NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071396

Metagenome / Metatranscriptome Family F071396

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071396
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 44 residues
Representative Sequence MNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Number of Associated Samples 101
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 42.62 %
% of genes near scaffold ends (potentially truncated) 43.44 %
% of genes from short scaffolds (< 2000 bps) 83.61 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (51.639 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil
(13.934 % of family members)
Environment Ontology (ENVO) Unclassified
(32.787 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.361 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.82%    β-sheet: 0.00%    Coil/Unstructured: 43.18%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF12697Abhydrolase_6 20.49
PF003892-Hacid_dh 14.75
PF028262-Hacid_dh_C 8.20
PF132794HBT_2 3.28
PF12146Hydrolase_4 3.28
PF00561Abhydrolase_1 3.28
PF00486Trans_reg_C 2.46
PF13414TPR_11 1.64
PF08386Abhydrolase_4 1.64
PF09084NMT1 0.82
PF00497SBP_bac_3 0.82
PF16868NMT1_3 0.82
PF13561adh_short_C2 0.82
PF13489Methyltransf_23 0.82
PF13181TPR_8 0.82
PF11937DUF3455 0.82

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 122 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.82
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.82

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A51.64 %
All OrganismsrootAll Organisms48.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000156|NODE_c0687740All Organisms → cellular organisms → Bacteria3313Open in IMG/M
3300000890|JGI11643J12802_11015647Not Available987Open in IMG/M
3300000891|JGI10214J12806_13028958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium859Open in IMG/M
3300001692|JGI24247J19897_10093Not Available602Open in IMG/M
3300003349|JGI26129J50193_1004917All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium952Open in IMG/M
3300003911|JGI25405J52794_10106135All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07628Open in IMG/M
3300004020|Ga0055440_10010130Not Available1681Open in IMG/M
3300004058|Ga0055498_10005789Not Available1443Open in IMG/M
3300004058|Ga0055498_10113690Not Available561Open in IMG/M
3300004070|Ga0055488_10054723Not Available877Open in IMG/M
3300004114|Ga0062593_100062889Not Available2401Open in IMG/M
3300004156|Ga0062589_101685500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07632Open in IMG/M
3300004157|Ga0062590_100159300All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 071562Open in IMG/M
3300004463|Ga0063356_103769450Not Available653Open in IMG/M
3300004480|Ga0062592_100399159All Organisms → cellular organisms → Bacteria1093Open in IMG/M
3300004643|Ga0062591_100626295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae957Open in IMG/M
3300004643|Ga0062591_101149564All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300004643|Ga0062591_101847297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae618Open in IMG/M
3300004643|Ga0062591_102358104Not Available557Open in IMG/M
3300004643|Ga0062591_102533038All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300005093|Ga0062594_100244407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 071305Open in IMG/M
3300005093|Ga0062594_102194979All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300005146|Ga0066817_1022796Not Available586Open in IMG/M
3300005164|Ga0066815_10006341Not Available1329Open in IMG/M
3300005168|Ga0066809_10105131Not Available695Open in IMG/M
3300005169|Ga0066810_10021115All Organisms → cellular organisms → Bacteria → Proteobacteria1084Open in IMG/M
3300005183|Ga0068993_10091054Not Available962Open in IMG/M
3300005213|Ga0068998_10001915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2225Open in IMG/M
3300005332|Ga0066388_100776509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 071554Open in IMG/M
3300005332|Ga0066388_103938641All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300005332|Ga0066388_105710967All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300005335|Ga0070666_10083856All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium2180Open in IMG/M
3300005335|Ga0070666_10677905Not Available755Open in IMG/M
3300005353|Ga0070669_101769575Not Available539Open in IMG/M
3300005434|Ga0070709_10429331Not Available992Open in IMG/M
3300005435|Ga0070714_101671285All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300005444|Ga0070694_101780659All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005530|Ga0070679_101623334Not Available594Open in IMG/M
3300005536|Ga0070697_100460293Not Available1109Open in IMG/M
3300005564|Ga0070664_100119949All Organisms → cellular organisms → Bacteria2302Open in IMG/M
3300005713|Ga0066905_100922459Not Available766Open in IMG/M
3300006048|Ga0075363_100746081Not Available593Open in IMG/M
3300006195|Ga0075366_10182949All Organisms → cellular organisms → Bacteria → Proteobacteria1273Open in IMG/M
3300006574|Ga0074056_11819820All Organisms → cellular organisms → Bacteria1266Open in IMG/M
3300006852|Ga0075433_11401205Not Available605Open in IMG/M
3300006871|Ga0075434_100206930All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300006954|Ga0079219_10271570All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 071026Open in IMG/M
