NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071293

Metagenome / Metatranscriptome Family F071293

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071293
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 146 residues
Representative Sequence MVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITMQVQITRYTGMRILHNYRNISRSSKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYALFANNQHPLQLYVYEEYNKFLRAAHCK
Number of Associated Samples 110
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 5.61 %
% of genes near scaffold ends (potentially truncated) 75.41 %
% of genes from short scaffolds (< 2000 bps) 86.89 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (87.705 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(17.213 % of family members)
Environment Ontology (ENVO) Unclassified
(44.262 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(45.902 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 52.98%    β-sheet: 0.00%    Coil/Unstructured: 47.02%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF02953zf-Tim10_DDP 0.82



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms87.70 %
UnclassifiedrootN/A12.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003430|JGI25921J50272_10094964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea635Open in IMG/M
3300004684|Ga0065168_1082065All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea508Open in IMG/M
3300004795|Ga0007756_11619335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea681Open in IMG/M
3300005527|Ga0068876_10738500All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea524Open in IMG/M
3300005662|Ga0078894_10134173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2213Open in IMG/M
3300006029|Ga0075466_1101659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum779Open in IMG/M
3300006122|Ga0007837_1043100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea767Open in IMG/M
3300006355|Ga0075501_1222554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300007520|Ga0105054_11152894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea525Open in IMG/M
3300007561|Ga0102914_1124103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea802Open in IMG/M
3300007722|Ga0105051_11096770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea567Open in IMG/M
3300008111|Ga0114344_1237038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea540Open in IMG/M
3300008508|Ga0110932_1036292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea511Open in IMG/M
3300009077|Ga0115552_1187021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum854Open in IMG/M
3300009216|Ga0103842_1015258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea727Open in IMG/M
3300009263|Ga0103872_1034577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300009434|Ga0115562_1124355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum989Open in IMG/M
3300009498|Ga0115568_10297276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum716Open in IMG/M
3300009606|Ga0115102_10241822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300009608|Ga0115100_11230352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum806Open in IMG/M
3300010307|Ga0129319_1022962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea651Open in IMG/M
3300012751|Ga0138277_1103059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea502Open in IMG/M
3300012768|Ga0138276_1018627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea506Open in IMG/M
3300012778|Ga0138269_1039650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea663Open in IMG/M
3300013014|Ga0164295_11531965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea517Open in IMG/M
3300013087|Ga0163212_1128982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea804Open in IMG/M
3300013087|Ga0163212_1179934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea664Open in IMG/M
(restricted) 3300013131|Ga0172373_10118049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1956Open in IMG/M
3300013295|Ga0170791_14250536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea686Open in IMG/M
3300013310|Ga0157622_1014764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea512Open in IMG/M
3300014838|Ga0182030_11358993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300016771|Ga0182082_1245561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea592Open in IMG/M
3300017166|Ga0186523_110107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea920Open in IMG/M
3300017238|Ga0186197_116364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea639Open in IMG/M
3300017280|Ga0186684_116226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum728Open in IMG/M
