWYTDLSGWIGRLAAERARGG*
Ga0137381_1005309323300012207Vadose Zone SoilVRDGVITEFALPRGDARPFGITVDASNNVWYTDLSGWLGRLAADRARGR*
Ga0137387_1050959313300012349Vadose Zone SoilADSRPFGVMVDKANNVWYTDLSGWLGMLPAVAAQAP*
Ga0137372_1036220713300012350Vadose Zone SoilISRLHGGAITEFALPRRDARPFGITVDAGNNVWYTDLSGWLGRLDADRARVR*
Ga0137385_1100921423300012359Vadose Zone SoilRDGVITEFALPRGDARPFGIAVDASNNVWYTDLSGWLGRLAADRARGR*
Ga0137375_1131176613300012360Vadose Zone SoilDARPFGITVDASNNVWYTDLSGWLGRLAADRARGR*
Ga0137358_1070399023300012582Vadose Zone SoilFVLPRADARPFGITVDAGNTVWYTDLSGWLGRLDASHARTRERR*
Ga0137396_1023328333300012918Vadose Zone SoilRRDARPFGVAVDRANNVWYTDLGGWLGMLRAAQATSR*
Ga0137416_1065300023300012927Vadose Zone SoilARPFGVAVDAANNVWYTDLSGWLGMLPAASATSR*
Ga0137404_1136985013300012929Vadose Zone SoilARPFGITVDASNNVWYTDLSGWLGRLAADRARGR*
Ga0163162_1288277113300013306Switchgrass RhizosphereRGDARPFGITVDASNNVWYTDLSGWLGRLSADRARGR*
Ga0163163_1299391113300014325Switchgrass RhizosphereALPRRDARPFGVAVDGANNVWYTDLSGWLGMVRGERARAE*
Ga0134073_1023572413300015356Grasslands SoilSRPFGVAVDAANNVWYTDLSGSLGMLPAARAKAP*
Ga0132257_10045622413300015373Arabidopsis RhizosphereARPFGVAVDAANNVWYTDRSGWLGRLDADRARVR*
Ga0182035_1034156413300016341SoilFRLPRADGRPFGVGTDAANNVWYTDLTGWLGMLPAGRARAP
Ga0182032_1067179413300016357SoilLPQSDARPFGIAVDGAGNVWYTDLSGRLGRLSAEQARGR
Ga0182037_1064208423300016404SoilVAEFRLPRADGRPFAVAVDRANNVWYTDLSGWLGMLPAGRAKAP
Ga0182037_1156994923300016404SoilRDGRITEFRLPRADGRPFGVGTDAANNVWYTDLTGWLGMLPAGRARAP
Ga0182038_1053643523300016445SoilRLPRADGRPFGVGTDAANNVWYTDLTGWLGMLPAGRARAP
Ga0134074_107017913300017657Grasslands SoilITEYVLPRSDARPFGITVDAGNNVWYTDLSGWLGRLDADRARVR
Ga0066667_1200719813300018433Grasslands SoilSDARPFGITVDAGNNVWYTDLSGWLGRLDADRARAR
Ga0210381_1041148613300021078Groundwater SedimentHRLGRVQATTIREFVLPRDDARPFGIAVDAGNNVWYTDLSGWVGRLDAKRARAR
Ga0210409_1094437623300021559SoilPRSDARPFGIAVDAAANVWYTDLSGALGRLSAQRARSR
Ga0126371_1185622913300021560Tropical Forest SoilVQEFALPRRDARPFGVAIDRANNVWYTDLSGWIGRLAAERARGR
Ga0207710_1048545613300025900Switchgrass RhizosphereRGGRVKEFALPRRDARPFGVAVDGANNVWYTDLSGWLGMVRGERARAE
Ga0207684_1136750213300025910Corn, Switchgrass And Miscanthus RhizosphereDGRVTEFRLPRADARPFGVAVDRANNVWYTDLGGWLGMLRAASATSR
Ga0207701_1112113313300025930Corn, Switchgrass And Miscanthus RhizospherePLPRSDARPFGIAVDGSGNVWFTDLSGGLGRLSAERTRGR
Ga0209236_109137213300026298Grasslands SoilVLPRSDARPFGITVDAANNVWYTDLSGWVGRLDASRAQIR
Ga0209761_103790013300026313Grasslands SoilAGAITEFVLPRADARPFGVNVDAGNNVWYTDLSGWLGRLAADRARVR
Ga0209471_115161923300026318SoilMAEFPLPRSDARPFDVAVDAANNVWYTDLSGWLGRLSAERARVR
Ga0209470_133586523300026324SoilKLGRVRDGVITEFALPRGDARPFGITVDASNNVWYTDLSGWLGRLDADRARVR
Ga0209801_117154623300026326SoilGGVTEFVLPRSDARPFGITVDADNNVWYTDLSGWLGRLDADRARAR
