Basic Information | |
---|---|
Family ID | F071176 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 122 |
Average Sequence Length | 44 residues |
Representative Sequence | DKDPQVFGRAVVGAVSDAVGYFLTHPGVDADSLAASLCRIFAP |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.64 % |
% of genes near scaffold ends (potentially truncated) | 99.18 % |
% of genes from short scaffolds (< 2000 bps) | 86.07 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.67 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.541 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.410 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.049 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.279 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.48% β-sheet: 0.00% Coil/Unstructured: 53.52% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF02659 | Mntp | 27.05 |
PF08241 | Methyltransf_11 | 8.20 |
PF12867 | DinB_2 | 4.92 |
PF01476 | LysM | 4.92 |
PF05768 | Glrx-like | 4.10 |
PF00078 | RVT_1 | 1.64 |
PF01726 | LexA_DNA_bind | 1.64 |
PF00196 | GerE | 0.82 |
PF13474 | SnoaL_3 | 0.82 |
PF00583 | Acetyltransf_1 | 0.82 |
PF00155 | Aminotran_1_2 | 0.82 |
PF00440 | TetR_N | 0.82 |
PF00903 | Glyoxalase | 0.82 |
PF00535 | Glycos_transf_2 | 0.82 |
PF16327 | CcmF_C | 0.82 |
PF14534 | DUF4440 | 0.82 |
PF12681 | Glyoxalase_2 | 0.82 |
PF01256 | Carb_kinase | 0.82 |
PF05190 | MutS_IV | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG1971 | Putative Mn2+ efflux pump MntP | Inorganic ion transport and metabolism [P] | 27.05 |
COG0695 | Glutaredoxin | Posttranslational modification, protein turnover, chaperones [O] | 4.10 |
COG3118 | Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family | Posttranslational modification, protein turnover, chaperones [O] | 4.10 |
COG0063 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domain | Nucleotide transport and metabolism [F] | 0.82 |
COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 0.82 |
COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.54 % |
Unclassified | root | N/A | 2.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459007|GJ61VE201CIKCH | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300000887|AL16A1W_10191097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
3300001661|JGI12053J15887_10071711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1917 | Open in IMG/M |
3300002558|JGI25385J37094_10082401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 994 | Open in IMG/M |
3300004479|Ga0062595_101462607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 627 | Open in IMG/M |
3300005174|Ga0066680_10213900 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300005435|Ga0070714_100800630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 913 | Open in IMG/M |
3300005447|Ga0066689_10234898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1123 | Open in IMG/M |
3300005467|Ga0070706_101758706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
3300005468|Ga0070707_100653026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1014 | Open in IMG/M |
3300005468|Ga0070707_101334981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 | 683 | Open in IMG/M |
3300005471|Ga0070698_100057581 | All Organisms → cellular organisms → Bacteria | 3932 | Open in IMG/M |
3300005471|Ga0070698_100167083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2142 | Open in IMG/M |