3300018415|Ga0181559_10377732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300018565|Ga0188826_118320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea570Open in IMG/M
3300018599|Ga0188834_1017321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea749Open in IMG/M
3300018706|Ga0193539_1038487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea807Open in IMG/M
3300018741|Ga0193534_1032344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea812Open in IMG/M
3300018766|Ga0193181_1021724All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum895Open in IMG/M
3300018961|Ga0193531_10176396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea817Open in IMG/M
3300018974|Ga0192873_10259677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea750Open in IMG/M
3300018979|Ga0193540_10084343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea864Open in IMG/M
3300018989|Ga0193030_10089328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum928Open in IMG/M
3300018989|Ga0193030_10111200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea854Open in IMG/M
3300018989|Ga0193030_10143836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea768Open in IMG/M
3300018996|Ga0192916_10105693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea843Open in IMG/M
3300019020|Ga0193538_10152559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea821Open in IMG/M
3300019036|Ga0192945_10133959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum794Open in IMG/M
3300019048|Ga0192981_10252350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum674Open in IMG/M
3300019051|Ga0192826_10348385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300019085|Ga0188830_1012466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea690Open in IMG/M
3300019136|Ga0193112_1071935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea821Open in IMG/M
3300019153|Ga0192975_10167758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea789Open in IMG/M
3300019276|Ga0182067_1025167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum696Open in IMG/M
3300021092|Ga0194122_10467736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea632Open in IMG/M
3300021169|Ga0206687_1628523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum752Open in IMG/M
3300021359|Ga0206689_10892780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300021924|Ga0063085_1116956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300021927|Ga0063103_1101270All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300021962|Ga0222713_10441341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum791Open in IMG/M
3300025388|Ga0208503_1031351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300025849|Ga0209603_1326423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300026495|Ga0247571_1119864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300027833|Ga0209092_10276848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum915Open in IMG/M
3300027849|Ga0209712_10597857All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300027963|Ga0209400_1284627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea640Open in IMG/M
3300028137|Ga0256412_1193642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum751Open in IMG/M
3300028137|Ga0256412_1242554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum665Open in IMG/M
3300028290|Ga0247572_1099097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300030542|Ga0210249_1187554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea508Open in IMG/M
3300030598|Ga0210287_1136335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea630Open in IMG/M
3300030625|Ga0210259_10433203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea688Open in IMG/M
3300030671|Ga0307403_10422523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea717Open in IMG/M
3300030671|Ga0307403_10808057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300030709|Ga0307400_10689670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300030725|Ga0308128_1024665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300030738|Ga0265462_11050358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea707Open in IMG/M
3300030738|Ga0265462_11188871All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea679Open in IMG/M
3300030740|Ga0265460_11141544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea739Open in IMG/M
3300030741|Ga0265459_11449504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea778Open in IMG/M
3300030741|Ga0265459_12108830All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea680Open in IMG/M
3300030743|Ga0265461_12585034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea601Open in IMG/M
3300031053|Ga0074018_1705103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea789Open in IMG/M