Ga0209056_1007002643300026538SoilDGRVTEFRLPRADARPFGVAVDRANNVWYTDLGGWLGMLRAAQATSR
Ga0209684_101360713300027527Tropical Forest SoilSDARPFGIAVDDAGNVWYTDLSGRLGRLSAEQARGR
Ga0209388_105828023300027655Vadose Zone SoilVLPRPDARPFGITVDAGNNVWYTDLGGWLGRLAADRARAR
Ga0209283_1022335913300027875Vadose Zone SoilGRVRDGIITEFTLPRSDARPFGIAVDARNNVWYTDLSGWIGRLAAERARGG
Ga0209590_1077489233300027882Vadose Zone SoilALPRRDARPFGITVDARNNVWYTDLSGWLGRLDADRARVR
Ga0268264_1216558713300028381Switchgrass RhizosphereYVLPRADARPFGIAVDAGNNVWYTDLSGWLGRLDADRARAR
Ga0137415_1100667523300028536Vadose Zone SoilRLRDGTITEFELPRPDARPFGITVDGANNVWYSDLSGWLGRLDAGPARGR
Ga0247828_1015586223300028587SoilNAPEAITEFALPRAEARPFGIAVDAGNNVWYTDLSGWLGRLDAERARVR
Ga0247826_1000874353300030336SoilHAGAITEFALPRAEARPFGIAVDAGNNVWYTDLSGWLGRLDAERARVR
Ga0307498_1011188313300031170SoilGTIKEFALPRPDARPFGITVDGANNVWYSDLSGWLGRLDASRARDR
Ga0318528_1012588423300031561SoilTEFRLPRADGRPFGVGTDAANNVWYTDLTGWLGMLPAGRARAP
Ga0307469_1070340823300031720Hardwood Forest SoilLPRPDARPFGITVDAGNNVWYTDLSGWLGRLDADRARIR
Ga0307469_1121097223300031720Hardwood Forest SoilGRVRDGRVTEFRLPRPDARPFGIAVDRANNVWYTDLSGWLGMLRAGHARSR
Ga0307469_1199210023300031720Hardwood Forest SoilDGVITEFALPRGDARPFGITVDASNNVWYTDLSGWLGRLSADRARGR
Ga0307469_1234600223300031720Hardwood Forest SoilRVRDGIVREFPLPRRDARPFGVAVDRANNVWYTDLSGWLGMFRADRARNE
Ga0318493_1017915123300031723SoilPQSDARPFGIAVDGAGNVWYTDLSGRLGRLSAEQARGG
Ga0307468_10016782313300031740Hardwood Forest SoilLPRPDARPFGIAVDVGNNVWYTDLSGWIGRLDADRARVR
Ga0306918_1030309713300031744SoilRVAEFRLPRADGRPFAVAVDRANNVWYTDLSGWLAMLPAVRAKAP
Ga0318502_1021368523300031747SoilRLPRPDGRPFAVAVDRANNVWYTDLSGWLAMLPAVRAKAP
Ga0318546_1018161133300031771SoilERHPFGVAVDAANNVWYTDLSGWLGMLPASAAETP
Ga0318548_1060118813300031793SoilDGRPFAVAVDRANNVWYTDLSGWLAMLPAVRAKAP
Ga0318576_1033530913300031796SoilGKVAEFRLPRTERRPFGVAVDAANNVWYTDLSGWLGMLPASAAETP
Ga0310884_1011328113300031944SoilAGAITEFALPRAEARPFGIAVDAGNNVWYTDLSGWLGRLDAERARVR
Ga0306922_1045625313300032001SoilGRVAEFRLPRADGRPFAVAVDRANNVWYTDLSGWLAMLPAVRAKAP
Ga0310899_1040772123300032017SoilSLGRVHAGAITEFALPRAEARPFGIAVDAGNNVWYTDLSGWLGRLDAERARGR
Ga0318513_1035523313300032065SoilSLPRASARPFGVTVDSANNVWYTDLSGWLGMLPATVAKAP
Ga0306924_1150588323300032076SoilAEFRLPRTERRPFGVAVDAANNVWYTDLSGWLGMLPASAAKAP
Ga0318540_1019518913300032094SoilPRPGSRPFAVAVDPSNNVWYTDLSGWLGMLPAAQAKAP
Ga0307471_10126244823300032180Hardwood Forest SoilGHKLGRVHAGRITEFVLPRAEARPFGIAVDAANNVWYTDLSGWLGRLDADRARVR
Ga0335077_1201151823300033158SoilPDARPFGIAVDDGGNVWFTDLTGRLGRLSAQRARGW
Ga0364945_0218309_3_1853300034115SedimentFTETRAQKLGRVRGGVIKEFALPRRDARPFGVAVDEANNVWYTDLSGWLGMLGSDRARAE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.