3300005471|Ga0070698_100981704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 791 | Open in IMG/M |
3300005518|Ga0070699_100097379 | All Organisms → cellular organisms → Bacteria | 2577 | Open in IMG/M |
3300005536|Ga0070697_100006946 | All Organisms → cellular organisms → Bacteria | 8802 | Open in IMG/M |
3300005542|Ga0070732_10214988 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
3300005546|Ga0070696_100256255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1325 | Open in IMG/M |
3300005553|Ga0066695_10032443 | All Organisms → cellular organisms → Bacteria | 3027 | Open in IMG/M |
3300005556|Ga0066707_10358029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 954 | Open in IMG/M |
3300005566|Ga0066693_10456536 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005575|Ga0066702_10928961 | Not Available | 519 | Open in IMG/M |
3300005586|Ga0066691_10441570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 776 | Open in IMG/M |
3300005598|Ga0066706_11000126 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300006050|Ga0075028_100375672 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300006055|Ga0097691_1193796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 525 | Open in IMG/M |
3300006102|Ga0075015_100084399 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
3300006638|Ga0075522_10266961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 839 | Open in IMG/M |
3300006852|Ga0075433_10261681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1533 | Open in IMG/M |
3300006854|Ga0075425_102332371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 594 | Open in IMG/M |
3300006903|Ga0075426_10140160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1742 | Open in IMG/M |
3300006954|Ga0079219_11124615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 669 | Open in IMG/M |
3300007265|Ga0099794_10139932 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300007265|Ga0099794_10334636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 | 786 | Open in IMG/M |
3300009012|Ga0066710_103783967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 568 | Open in IMG/M |
3300009038|Ga0099829_10521790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 986 | Open in IMG/M |
3300009088|Ga0099830_10562212 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300009137|Ga0066709_100644325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1516 | Open in IMG/M |
3300009137|Ga0066709_103679467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 556 | Open in IMG/M |
3300009137|Ga0066709_103697730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
3300010321|Ga0134067_10109292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 954 | Open in IMG/M |
3300010337|Ga0134062_10651979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
3300010361|Ga0126378_12730431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 564 | Open in IMG/M |
3300010373|Ga0134128_10126395 | All Organisms → cellular organisms → Bacteria | 2897 | Open in IMG/M |
3300010396|Ga0134126_10180787 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
3300011271|Ga0137393_10933332 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300011992|Ga0120146_1026636 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300011992|Ga0120146_1049183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 702 | Open in IMG/M |
3300011996|Ga0120156_1000826 | All Organisms → cellular organisms → Bacteria | 10996 | Open in IMG/M |