3300031524|Ga0302320_11124578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea815Open in IMG/M
3300031524|Ga0302320_11380742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea703Open in IMG/M
3300031717|Ga0307396_10365855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea690Open in IMG/M
3300031729|Ga0307391_10418374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea744Open in IMG/M
3300031739|Ga0307383_10643545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300031758|Ga0315907_11245528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea518Open in IMG/M
3300032050|Ga0315906_11362982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea501Open in IMG/M
3300032093|Ga0315902_11299633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea513Open in IMG/M
3300032462|Ga0335396_10864718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea538Open in IMG/M
3300032463|Ga0314684_10431446All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum774Open in IMG/M
3300032470|Ga0314670_10367682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum753Open in IMG/M
3300032521|Ga0314680_10402519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum851Open in IMG/M
3300032521|Ga0314680_10533637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum740Open in IMG/M
3300032522|Ga0314677_10308006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum838Open in IMG/M
3300032650|Ga0314673_10291856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum822Open in IMG/M
3300032650|Ga0314673_10336423All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum769Open in IMG/M
3300032651|Ga0314685_10393099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum768Open in IMG/M
3300032711|Ga0314681_10446654All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300032749|Ga0314691_10189473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum856Open in IMG/M
3300032750|Ga0314708_10295360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum796Open in IMG/M
3300032755|Ga0314709_10531285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300032756|Ga0315742_12439452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine17.21%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater9.84%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine9.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.02%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake7.38%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater4.10%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil4.10%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.28%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.28%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.28%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.28%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.46%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater2.46%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.46%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated2.46%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.64%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.64%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.64%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.64%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.82%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.82%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.82%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.82%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.82%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.82%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003430Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SDEnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004684Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2)EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006122Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007520Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008508Freshwater microbial communities from catchments in Singapore - Site BIEnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009221Microbial communities of water from Amazon river, Brazil - RCM2EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010307Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012751Freshwater microbial communities from Lake Montjoie, Canada - M_130821_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012768Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012778Freshwater microbial communities from Lake Croche, Canada - C_130208_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013014Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaGEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300013310Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES153 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016771Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017166Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in filtered seawater, 15 C, 29.4 psu salinity and 162 ?mol photons light - Favella taraikaensis Fe Narragansett Bay (MMETSP0436)Host-AssociatedOpen in IMG/M