3300006954|Ga0079219_10333639Not Available962Open in IMG/M
3300009094|Ga0111539_10109076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3248Open in IMG/M
3300009098|Ga0105245_11749969Not Available674Open in IMG/M
3300010043|Ga0126380_10477494Not Available950Open in IMG/M
3300010358|Ga0126370_10425885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 071099Open in IMG/M
3300010359|Ga0126376_12187311Not Available598Open in IMG/M
3300010359|Ga0126376_12275279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07588Open in IMG/M
3300010362|Ga0126377_10002409All Organisms → cellular organisms → Bacteria12869Open in IMG/M
3300010362|Ga0126377_10374325Not Available1428Open in IMG/M
3300010371|Ga0134125_10074528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3775Open in IMG/M
3300010399|Ga0134127_10127831Not Available2273Open in IMG/M
3300012489|Ga0157349_1009799Not Available755Open in IMG/M
3300012893|Ga0157284_10239688Not Available566Open in IMG/M
3300012899|Ga0157299_10123963All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300012908|Ga0157286_10168418All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07713Open in IMG/M
3300012913|Ga0157298_10216238Not Available626Open in IMG/M
3300012916|Ga0157310_10451673Not Available547Open in IMG/M
3300012948|Ga0126375_10167210Not Available1407Open in IMG/M
3300012948|Ga0126375_10201504Not Available1307Open in IMG/M
3300012955|Ga0164298_10528933Not Available794Open in IMG/M
3300012957|Ga0164303_11155002Not Available563Open in IMG/M
3300012987|Ga0164307_10165619All Organisms → cellular organisms → Bacteria → Proteobacteria1471Open in IMG/M
3300012988|Ga0164306_10069717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium2199Open in IMG/M
3300014308|Ga0075354_1016038Not Available1150Open in IMG/M
3300015371|Ga0132258_10346040All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3674Open in IMG/M
3300015371|Ga0132258_13752925Not Available1035Open in IMG/M
3300015372|Ga0132256_100766883Not Available1081Open in IMG/M
3300015372|Ga0132256_103074239Not Available561Open in IMG/M
3300015372|Ga0132256_103160371Not Available554Open in IMG/M
3300015373|Ga0132257_100531255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 071446Open in IMG/M
3300015374|Ga0132255_102183889Not Available844Open in IMG/M
3300015374|Ga0132255_105104072Not Available556Open in IMG/M
3300017947|Ga0187785_10071371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1341Open in IMG/M
3300019356|Ga0173481_10002864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4403Open in IMG/M
3300019361|Ga0173482_10006038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2876Open in IMG/M
3300019362|Ga0173479_10405575All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium659Open in IMG/M
3300021445|Ga0182009_10055365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 071693Open in IMG/M
3300022883|Ga0247786_1089520Not Available657Open in IMG/M
3300023072|Ga0247799_1097421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae527Open in IMG/M
3300025271|Ga0207666_1007247Not Available1456Open in IMG/M
3300025728|Ga0207655_1251549Not Available501Open in IMG/M
3300025901|Ga0207688_10042502All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae2530Open in IMG/M
3300025903|Ga0207680_10705183Not Available723Open in IMG/M
3300025910|Ga0207684_11728493Not Available503Open in IMG/M
3300025912|Ga0207707_10794955Not Available788Open in IMG/M
3300025917|Ga0207660_10707400All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300025925|Ga0207650_10201858Not Available1593Open in IMG/M
3300025932|Ga0207690_11796460All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300025933|Ga0207706_11613649Not Available525Open in IMG/M
3300025935|Ga0207709_11389509All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300025945|Ga0207679_10180706All Organisms → cellular organisms → Bacteria → Proteobacteria1745Open in IMG/M
3300025945|Ga0207679_10282349Not Available1424Open in IMG/M
3300025955|Ga0210071_1016446Not Available895Open in IMG/M
3300025957|Ga0210089_1030682Not Available658Open in IMG/M
3300026075|Ga0207708_10887566Not Available771Open in IMG/M
3300026452|Ga0256821_1004594Not Available1271Open in IMG/M
3300026655|Ga0207530_100375Not Available616Open in IMG/M
3300026761|Ga0207495_100174Not Available1405Open in IMG/M
3300026766|Ga0207450_100221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2396Open in IMG/M
3300027360|Ga0209969_1075922Not Available536Open in IMG/M
3300027435|Ga0207553_1005088Not Available656Open in IMG/M
3300027482|Ga0207460_102919Not Available602Open in IMG/M
3300027523|Ga0208890_1012133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 071157Open in IMG/M
3300027523|Ga0208890_1028322All Organisms → cellular organisms → Bacteria → Proteobacteria835Open in IMG/M
3300027617|Ga0210002_1001138All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae3700Open in IMG/M
3300027617|Ga0210002_1001176All Organisms → cellular organisms → Bacteria → Proteobacteria3647Open in IMG/M
3300027775|Ga0209177_10228591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07676Open in IMG/M
3300027775|Ga0209177_10354126Not Available576Open in IMG/M
(restricted) 3300031150|Ga0255311_1022214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium1308Open in IMG/M