3300011999|Ga0120148_1019878 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
3300012010|Ga0120118_1044118 | Not Available | 1138 | Open in IMG/M |
3300012019|Ga0120139_1097161 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300012096|Ga0137389_10317362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1321 | Open in IMG/M |
3300012189|Ga0137388_11595021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 588 | Open in IMG/M |
3300012200|Ga0137382_10411907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 953 | Open in IMG/M |
3300012200|Ga0137382_11251125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
3300012202|Ga0137363_11376582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 595 | Open in IMG/M |
3300012203|Ga0137399_10542713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 976 | Open in IMG/M |
3300012203|Ga0137399_10638756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 895 | Open in IMG/M |
3300012203|Ga0137399_10803289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 | 792 | Open in IMG/M |
3300012207|Ga0137381_11329871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 611 | Open in IMG/M |
3300012210|Ga0137378_10307957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1473 | Open in IMG/M |
3300012210|Ga0137378_10854241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 823 | Open in IMG/M |
3300012211|Ga0137377_10162491 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
3300012349|Ga0137387_10747082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 708 | Open in IMG/M |
3300012351|Ga0137386_11029968 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 584 | Open in IMG/M |
3300012357|Ga0137384_11207577 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
3300012359|Ga0137385_11171401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 630 | Open in IMG/M |
3300012362|Ga0137361_11354927 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300012363|Ga0137390_10838075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 876 | Open in IMG/M |
3300012923|Ga0137359_11707335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 517 | Open in IMG/M |
3300012925|Ga0137419_10375832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1105 | Open in IMG/M |
3300012925|Ga0137419_11964890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 | 503 | Open in IMG/M |
3300012944|Ga0137410_10048406 | All Organisms → cellular organisms → Bacteria | 3021 | Open in IMG/M |
3300012977|Ga0134087_10137135 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1054 | Open in IMG/M |
3300013104|Ga0157370_11634794 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300013501|Ga0120154_1022333 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
3300013763|Ga0120179_1022866 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
3300013766|Ga0120181_1049221 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300013766|Ga0120181_1072497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 759 | Open in IMG/M |
3300013768|Ga0120155_1015416 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
3300013768|Ga0120155_1120827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 722 | Open in IMG/M |
3300013772|Ga0120158_10025652 | All Organisms → cellular organisms → Bacteria | 4668 | Open in IMG/M |
3300013772|Ga0120158_10275272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 828 | Open in IMG/M |