3300017238Metatranscriptome of marine eukaryotic communities from unknown location in Brackish water medium, at 19 C, 5 psu salinity and 389 ?mol photons light - Pseudokeronopsis sp. Brazil (MMETSP1396)Host-AssociatedOpen in IMG/M
3300017280Metatranscriptome of coastal eukaryotic communities from Ligurian Sea in autoclaved artificial seawater, 19 C, 33 psu salinity and 638 ?mol photons light - Strombidium inclinatum S3 (MMETSP0208)Host-AssociatedOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018565Metatranscriptome of marine microbial communities from Baltic Sea - GS669_3p0_dTEnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018706Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789488-ERR1719151)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019136Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000325 (ERX1782382-ERR1712004)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021092Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10mEnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021845Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R876 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300025388Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE31Jul07 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030542Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR003SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030598Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE048SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030738Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031053Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - LB 6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032739Forest Soil Metatranscriptomics Site 2 LB Combined AssemblyEnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI25921J50272_1009496423300003430Freshwater LakeMVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITMQVQITRFTGMRILHNYRNISRASKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADMTDRHYALFANNQHPLQL
Ga0065166_1028483313300004112Freshwater LakeGFNNTAAALNPRVHPAKKTKIHADLTRYITMQVQITRFTGMRILHNYRNISRASKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPL*
Ga0065168_108206513300004684FreshwaterMVYKIRNKGFNNTVAALNPRVHPAKKTKIHADLTRYITMQVQITRFTGMRILHNYRNISRASKQFLMGDRILEQLMILTIKEHYFRPMYYKSPIENSFYLGRSLADLTDRHYALFANNQHPLQLSVYEEYNKFLRAAHSKEEQAGLQAIDQRM
Ga0007751_1079443423300004794Freshwater LakeGFNNWSAAQTVRAYPARKTKTQVNMTGHVTIQVHITRFTGMRIMHNYRNISRATKQFMMGDRFLEQLMILQLREHFFRPMYYNAPIENTFFMGRSLADLADRHYGLFANNQHPIQLSAYEEYNRFLRDLHDKTQAES*
Ga0007756_1161933513300004795Freshwater LakeRNKGFNNWSAAQTVRAYPARKTKTQVNMTGHVTIQVHITRFTGMRIMHNYRNISRATKQFMMGDRFLEQLMILQLREHFFRPMYYNAPIENTFFMGRSLADLADRHYGLFANNQHPIQLSAYEEYNRFLRDLHDKTQAES*
Ga0068876_1073850023300005527Freshwater LakeMVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITVQVQITRYTGMRILHNYRNISRACKQFMMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPLQLSVYEEYNKFLRAAHSKENQAALQSIG
Ga0078894_1013417313300005662Freshwater LakeMVFKIRNKGFNNTAAALNPRVHPAKKTKIQADLTRYITVQVQITRFTGMRILHNYRNISRATKQFMMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYALFANNQHPLQLYVYEEYNKFLRTAHN
Ga0075466_110165933300006029AqueousMVYKIRNKGFDIFAAASNPRVHPSKKTKIQVDLTRRITLQVQQTRFTGMRIKHGYRNISRATKQFLMGDRLLEQVVILTTKYHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYDAYNQFLRRQHSEAH*
Ga0007837_104310013300006122FreshwaterMLLILIIINIDIVNKEMVYKIRNKGFNNTVAALNPRVHPAKKTKIHADLTRYITMQVQITRFTGMRILHNYRNISRASKQFLMGDRILEQLMILTIKEHYFRPMYYKSPIENSFYLGRSLADLTDRHYALFANNQHPLQLSVYEEYNKFLRAAHSKEEQA
Ga0075501_122255413300006355AqueousKGFDIWAAATNPRVHPCKKTKINIDLTRCVTFQVSQTRFTGMRLKHGYRNISRATKQFLMGDKLLEQAVILTIKYHFFRPMHYESPIEQSFYLGRALADLTDRHYALFANNQHPLQMDIYDSYNRFLRVAHSEAHQQRLQKTQERVWELAE*
Ga0075498_121042723300006378AqueousNKAFNNFGVGQTIRLQPPLKTKLQMDLTTHVTLQTNITRYTGLRILHNYRNISRACKQFMMGDRFLEQIMIMTIREHYFRPMRYESPIEGNFFLGRNLADASDRHYALFALNQHPLQL*
Ga0105054_1115289413300007520FreshwaterMVYKIRNKGFNNTAAALNPRVHPGKKTKIHADLTRYITMQVQITRYTGMRLLHNYRNISRASKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRTLADLTDRHYSLFANNQHPLQLSVYEEYNRFLRDAHD*
Ga0102914_112410313300007561EstuarineMLLIAIIINIDIVNKEMVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITMQVQITRFTGMRILHNYRNISRASKQFLMGDRILEQLMILTIKEHYFRPMYYKSPIENSFYLGRSLADLTDRHYALFANNQHPLQLSVYEEYNKFL