3300014827|Ga0120171_1075987 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300015052|Ga0137411_1287555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 893 | Open in IMG/M |
3300015358|Ga0134089_10502058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 531 | Open in IMG/M |
3300015359|Ga0134085_10160385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 957 | Open in IMG/M |
3300015359|Ga0134085_10605980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 509 | Open in IMG/M |
3300018468|Ga0066662_10670630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 984 | Open in IMG/M |
3300018482|Ga0066669_10829752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 821 | Open in IMG/M |
3300019879|Ga0193723_1060808 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
3300021046|Ga0215015_10039476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1652 | Open in IMG/M |
3300021046|Ga0215015_10821932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 728 | Open in IMG/M |
3300021432|Ga0210384_11277580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 639 | Open in IMG/M |
3300021479|Ga0210410_10390769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1247 | Open in IMG/M |
3300024323|Ga0247666_1053708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 813 | Open in IMG/M |
3300025862|Ga0209483_1196645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 807 | Open in IMG/M |
3300025915|Ga0207693_10177709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1675 | Open in IMG/M |
3300025916|Ga0207663_10910587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 703 | Open in IMG/M |
3300025922|Ga0207646_10445557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1168 | Open in IMG/M |
3300026295|Ga0209234_1024565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2284 | Open in IMG/M |
3300026295|Ga0209234_1169243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 762 | Open in IMG/M |
3300026314|Ga0209268_1021704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2331 | Open in IMG/M |
3300026332|Ga0209803_1171366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 823 | Open in IMG/M |
3300026333|Ga0209158_1270432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 582 | Open in IMG/M |
3300026342|Ga0209057_1161149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 677 | Open in IMG/M |
3300026529|Ga0209806_1174052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 792 | Open in IMG/M |
3300026551|Ga0209648_10052564 | All Organisms → cellular organisms → Bacteria | 3483 | Open in IMG/M |
3300027587|Ga0209220_1152170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 598 | Open in IMG/M |
3300027748|Ga0209689_1018943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae | 4306 | Open in IMG/M |
3300027748|Ga0209689_1286370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 645 | Open in IMG/M |
3300027862|Ga0209701_10048239 | All Organisms → cellular organisms → Bacteria | 2740 | Open in IMG/M |
3300027882|Ga0209590_10680583 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
3300027882|Ga0209590_11019462 | Not Available | 515 | Open in IMG/M |
3300029636|Ga0222749_10765327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
3300031672|Ga0307373_10382576 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300031720|Ga0307469_11532506 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300031740|Ga0307468_101410429 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300031820|Ga0307473_10776627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 681 | Open in IMG/M |
3300032180|Ga0307471_100540237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1319 | Open in IMG/M |
3300032180|Ga0307471_100632626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1231 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.41% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 13.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.30% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.20% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.92% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.46% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.46% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.46% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.64% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.64% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.82% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.82% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.82% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011992 | Permafrost microbial communities from Nunavut, Canada - A23_65cm_12M | Environmental | Open in IMG/M |
3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300014827 | Permafrost microbial communities from Nunavut, Canada - A3_80cm_18M | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
L02_01693160 | 2170459007 | Grass Soil | ADRDPQVFGRAVVGAVNDSVAYFLTHPGADAEALAQSLCGIFAPEG |
AL16A1W_101910972 | 3300000887 | Permafrost | VGAVNDAVAYFLTHPGTDAESLAQSLCRIFAPELAGTPE* |
JGI12053J15887_100717111 | 3300001661 | Forest Soil | HAMLHDPFYADKDPQVFGRAVVGAVSDAVGHFLTHPGVDADSLAESLCRIFAP* |
JGI25385J37094_100824013 | 3300002558 | Grasslands Soil | PAVFGRAVVGAVSDAVGYFLTHPGVDSESLASSLCVIFAP* |
Ga0062595_1014626072 | 3300004479 | Soil | PAVFGRAVVGAVNDAVSHFLTHPGVDADELAAGLCRIFAP* |
Ga0066680_102139001 | 3300005174 | Soil | DKDPAVFGRAVVGAVSDAVGYFLTHPGADANSLAASLCRIFAP* |
Ga0070714_1008006303 | 3300005435 | Agricultural Soil | EVRHAREHDPFYADKDPQVFGRAVVGAVNDAVSYFLTHPGADAASLAESLCRIFAP* |
Ga0066689_102348983 | 3300005447 | Soil | DKDPAVFGRAVVGAVSDAVGYFLTHPGADADSLAASLCVIFAP* |
Ga0070706_1017587061 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLALLDDEFYADQDPQVFGRAVVGAVNDAVGYFLTHPGADADSLADSLCRIFAP* |
Ga0070707_1006530261 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ANQDPQVFGRAVVGAVNDAVGYFLTHPGADAESLADSLCRIFAP* |
Ga0070707_1013349812 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHDAFYADKDPVVFGRAVVGAVSDAVGYFLTHPGVDADSLAASLCLIFAP* |
Ga0070698_1000575818 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | HDPFYSDKDPAVFGRAVVGAVSDAVGYFLTHPGADAESLASSLCVIFAP* |
Ga0070698_1001670831 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | QVFGRAVVGAVNDAVGYFLTHPGADAESLAESLCRIFAP* |
Ga0070698_1009817042 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | HDPFYSDKDPAVFGRAVVGAVSDAVGYFLTHPGADAESLAESLCRIFAP* |
Ga0070699_1000973796 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | QDPQVFGRAVVGAVNDAVGYFLTHPGADAESLAESLCRIFAP* |
Ga0070697_1000069461 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | HDAFYADKDPVVFGRAVVGAVSDAVGYFLTHPGVDADSLAASLCLIFAP* |
Ga0070732_102149881 | 3300005542 | Surface Soil | AVVGAVSDAVGYFLTHPGVDAESLAASLCTIFAP* |
Ga0070696_1002562551 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | FYRDKDPEVFGRAVVGAVNDAVGYFLTHHGVDARSLSASLCRIFAP* |