Ga0105051_1109677013300007722FreshwaterMVYKIRNKGFNNTAAALNPRVHPGKKTKIHADLTRYITMQVQITRYTGMRLLHNYRNISRASKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRTLADLTDRHYSLFANNQHPLQLSVYEEYNRFLRDAHDKQNHASYEAFNERMDTVMTDRSKLLNQ
Ga0114344_123703813300008111Freshwater, PlanktonMVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITVQVQITRYTGMRILHNYRNISRACKQFMMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPLQLSVYEEYNKFLRAAHSKENQAALQSIGDRMGEVMEDRSR
Ga0110932_103629213300008508FreshwaterMVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITMQVQITRFTGMRILHNYRNISRATKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPLQLYVYEEYNKF
Ga0115552_118702123300009077Pelagic MarineMVYKIRNKGFDIWAAAANPRVHPSKKTKTGLDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEGHVQRAANTDARI*
Ga0103842_101525813300009216River WaterLKTKKIRNKGFNNFSTSAESFRVWPSKKTKTNVDLAYHVILQTHITRYSGMRILHNYRNISRASKQFMMGDKFFERIMILTIKEHFFRPMYYRSPIEQTFFLGRTMADLTDRHYALFANNQHPL*
Ga0103849_103823713300009221River WaterNNWSAAQTVRAYPARKTKTQVNMTGHVTIQVHITRFTGMRIMHNYRNISRATKQFMMGDRFLEQLMILQLREHFFRPMYYNAPIENTFFMGRSLADLADRHYGLFANNQHPIQLTAYEEYNRFLRDLHDKTQAET*
Ga0103872_103457723300009263Surface Ocean WaterVYKIRNKGFDIWAAATNPRVHPSKKTKIALDLTRCITLQVQQTRFTGMRIKHGYRNISRSCKQFLMGDKLLEQAVILTLKHHFFRPMYYQSPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYDNYNQMLRVLHDQGH*
Ga0115562_112435523300009434Pelagic MarineMVYKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI*
Ga0115568_1029727623300009498Pelagic MarineSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEGHVQRAANTDARI*
Ga0115102_1024182213300009606MarineKTFITNMVYKIRNKGFDIWAAAANPRVHPSKKTKTGLDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEGHVQRAANTDARI*
Ga0115100_1123035213300009608MarineVFKIRNKGFDIFAAATNPRVHPAKKTKTALDLTRLVTLQVQQTRFTGMRIKHGYRNISRSCKQFLMGDKLLEQCMILSIKHHFFRPMHYKSPIENSFYIGRALADLTDRHYSLFANNQHPMQLDIYE*
Ga0129319_102296213300010307AqueousVRNKGFNNWSAAQTVRAYPARKTKTQVNMTGHVTIQVHITRFTGMRIMHNYRNISRATKQFMMGDRFLEQLMILQLREHFFRPMYYNAPIENTFFMGRSLADLSDRHYGLFANNQHPIQLSAYEEYNRFLRDLHDKTEAES*
Ga0129344_138205023300012520AqueousYKIRNKGFDIWAAATNPRVHPAKKTKTGLDLTRLVTFQVQQTRFTGMRIKHGYRNISRSCKQFLMGDKLLEQAVILSIKEHFFRPMYYASPIENSFYIGRALADLTDRHYSLFANNQHPLQLDIYTQYNHMLRIMNSEAHQARNAETKERFDELMAAKTDSLNKEEGETPSWDDY*
Ga0129352_1018342613300012528AqueousRNKGFDIWAAATNPRVHPAKKTKTGLDLTRLVTFQVQQTRFTGMRIKHGYRNISRSCKQFLMGDKLLEQAVILSIKEHFFRPMYYASPIENSFYIGRALADLTDRHYSLFANNQHPLQLDIYTQYNHMLRIMNSEAHQARNAETKERFDELMAAKTDSLNKEEGETPSWDDY*
Ga0138277_110305913300012751Freshwater LakeFKIRNKGFNNTAAALNPRVHPAKKTKIQADLTRYITVQVQITRFTGMRILHNYRNISRSTKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPLQLYVYEEYNKFLRAAHNKDEQENLKYINDRMGQVMEDRSKIINAKEG
Ga0138276_101862713300012768Freshwater LakeYKVRNKGFNNWSAAQTVRAYPAKKTKTQVNMTGHITIQVHITRFTGMRILHNYRNISRATKQFMMGDRFLEQLMILQLREHFFRPMYYNAPIENTFFMGRNLADLSDRHYGLFANNQHPIQLSAYEEYNRFLRDLHDKTEAESQEDLAKRFD*
Ga0138269_103965013300012778Freshwater LakeKIRNKGFNNWSAAQTVRAYTNKKTKTQVNMTGHITIQVHITRFTGMRIMHNYRNISRATKQFMMGDRFLEQLMILQLREHFFRPMYYNAPIENTFFMGRSLADLADRHYGLFANNQHPIQLSAYEEYNRFLRDLHDKTEAES*
Ga0164295_1153196523300013014FreshwaterMVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITVQVQITRYTGMRILHNYRNISRSCKQFMMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPLQLSVYEEYNKFLRAAHSK
Ga0163212_112898213300013087FreshwaterMVYKIRNKGFNNTAAALNPRVHPAKKTKINADLTRYITMQVQITRFTGMRILHNYRNISRASKQFMMGDRILEQLMILTIKEHYFRPLYYKSPIENSFYLGRSLADLTDRHYALFANNQHPLQLSVYEEYNKFLRAAHCKEEQAGL
Ga0163212_117993423300013087FreshwaterNTAAALNPRVHPAKKTKIHADLTRYITVQVQITRYTGMRILHNYRNISRACKQFMMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPL*
(restricted) Ga0172373_1011804913300013131FreshwaterMVYKIRNKGFNNTAAALNPRVHPGKKTKIHADMTRYITMQVQITRYTGMRLLHNYRNISRATKQFLMGDKILEQLMVLTIKEHYFRPMYYRSPIENSFYLGRTLADLADRHYSLFANNQHPLQLSVYEEYNRFLRDAHSKENQA*
Ga0170791_1425053613300013295FreshwaterMVYKIRNKGFNNWSAAQTVRAYTNKKTKTQVNMTGHITIQVHITRFTGMRIMHNYRNISRATKQFMMGDRFLEQLMILQLREHFFRPMYYNAPIENTFFMGRSLADLADRHYGLFANNQHPIQLSAYEEYNRFLRDLHDKTEAES*
Ga0157622_101476413300013310FreshwaterKEQKMVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITVQVQITRYTGMRILHNYRNISRACKQFMMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPLQLSVYEEYNKFLRAAHSKENQAALQSIGDRMGEVMEDRSRLLNT
Ga0182030_1135899313300014838BogPKTPKPLLTLLYFINYNKYHYQKMVYKIRNKGFNNTAAALNPRIHPAKKTKIHADLTRYITMQVQITRYTGMRILHNYRNISRASKQFLMGDRILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYALFANNQHPLQLYVYEEYNRFLRQAHNKQEQEGL*
Ga0182082_124556113300016771Salt MarshMVYKIRNKGFNNFAGPNGIRVFPAKKTNVNVAMERHLTLQVQISRYTGMRILHNYRNISRATKQFMMGDRFLEQLMILQIKEHYFAPMYYKAPIENTFFLGRNLADLSDRHTALFQNNQHPIQLQVYEAYNNFLRDLHSKQHAEAAEDLAARFEEVCNERSAHLNEAEGESL
Ga0186523_11010713300017166Host-AssociatedMVYKIRNKGFGAVFSGTGNVRAYPARKTMVNPDLSTHVTLQVQITRFTGMRVLHNYRNISRATKQFMMGDRFFEQLMILTIREHYFRPMYYKAPIENTFFLGRTLADLTDRHYALFANNQHPLQLAAYNEYNTFLQDLHDQASAARDEEDGQRFTQAIGEA
Ga0186197_11636413300017238Host-AssociatedPRVYPAKKTKTHADLTKFVTVQVHITRYTCMRYYHNYRNISRACKQFLMGDKILEQLMILTIKEHFFRPYYYKSPIENCFYLGRAIADMTDRHYALFANNQHPMQLQVYEEYNRFLRMAHDKATQERYQQLSDRMQQL
Ga0186684_11622613300017280Host-AssociatedFLNRNMVYKIRNKGFDIFAAATNTRVHPAKKTKISMDLTRCITLQVQQTRFTGMRIKHGYRNISRASKQFLMGDKLLEQVCILTLKHHFFRPLYYKSPIENSFYLGRALADLTDRHYALFANNQHPLQLDLYDQYNKFLR
Ga0181559_1037773233300018415Salt MarshMVYKIRNKGFDIFAAASNPRVHPSKKTKIQVDLTRRITLQVQQTRFTGMRIKHGYRNISRATKQFLMGDRLLEQVVILTTKYHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYDAYNQFLRRQHSEAH
Ga0188826_11832013300018565Freshwater LakeVRNKGFNNWSAAQTVRAYPARKTKTQVNMTGHITIQVHITRFTGMRILHNYRNISRATKQFMMGDRFLEQLMILQLREHFFRPMYYNAPIENTFFMGRSLADLSDRHYGLFANNQHPIQLSAYEEYNRFLRDLHDKTEAER
Ga0188834_101732113300018599Freshwater LakeMVYKIRNKSFNIFNMSQTVRAYPAKKTQVAFDIEAHVTLQVHITRFTGMRLLHNYRNISRACKQFMMGDRFLEQLMILQIREHFFRPMMYDAPIENTFFMGRSLADLSDRHYSLFANNQHPIQLHTYNEYNTFLKEIHDQKEAETQEDLKARFDEVA
Ga0193539_103848723300018706MarineYKIRNKGFNAAFQGTTNTRAYPARKTAINIDLSTHVTLQVQITRFTGMRILHNYRNISRATKQFMMGDRFFEQLMILTLREHYFRPMYYKAPIENTFFLGRSLADLTDRHYALFANNQHPLQLAAYNEYNRFLQDLHDPASAARDEEEGQRFTEAITEAQG
Ga0192974_104902523300018739MarineNTRAYPAKKTQINVDLSTHVTLQVQITRFTGMRILHNYRSISRATKQFMMGDRFFEQLMILTLREHFFRPMMYKAPIENTFFMGRTLADLTDRHYALFANNQHPLQLSAYSEYNKFLAEMHGD
Ga0193534_103234423300018741MarineKIRNKGFNAAFQGTTNTRAYPARKTAINIDLSTHVTLQVQITRFTGMRILHNYRNISRATKQFMMGDRFFEQLMILTLREHYFRPMYYKAPIENTFFLGRSLADLTDRHYALFANNQHPLQLAAYNEYNRFLQDLHDPASAARDEEEGQRFTEAITEAQG
Ga0193181_102172413300018766MarineFKIRNKGFDIFAAATNPRVHPAKKTKIGLDLTRLVTLQVQQTRFTGMRIKHGYRNISRASKQFLMGDKLLEQCVILSIKHHFFRPLYYKSPIENSFYIGRALADLTDRHYSLFANNQHPMQLDIYENYNKMLRIVHSEEH
Ga0193531_1017639613300018961MarineVYKIRNKGFNAAFQGTTNTRAYPARKTAINIDLSTHVTLQVQITRFTGMRILHNYRNISRATKQFMMGDRFFEQLMILTLREHYFRPMYYKAPIENTFFLGRSLADLTDRHYALFANNQHPLQLAAYNEYNRFLQDLHDPASAARDEEEGQRFTEAITEAQG
Ga0192873_1025967713300018974MarineANPRVHPAKKTKIGLDLTRLVTLQVQQTRFTGMRIKHGYRNISRASKQFLMGDRLLEQCVILSIKEHFFRPMYYQSPIENSFYLGRALADLTDRHYSLFANNQHPMQLDIYENYNKMLRVLHSEEHQARAQETNARFDELVAAKNSTLNNTEGETINWDDY
Ga0193540_1008434323300018979MarineHGELLLTQMVYKIRNKGFNAAFQGTTNTRAYPARKTAINIDLSTHVTLQVQITRFTGMRILHNYRNISRATKQFMMGDRFFEQLMILTLREHYFRPMYYKAPIENTFFLGRSLADLTDRHYALFANNQHPLQLAAYNEYNRFLQDLHDPASAARDEEEGQRFTEAITEAQG
Ga0193030_1008932823300018989MarineMVYKIRNKGFDIFAAATNPRVHTAKKTKIGLDLTRLVTLQVQQTRFTGMRIKHGYRNISRASKQFLMGDKLLEQCCILSIKHHFFRPLHYKSPIENSFYIGRALADLTDRHYSLFANNQHPMQLDIYENYNKMLRVVHSEEHQSRIKATQDRFDELVKEKT
Ga0193030_1011120013300018989MarineHGELLTQMVYKIRNKGFNAAFQGTTNTRAYPARKTAINIDLSTHVTLQVQITRFTGMRILHNYRNISRATKQFMMGDRFFEQLMILTLREHYFRPMYYKAPIENTFFLGRSLADLTDRHYALFANNQHPLQLAAYNEYNRFLQDLHDPASAARDEEEGQRFTEAITEAQG
Ga0193030_1014383613300018989MarineTWGIIYLYKIVMVYKIRNKGFNNFASVRSYPAKKTQVNVDLSTHVVLQTHITRFTGMRILHNYRNISRATKQFMMGDSFLEKIMILTIREHFFRPMYYEAPIEQTFFMGRCLADLTDRHYALFANNQHPLQITAYNEYNRFL
Ga0192916_1010569323300018996MarineMVYKIRNKGFAAPWSMTNNTRVYPAKKTMVNCDLSSHVTLQVQITRFTGMRILHNYRNISRATKQFMLGDKFFEQLMILTIREHFFRPMMYKAPIENTFFIGRTLADLTDRHYALFANNQHPLQLAAYQEYNRFLQNLHDIPRAERATADAEHFESVV
Ga0193514_1022502913300018999MarineKKTQINVDLRTHVILQTHITRYSGMRILHNYRNISRACKQFMMGDSFLEKIMILTIREHFFRPMYYKAPIEQTFFLGRTLADLSDRHYALFANNQHPLQLAIYNEYNRFLQDLHDKASN
Ga0193538_1015255923300019020MarineQMVYKIRNKGFNAAFQGTTNTRAYPARKTAINIDLSTHVTLQVQITRFTGMRILHNYRNISRATKQFMMGDRFFEQLMILTLREHYFRPMYYKAPIENTFFLGRSLADLTDRHYALFANNQHPLQLAAYNEYNRFLQDLHDPASAARDEEEGQRFTEAITEAQG
Ga0192945_1008913913300019036MarineMVHKIRNKGFDIFAAAANPRVHPAKKTKIGLDLTRLVTLQVQQTRFTGMRIKHGYRNISRASKQFLMGDKLLEQCVILSIKEHFFRPMYYQSPIENSFYLGRALADLTDRHYSLFANNQHPMQLDIYENYNKMLRILHSEEHQARAQETNARFDELVAAKNSTLNNDEGESINWDDY
Ga0192945_1013395913300019036MarineMVYKIRNKGFDIWAAAANPRVHPSKKTKTGLDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEGHVQRAANTDARI
Ga0192981_1025235023300019048MarineMVYKIRNKGFDIFAAASNTRVHTARKTKIALDLKKCVTIQVQQTRYTGMRIKHGYRNISRATKQFLMGDKLLEQCVILTLKQQFFRPMYYQSPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYDTYNRFLRISNSDAH
Ga0192826_1034838513300019051MarineMVYRIRNKGFDIFAAAMNPRVHPARKVKINLDLSKHVTVQVQQTRFTGMRIKHGYRNISRATKQFLMGDRMLEQVVILTLKHHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYENYNRFLRVAHSEGHQQRQDETAARIQELKEQRTQL
Ga0188830_101246613300019085Freshwater LakeYKVRNKGFNNWSAAQTVRAYPARKTKTQVNMTGHITIQVHITRFTGMRILHNYRNISRATKQFMMGDRFLEQLMILQLREHFFRPMYYNAPIENTFFMGRSLADLSDRHYGLFANNQHPIQLSAYEEYNRFLRDLHDKTEAER
Ga0193112_107193513300019136MarineMVFKIRNKGFNNFSTSAESFRVFPSKKTKTNVDLAYHVILQTHITRYSGMRILHNYRNISRASKQFMMGDKFFERIMILTIKEHFFRPMYYRSPIEQTFFLGRTMADLTDRHYALFANNQHPL
Ga0192975_1016775823300019153MarineHRQNMVYKIRNKGFASVWGAGANTRAYPAKKTQINVDLSTHVTLQVQITRFTGMRILHNYRSISRATKQFMMGDRFFEQLMILTLREHFFRPMMYKAPIENTFFMGRTLADLTDRHYALFANNQHPLQLSAYSEYNKFLAEMHGD