Ga0066695_100324437 | 3300005553 | Soil | FGRAVVGAVSDAVGYFLTHPGVDADSLAESLCVIFAP* |
Ga0066707_103580293 | 3300005556 | Soil | AVFGRAVVGAVSDAVGYFLTHPGVDADSLAASLCVIFAP* |
Ga0066693_104565361 | 3300005566 | Soil | FYADKDPAVFGRAVVGAVSDAVGYFLTHPGADADLLAASLCRIFAP* |
Ga0066702_109289612 | 3300005575 | Soil | PVVFGRAVVGAVSEATGHFLAQPQADPEALAASLCRIFAP* |
Ga0066691_104415702 | 3300005586 | Soil | VRHAMSHDPFYADKDPAVFGRAVVGAVSDAVGYFLTHPGADADSLAASLCVIFAP* |
Ga0066706_110001261 | 3300005598 | Soil | FYADKDPAVFGRAVVGAVSDAVGYFLTHPGADADSLAASLCRIFAP* |
Ga0075028_1003756721 | 3300006050 | Watersheds | PQVFGRAVVGAVSDAVGYFLTHPGAKAEALAASLCGIFAP* |
Ga0097691_11937961 | 3300006055 | Arctic Peat Soil | VFGRAVVGAVSDAVGYFLTHPGVDAESLAASLCRIFAP* |
Ga0075015_1000843991 | 3300006102 | Watersheds | FGRAVVGAVTDAVGYFLTHPGAGADSLAENLCAIFAP* |
Ga0075522_102669611 | 3300006638 | Arctic Peat Soil | FYANKDPQVFGRAVVGAVNDAVGYFLTHPGVDADSLAASLCRIFAP* |
Ga0075433_102616811 | 3300006852 | Populus Rhizosphere | GRAVVGAVSDAVGYYLTHPGADADRLAASLCVIFAP* |
Ga0075425_1023323711 | 3300006854 | Populus Rhizosphere | PAVFGRAVVGAVSDAVGYYLTHPGADADRLAASLCVIFAP* |
Ga0075426_101401602 | 3300006903 | Populus Rhizosphere | FGRAVVGAVSDAVGYYLTHPGADADRLAASLCVIFAP* |
Ga0079219_111246152 | 3300006954 | Agricultural Soil | DPVVFGRAVVGAVNDAVSYFLTHPGADADSLAASLCRIFAP* |
Ga0099794_101399323 | 3300007265 | Vadose Zone Soil | ADKEPQVFGRAVVGAVNDSVGYYLTHPGADAESLAASLCRIFAP* |
Ga0099794_103346361 | 3300007265 | Vadose Zone Soil | YADKEPQVFGRAVVGAVNDSVGYYLTHPGADADSLAASLCRIFAP* |
Ga0066710_1037839671 | 3300009012 | Grasslands Soil | KDPAVFGRAVVGAVNDAVSYFLTHPGADADSLAASLCRIFAP |
Ga0099829_105217901 | 3300009038 | Vadose Zone Soil | PFYADKDPRVFGRAAVGAVSDAVGYYLTHPGMDADSLADSLCRIFAP* |
Ga0099830_105622123 | 3300009088 | Vadose Zone Soil | VVFGRSVVGAVNDAVSYFLTHPGADAESLADSLCRIFAP* |
Ga0066709_1006443251 | 3300009137 | Grasslands Soil | AVFGRAVVGAVNDAVSYFLTHPGVDADSLAASLCRIFAP* |
Ga0066709_1036794671 | 3300009137 | Grasslands Soil | PAVFGRAVVGAVSDAVGYFLTHPGVDADSLAESLCVIFAP* |
Ga0066709_1036977301 | 3300009137 | Grasslands Soil | VFGRAVVGAVSDAVGYFLTHPGVDADSLAESLCVIFAP* |
Ga0134067_101092923 | 3300010321 | Grasslands Soil | FGRAVVGAVYEATSHFLVDPDVDLEALIRGLCAIFAPET* |
Ga0134062_106519791 | 3300010337 | Grasslands Soil | RAVVGAVSDAVGYFLTHPGVDADSLASSLCVIFAP* |
Ga0126378_127304312 | 3300010361 | Tropical Forest Soil | YADKDPAVFGRAVVGGVSDAVGYFLTHPGVDADSLAASLCRIFAP* |
Ga0134128_101263951 | 3300010373 | Terrestrial Soil | DPEVFGRAVVGAVNDAVGYFLTHPGVDERSLSASLCRIFAP* |
Ga0134126_101807871 | 3300010396 | Terrestrial Soil | HDAFYADKDPAVFGRAVVGAVSDATGYFLTHPGVDARSLSASLCRIFAP* |
Ga0137393_109333322 | 3300011271 | Vadose Zone Soil | PFYANHDPQVFGRAVVGAVNDAVGYFLTHPGADAESLAESLSRIFAP* |
Ga0120146_10266363 | 3300011992 | Permafrost | FYADKDPQVFGRAVVGAVNDSVGYYLTHPGADAESLAGSLCRIFAP* |
Ga0120146_10491831 | 3300011992 | Permafrost | HDPFYADKDPQVFGRAVVGAVSDAVGYFLTHPGVDADSLAASLCRIFAP* |
Ga0120156_10008261 | 3300011996 | Permafrost | VGAVNDAVAYFLTHPGADAESLAQSLCGIFAPGSE* |
Ga0120148_10198781 | 3300011999 | Permafrost | GHDPFYADKDPQVFGRAVVGAVNDSVGYYLTHPGADAESLAGSLCRIFAP* |
Ga0120118_10441183 | 3300012010 | Permafrost | FGRAVVGAVSDAVGHFLTHPGVEADALAASLCRIFAP* |
Ga0120139_10971612 | 3300012019 | Permafrost | ALLHDPFYADKDPVVCGRAVVGAVNDAVAYFLTHPGADAESLAQSLCGIFAPDSE* |
Ga0137389_103173623 | 3300012096 | Vadose Zone Soil | DDAFYANQDPQVFGRAVVGAVNDAVGYFLTHPGADAESLADSLCRIFAP* |