Ga0182067_102516723300019276Salt MarshFLKMVYKIRNKGFDIFAAATNPRVHHSKKVKLNLDLTKCVTLQVQQTRFTGMRIKHGYRNISRSCKQFLMGDKLLEQAVILTLKMHFFRPMHYQAPIENTFYLGRALADLTDRHYALFANNQHPLQLDIYDTYNTALRRAHSEAEQSRKEE
Ga0194122_1046773613300021092Freshwater LakeMVYKIRNKGFNNTAAALNPRVHPAKKTKINADLTRYITMQVQITRFTGMRILHNYRNISRASKQFLMGDRILEQLMILTIKEHYFRPLYYRSPIENSFYLGRSLADLTDRHYALFANNQHPLQLSVYEEYNK
Ga0206687_162852323300021169SeawaterMVYKLRNKGFDIFAAATNPRVHPSKKTKTALDLTKCVTLQVQQTRFTGMRLKHGYRNISRATKQFLMGDKLLEQAIILTLKFHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDVYQNYNLMLRTLHSESF
Ga0206689_1089278023300021359SeawaterPRVHPAKKTKTALPVELCVSLQVQQTRFTGMRIKHSYRNISRATKQFLMGDKLLEQMCILTLKHHYFRPMYYQSPIENSFYLGRALADLNDRHYALFANNQHPMQLDIYATYNKMLRRLHDKGHNDRVDEFKERMDEVSKER
Ga0210297_105962713300021845EstuarineTSQRVFPAKKTKLQADLGIQVTLQTHITRYTSLRILHNYRNISRACKQFMMGDRFLEQLMIVSLKEHYFLPLYYRAPIEQTFFLGRNLADLTDRHYALFANNQHPIQLAAYEEYNKFLRDLHD
Ga0063085_111695613300021924MarineFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0063103_110127013300021927MarineRIRNKGFDIFSAATTTRVHPAKKTKIGLDLTRLVTLQVQQTRFTGMRIKHGYRNISRSTKQFLMGDRLLEQCCILQLKWHFFRPMHYQTPIENSFYIGRALADLTDRHYSLFANNQHPFQLEMYESYNKFLRVSHSEAHQGRKADT
Ga0222713_1044134133300021962Estuarine WaterPKPQNPVIIKIHLIIIFNMVYKIRNKGFDIFAAASNPRVHPSKKTKIHVDVTRRITLQVQQTRFTGMRIKHGYRNISRATKQFLMGDRLLEQIVILTTKYHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYDAYNQFLRRQHSEAH
Ga0208503_103135113300025388FreshwaterMVYKIRNKGFNNTVAALNPRVHPAKKTKIHADLTRYITMQVQITRFTGMRILHNYHNISRASKQFLMGDRILEQLMILTIKEHYFRPMYYKSPIENSFYLGRSLADLTDRHYALFANNQHPLQLSVYEEYNKFLRAAHSKEEQAGLQAIDQRMQEVMDDRTRLLNSKEGE
Ga0209603_132642313300025849Pelagic MarineMVYKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDI
Ga0247571_111986413300026495SeawaterANPRVHPSKKTKTGLDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEGHVQRAANTDARI
Ga0209092_1027684813300027833MarineMVYKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0209712_1059785713300027849MarineMVYKIRNKGFDIFAAASNPRVHTARKTKIALDLKKCVTIQVQQTRYTGMRIKHGYRNISRATKQFLMGDKLLEQCVILTLKQQFFRPMYYQSPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYDTYNRFLRISNSDAHQQRFAETEARFDEVRQERNAYLNHEEGEKLS
Ga0209400_128462713300027963Freshwater LakeMVFKIRNKGFNNTAAALNPRVHPAKKTKIQADLTRYITVQVQITRFTGMRILHNYRNISRSTKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPLQLYVYEEYNKFLRAAHNKDEQENLKYINDR
Ga0256412_119364213300028137SeawaterITNMVYKIRNKGFDIWAAAANPRVHPSKKTKTGLDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEGHVQRAANTDARI
Ga0256412_124255423300028137SeawaterIRNKGFDIFAAATNTRVHPMKKTKTALKMSECVSLQVQQTRFTGMRIKHSYRNISRATKQFLMGDKLLEQVVILTLKQHYFRPMYYQSPIENSFYLGRALADLNDRHQALFLNNQHPMQLDIYDNYN
Ga0247572_109909713300028290SeawaterVYKIRNKGFDIWAAAANPRVHPSKKTKTGLDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEGHVQRAANTDARI
Ga0210249_118755413300030542SoilNNTAAALNPRVHPAKKTRINADLTRYVTIQTHITRFTGMRILHNYRNISRASKQFLMGDKILEQVMILTIKEHFFRPMYYKSPIENCFYLGRALADLTDRHYGLFANNMHPIQLSVYEGYNRFLRDVHNKKEQENDLFFKERLTQLIDDKSK
Ga0210287_113633513300030598SoilALNPRVHPAKKTKIHADLTRYITMQVHVTRYTGQRILHNYRLISRSSKQFLMGDKILEQLMILTIKEMYFRPMNYRSPIENAFYLGRTLADLTDRHYALFANNQHPL
Ga0210259_1043320313300030625SoilKIRNKASNNTAAALNPRVHPAKKTRINADLTRYVTIQTHITRFTGMRILHNYRNISRASKQFLMGDKILEQVMILTIKEHFFRPMYYKSPIENCFYLGRALADLTDRHYGLFANNMHPIQLSVYEGYNRFLRDVHNKKEQENDLFFKERLTQLIDDKSK
Ga0307403_1042252313300030671MarineQNMVYKIRNKGFASVWGAGANTRAYPAKKTQINVDLSTHVTLQVQITRFTGMRILHNYRSISRATKQFMMGDRFFEQLMILTLREHFFRPMMYKAPIENTFFMGRTLADLTDRHYALFANNQHPLQLSAYSEYNKFLAEMHGD
Ga0307403_1080805713300030671MarineFLMVYRIRNKGFDIFSAATTTRVHPAKKTKIGLDLTRLVTLQVQQTRFTGMRIKHGYRNISRSTKQFLMGDRLLEQACILQLKWHFFRPMHYQTPIENSFYIGRALADLTDRHYSLFANNQHPFQLEMYESYNKFLRVSHSEGHQTRLSDTRARMEEVIEERTKTLNHE
Ga0307400_1068967023300030709MarineDIWAAAANPRVHPSKKTKIALDLTKCVTLQVQQTRFTGMRIKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMYYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYDSYNKMLRVMNDESHQQRGANTQARIEEIVEERTKYLNN
Ga0308128_102466523300030725MarineKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADENHVARAANTDARI
Ga0265462_1105035813300030738SoilAALNPRVHPCKKTKVHLDLTKYVTCQVHISRFTGLRILHNYRNISRASKQFLMGDRILEQLMILTLKEHWFRPMTYRSPIENNFYLGRSLANLTDRHYGLFANNQHPIQLSCYKEYNAFLRMVHDKGENEWREQVGDRMVEIQDERKKLLN
Ga0265462_1118887113300030738SoilAAALNPRVHPAKKTKIHADLTRYITMQVHVTRYTGQRILHNYRLISRSSKQFLMGDKILEQLMILTIKEMYFRPMNYRSPIENAFYLGRTLADLTDRHYALFANNQHPL
Ga0265460_1114154413300030740SoilTIRNKGFNNTAAALNPRVHPCKKTKVHLDLTKYVTCQVHISRFTGLRILHNYRNISRASKQFLMGDRILEQLMILTLKEHWFRPMTYRSPIENNFYLGRSLANLTDRHYGLFANNQHPIQLSCYKEYNAFLRMVHDKGENEWREQVGDRMVEIQDERKKLLN
Ga0265459_1144950413300030741SoilMVYTIRNKGFNNTAAALNPRVHPCKKTKVHLDLTKYVTCQVHISRFTGLRILHNYRNISRASKQFLMGDRILEQLMILTLKEHWFRPMTYRSPIENNFYLGRSLANLTDRHYGLFANNQHPIQLSCYKEYNAFLRMVHDKGENEWREQVGDRMVEIQDERKKLLN