Ga0137388_115950212 | 3300012189 | Vadose Zone Soil | RAVVGAVNEAVSYFLTHPGADADSLAASLCRIFAP* |
Ga0137382_104119071 | 3300012200 | Vadose Zone Soil | QFYADKDPQVFGRAVVGAVSDAVGYFLTHPGVDAESLAASLCRIFAP* |
Ga0137382_112511252 | 3300012200 | Vadose Zone Soil | EVRHAMTHDNFYADKDPVVFGRAVVGAVSDAVGYYLTHPGVDADSLAASLCRIFAP* |
Ga0137363_113765821 | 3300012202 | Vadose Zone Soil | KDPVIFGRAVVGAVSDAVGYFLTHPGANADSLAASLCIIFAP* |
Ga0137399_105427133 | 3300012203 | Vadose Zone Soil | YADKDPQVFGRAVVGAVSDAVGYFLTHPGVDADSLAASLCRIFAP* |
Ga0137399_106387561 | 3300012203 | Vadose Zone Soil | HDPFYADKDPQVFGRAVVGAVSDAVGYFLTHPGVDAESLAASLCRIFAP* |
Ga0137399_108032891 | 3300012203 | Vadose Zone Soil | EVRHAIPHDRFYADKDPQVFGRAVVGAVNDAVGYFLTHPGADSESLAGSLCKIFAP* |
Ga0137381_113298711 | 3300012207 | Vadose Zone Soil | DDDFYANQDPQVFGRAVVGAVNDAVGYFLTHPGADAESLADSLCRIFAP* |
Ga0137378_103079571 | 3300012210 | Vadose Zone Soil | NQDPQVFGRAVVGAVNDAVGYFLTHPGADAESLADSLCRIFAP* |
Ga0137378_108542411 | 3300012210 | Vadose Zone Soil | NQDPQVFGRAVVGAVNDAVGYFLTHPGADAESLADSLCRIFPP* |
Ga0137377_101624915 | 3300012211 | Vadose Zone Soil | FYANQDPQVFGRAVVGAVNDAVGYFLTHPGADAESLAGSLCRIFAP* |
Ga0137387_107470822 | 3300012349 | Vadose Zone Soil | AMPHDAFYADKDPAVFGRAVVGAVSDAVGYFLTHPGVDADSLAESLCVIFAP* |
Ga0137386_110299682 | 3300012351 | Vadose Zone Soil | DKDPAVFGRAVVGAVSDAVGYFLTHPGVDAESLASSLCVIFAP* |
Ga0137384_112075771 | 3300012357 | Vadose Zone Soil | FYANQDPQVFGRAVVGAVNDAVGYFLTHPGADAESLADSLCRIFAP* |
Ga0137385_111714011 | 3300012359 | Vadose Zone Soil | KDPAVFGRAVEGAVSDAVGYFLTHPGVDADSLAESLCVIFAP* |
Ga0137361_113549271 | 3300012362 | Vadose Zone Soil | QDPQVFGRAVVGGVQDAVAYFLTHPGADAESLAESLCRIYAP* |
Ga0137390_108380751 | 3300012363 | Vadose Zone Soil | QVFGRAVVGAVNDSVGYYLTHPGADSDSLAESLCRIFAP* |
Ga0137359_117073351 | 3300012923 | Vadose Zone Soil | PVIFGRAVVGAVSDAVGYFLTHPGANADSLAASLCIIFAP* |
Ga0137419_103758321 | 3300012925 | Vadose Zone Soil | DPQVFGRAVVGAVSDAVGYFLTHPGGDAESLSESLCRIFAP* |
Ga0137419_119648902 | 3300012925 | Vadose Zone Soil | HDRFYADKDPQVFRRAVVGAVSDAVGYFLTHPGGDAASLSESLCRIFAP* |
Ga0137410_100484061 | 3300012944 | Vadose Zone Soil | KDPQVFGRAVVGAVSDAVGYFLTHPGVDAESLSESLCRIFAP* |
Ga0134087_101371352 | 3300012977 | Grasslands Soil | MPHDAFYADKDPAVFGRAVVGAVNDAVSYFLTHPGVDADSLAASLCRIFAP* |
Ga0157370_116347941 | 3300013104 | Corn Rhizosphere | PFYADKDPQVFGRAVVGAVSDSVGHFLTHPGYDADALAGSLCRIFAP* |
Ga0120154_10223331 | 3300013501 | Permafrost | VVGAVNDAVAYFLTHPGADAESLAQSLCGIFAPGSE* |
Ga0120179_10228664 | 3300013763 | Permafrost | VVGAVNDAVAYFLTHPGADAESLAQSLCRIFAPGSE* |
Ga0120181_10492213 | 3300013766 | Permafrost | HHAKLHDPFYADKDPQVFGRAVVGAVNDSVGYYLTHPGADAESLAGSLCRIFAP* |
Ga0120181_10724972 | 3300013766 | Permafrost | HDPFYADKDPQVFGRAVVGAVSDAVGFFLTHPGVDADSLAASLCRIFAP* |
Ga0120155_10154166 | 3300013768 | Permafrost | VGAVNDAVAYFLTHPGADAESLAQSLCRIFAPGSE* |
Ga0120155_11208272 | 3300013768 | Permafrost | MAHDPFYADKDPRVFGRAVVGAVSDGVGYYLTHPGMDADTLAESLCRIFAP* |
Ga0120158_100256527 | 3300013772 | Permafrost | DPVVFGRAVVGAVNDAVAYFLTHPGTDAESLAQSLCRIFAPELAGTPE* |
Ga0120158_102752721 | 3300013772 | Permafrost | DKDPQVFGRAVVGAVSDAVGYFLTHPGVDADSLAASLCRIFAP* |
Ga0120171_10759871 | 3300014827 | Permafrost | PVVFGRSVVVAVNDAVSYFLTHPGADAESLADSLCRIFAP* |
Ga0137411_12875554 | 3300015052 | Vadose Zone Soil | DPQVFGRAVVGAVSDAVGYFLTHPGVDAESLSESLCRIFAP* |
Ga0134089_105020581 | 3300015358 | Grasslands Soil | PAVFGRAVVGAVSDAVGYYLTHPGVDADSLAASLCVIFAP* |
Ga0134085_101603853 | 3300015359 | Grasslands Soil | AVFGRAVVGAVSDAVGYFLTHPGVDAGSLAESLCVIFAP* |
Ga0134085_106059802 | 3300015359 | Grasslands Soil | HAMNHDAFYTDKDPAVFGRAVVGAVSDAVGYFLTHPGADADSLASSLCVIFAP* |
Ga0066662_106706301 | 3300018468 | Grasslands Soil | DKDPAVFGRAVVGAVSDAVGYFLTHPGVDAESLASSLCVIFAP |
Ga0066669_108297522 | 3300018482 | Grasslands Soil | RAVVGAVSDAVGYFLTHPGVDAESLASSLCVIFAP |
Ga0193723_10608081 | 3300019879 | Soil | FYADRDPQVFGRAVVGAVNDSVAYFLTHPGADAEALAKSLCGIFAPEA |
Ga0215015_100394764 | 3300021046 | Soil | DQDPQVFGRAVVGAVNDAVGYFLTHPGADAESLADSLCRIFAP |
Ga0215015_108219322 | 3300021046 | Soil | LALLDDAFYANQDPQVFGRAVVGAVNDAVGYFLTHPGADADSLADSLCRIFAP |
Ga0210384_112775802 | 3300021432 | Soil | LHDPFYADKDPQVFGRATVGAVNDAVGYYLTHPGVDADALADSLCRIFAP |
Ga0210410_103907693 | 3300021479 | Soil | EFYADQDPQVFGRAVVGAVQDAVGYFLTHPGADAESLADSLCRIFAP |
Ga0247666_10537082 | 3300024323 | Soil | ARGHDPFFADKDPKTFGRAVVGAVSDAVGYFLTHPGMDAESLAGNLCRIFAP |
Ga0209483_11966452 | 3300025862 | Arctic Peat Soil | PFYANKDPQVFGRAVVGAVNDAVGYFLTHPGVDADSLAASLCRIFAP |
Ga0207693_101777091 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | QVFGRAVVGAVNDAVGYFLTHPGVAADSLAASLCRIFAP |
Ga0207663_109105873 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | QVFGRAVVGAVNDAVSYFLTHPGADAASLAESLCRIFAP |
Ga0207646_104455573 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RSVVGAVSDAVGYFLTHPGADAESLAESLCRIFAP |
Ga0209234_10245655 | 3300026295 | Grasslands Soil | PHDAFYADKDPAVFGRAVVGAVSDAVGYFLTHPGVDADSLAESLCVIFAP |
Ga0209234_11692432 | 3300026295 | Grasslands Soil | FGRAVVGAVSDAVGYFLTHPGVDADSLAASLCVIFAP |
Ga0209268_10217041 | 3300026314 | Soil | FYADKDPAVFGRAVVGAVSDAVGYFLTHPGVDAGSLAESLCVIFAP |
Ga0209803_11713661 | 3300026332 | Soil | DPAVFGRAVVGAVSDAVGYFLTHPGVDAESLASSLCVIFAP |
Ga0209158_12704321 | 3300026333 | Soil | VFGRAVVGAVSDAVGYFLTHPGVDAESLASSLCVIFAP |
Ga0209057_11611492 | 3300026342 | Soil | FGRAVVGAVSDAVGYFLTHPGVDAESLASSLCVIFAP |
Ga0209806_11740522 | 3300026529 | Soil | PFYADKDPEVFGRAVVGAVNDAVSYYLTHPGADAGSLAANLCRIFAP |
Ga0209648_100525647 | 3300026551 | Grasslands Soil | QDPQVFGRAVVGAVNDAVGYFLTHPGADAESLAESLCRIFAP |
Ga0209220_11521702 | 3300027587 | Forest Soil | HAMAHDPFYADKDPRVFGRAVVGAVSDAVGYFLTHPGMDADSLAESLCRIFAP |
Ga0209689_10189437 | 3300027748 | Soil | GRAVVGAVSDAVGYFLTHPGADADSLAASLCRIFAP |
Ga0209689_12863701 | 3300027748 | Soil | MPHDAFYADKDPAVFGRAVVGAVNDAVSYFLTHPGVDADSLAASLCRIFA |
Ga0209701_100482391 | 3300027862 | Vadose Zone Soil | DAFYANQDPQVFGRAVVGAVNDAVGYFLTHPGADAESLAESLCRIFAP |
Ga0209590_106805832 | 3300027882 | Vadose Zone Soil | VFGRAVVGSVSDAVGYFLTHPGADAESLAASLCRIFAP |
Ga0209590_110194621 | 3300027882 | Vadose Zone Soil | DDPFYANHDPQVFGRAVVGAVNDAVGYFLTHPGADADSLADSLCRIFAP |
Ga0222749_107653272 | 3300029636 | Soil | GRAVVGAVNDAVGYYLTHPGVDAEALSDSLCRIFAP |
Ga0307373_103825762 | 3300031672 | Soil | KDPQIFGRAVVGAVSDAVGYFLTHPGYDADALAESLCRIFAP |
Ga0307469_115325061 | 3300031720 | Hardwood Forest Soil | DAFYADKDPAVFGRAVVGAVSDAVGYFLTHPGVDADSLAESLCRIFAP |
Ga0307468_1014104291 | 3300031740 | Hardwood Forest Soil | DFYADRDPQVFGRAVVGAVNDSVAYFLTHPGADADALAQSLCGIFAPEA |
Ga0307473_107766271 | 3300031820 | Hardwood Forest Soil | HAMGHDEFYADKDPVVFGRAVVGAVSDAVGYFLTHPGADADTLAESLCRIFAP |
Ga0307471_1005402371 | 3300032180 | Hardwood Forest Soil | RHAMAHDAFYADKDPVVFGRAVVGAVSDAVGYFLTHPGADADSLAARLCRIFAP |
Ga0307471_1006326261 | 3300032180 | Hardwood Forest Soil | RHARAHDVFFADKDPVFFGRAVVGAVNDAVSYFLTHPGADADSLAASLCRIFAP |
⦗Top⦘ |