Ga0265459_1210883013300030741SoilNTAAALNPRVHPAKKTRINADLTRYVTIQTHITRFTGMRILHNYRNISRASKQFLMGDKILEQVMILTIKEHFFRPMYYKSPIENCFYLGRALADLTDRHYGLFANNMHPIQLSVYEGYNRFLRDVHNKKEQENDLFFKERLTQLIDDKSK
Ga0265461_1258503413300030743SoilPRVHPAKKTKINADLTRYVTMQVHITRFSGMRMLHNYRNISRATKQFLMGDKILEQLMVLTLKEHYFRPLYYRSPIENNFYIGRTLADLSDRHYALFANNQHPLQLHLYEEYNKFLRSVHSKEENEAEQQFADRFD
Ga0138296_121375323300030923SoilPRIHPAKKVKINNDLTRYVTIQVHITRFSGLRIMHNYRNISRACKQFLMGDKILEQIMILTIKEHFFRPLYYKSPIENCFYLGRTFADLTDRHFALFANN
Ga0074018_170510313300031053SoilLITGLGVSYLQIRHNVYKIRNKAFNNTAASINPRVHPAKKTKVHADLSRYITMQVHITRFTGLRIQHNYRNISRACKQFLMGDKILEQLMVLTIKEHYFRPMRYRAPIENSFYLGRTLADLTDRHYALFANN
Ga0170834_10371739913300031057Forest SoilPRIHPAKKVKINNDLTRYVTIQVHITRFSGLRMMHNYRNISRACKQFLMGDKILEQIMILTIKEHFFRPLYYKSPIENCFYLGRTFADLTDRHFALFANN
Ga0170824_11687474813300031231Forest SoilKIRNKGFNNTVAALNPRVHPAKKTKIHADLSRYITMQVHITRFTGMRILHNYRLMSRASKQFLMGDKILEQLMILTIREMYFRPMRYRSPIENAFYLGRTLADLTDRHYALFANNQHPL
Ga0302320_1112457813300031524BogMVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITMQVQITRYTGMRILHNYRNISRSSKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYALFANNQHPLQLYVYEEYNKFLRAAHCK
Ga0302320_1138074223300031524BogMVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITMQVQITRYTGMRILHNYRNISRSSKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYALFANNQHPLQLYVYEEYNKFLRA
Ga0307396_1036585523300031717MarineMVYKIRNKTFNVFTPATTVRVFPAKKTVTNFDHECHVTLQTHITRFSGMRVMHNYRNISRACKQFQMGDRFLEQLMTIQLRAHFFRPMTYNAPIEQTFFMGRSLADLSDRHYSLFANNQHPIQLQTYHQYNDLLAYLHDPKCAQEQ
Ga0307391_1041837413300031729MarineRQNMVYKIRNKGFASVWGAGANTRAYPAKKTQINVDLSTHVTLQVQITRFTGMRILHNYRSISRATKQFMMGDRFFEQLMILTLREHFFRPMMYKAPIENTFFMGRTLADLTDRHYALFANNQHPLQLSAYSEYNKFLAEMHGD
Ga0307383_1064354513300031739MarineYKMVYKIRNKGFDIFAAASNPRVHTARKTKIALDLKKCVTIQVQQTRYTGMRIKHGYRNISRATKQFLMGDKLLEQCVILTLKQQFFRPMYYQSPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYDTYNRFLRISNSDAH
Ga0315907_1124552813300031758FreshwaterMVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITVQVQITRYTGMRILHNYRNISRACKQFMMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPLQLSVYEEYNKFLRAAHSKENQAALQSI
Ga0315906_1136298213300032050FreshwaterMVYKIRNKGFNNTAAALNPRVHPAKKTKIHADLTRYITVQVQITRYTGMRILHNYRNISRACKQFMMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPLQLSVYEEYNKFL
Ga0315902_1129963313300032093FreshwaterMVYKIRNKGFNNTVAALNPRVHPAKKTKIHADLTRYITVQVQITRYTGMRILHNYRNISRACKQFMMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRSLADLTDRHYSLFANNQHPLQLSVYEEYNKFLRAAHSKDNQ
Ga0335396_1086471813300032462FreshwaterMVYKIRNKGFNNTAAALNPRVHPGKKTKIHADLTRYITMQVQITRYTGMRLLHNYRNISRASKQFLMGDKILEQLMILTIKEHYFRPMYYRSPIENSFYLGRTLADLTDRHYSLFANNQHPLQLSVYEEYNRFLRDAHDKQNHASYEAFNERMDTVMTDRSKLLNQQ
Ga0314684_1043144613300032463SeawaterIIKMVYKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0314670_1036768213300032470SeawaterKIIKMVYKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0314680_1040251933300032521SeawaterVFKIRNKGFDIFAAATNPRVHPAKKTKTALDLTRLVTLQVQQTRFTGMRIKHGYRNISRSCKQFLMGDKLLEQCMILSIKHHFFRPMHYKSPIENSFYIGRALADLTDRHYSLFANNQHPMQLDIYE
Ga0314680_1053363713300032521SeawaterIKMVYKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0314677_1030800613300032522SeawaterKLNSTVVTTHVGLVIRVARSFRNMPITNHQPIDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0314673_1029185613300032650SeawaterRNKGFDIFAAATNPRVHPAKKTKTALDLTRLVTLQVQQTRFTGMRIKHGYRNISRSCKQFLMGDKLLEQCMILSIKHHFFRPMHYKSPIENSFYIGRALADLTDRHYSLFANNQHPMQLDIYE
Ga0314673_1033642313300032650SeawaterEMVYKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0314685_1039309913300032651SeawaterTKIIKMVYKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0314681_1044665413300032711SeawaterKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0315741_1111561813300032739Forest SoilASINPRVHPAKKTKVHADLSRYITMQVHITRFTGLRIQHNYRNISRACKQFLMGDKILEQLMVLTIKEHYFRPMRYRAPIENSFYLGRTLADLTDRHYALFANN
Ga0314691_1018947313300032749SeawaterSRTTSSAPSATSRPRASRCRSASAATPKIIKMVYKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0314708_1029536013300032750SeawaterGINYLLTKIIKMVYKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0314709_1053128513300032755SeawaterVYKIRNKGFDIWAAAANPRVHPSKKTKTALDLTKHITAQFQQTRFTGMRLKHGYRNISRSCKQFLMGDKLLEQVVILTLKDHFFRPMHYASPIENSFYLGRALADLTDRHYALFANNQHPMQLDIYESYNKMLRVNADEAHVQRAAGTDARI
Ga0315742_1243945213300032756Forest SoilALNPRVHPAKKTKIHADLTRYITMQVHITRYTGQRILHNYRLMSRASKQFLMGDKILEQLMTLTIKEMYFRPMHYRSPIENAFYLGRTLADLTDRHYALFANNQHPLQLSCYEEYNRFLRTVHDPEAREAEKVLSERIDDKESLKRDKANK
Ga0315742_1252849413300032756Forest SoilFNNTAASINPRVHPAKKTKIHADLTRYITMQVHITRFTGLRIMHNYRNISRASKQFLMGDKILEQLMVLTIKENYFRPMHYRAPIENSFYIGRALADLTDRNYALFANN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.