(restricted) 3300031197|Ga0255310_10003499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4107Open in IMG/M
3300031720|Ga0307469_10033633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3015Open in IMG/M
3300031740|Ga0307468_100351824Not Available1099Open in IMG/M
3300031943|Ga0310885_10217618Not Available952Open in IMG/M
3300031944|Ga0310884_10010343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae3467Open in IMG/M
3300032205|Ga0307472_101093206All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Nordella → unclassified Nordella → Nordella sp. HKS 07754Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil13.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.84%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands6.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.56%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.56%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.10%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere4.10%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere4.10%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.10%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.28%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.28%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.46%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.46%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.46%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere2.46%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.64%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil1.64%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.64%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.82%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.82%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.82%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.82%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.82%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.82%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.82%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.82%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001692Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A1-11EnvironmentalOpen in IMG/M
3300003349Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PMHost-AssociatedOpen in IMG/M
3300003911Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300004020Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005146Soil and rhizosphere microbial communities from Laval, Canada - mgHABEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005213Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012489Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014308Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300025271Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025728Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025955Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025957Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026452Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4EnvironmentalOpen in IMG/M
3300026655Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G10K1-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026761Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A5-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026766Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO22-D (SPAdes)EnvironmentalOpen in IMG/M
3300027360Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027435Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K3-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027482Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A2w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027617Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
NODE_068774043300000156Sugar Cane Bagasse Incubating BioreactorMNSALAQVVIPHGNFDDGFEKYTVAAITFLLLCFAVWQYFRNRR*
JGI11643J12802_1101564733300000890SoilMNSALAQVVIPHGNFDDGFEQYLVAAITFLLLCFAVWQYFRDRK*
JGI10214J12806_1302895813300000891SoilSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
JGI24247J19897_1009313300001692SoilMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAV
JGI26129J50193_100491723300003349Arabidopsis Thaliana RhizosphereMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
JGI25405J52794_1010613523300003911Tabebuia Heterophylla RhizosphereRGRGAAYGRMYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0055440_1001013013300004020Natural And Restored WetlandsMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRR*
Ga0055498_1000578923300004058Natural And Restored WetlandsMSTALAQVVIPFGDFGDGFEKYLVATITFLFLCFAVWQYFRR*
Ga0055498_1011369013300004058Natural And Restored WetlandsMNSASAQVVIPHGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRQ*
Ga0055488_1005472313300004070Natural And Restored WetlandsMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRS*
Ga0062593_10006288933300004114SoilMGTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR*
Ga0062589_10168550023300004156SoilAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRK*
Ga0062590_10015930033300004157SoilMNSALAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWHYFRDRK*
Ga0063356_10376945013300004463Arabidopsis Thaliana RhizosphereMNSAMAQVVIPYGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0062592_10039915923300004480SoilMNSVVAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRK*
Ga0062591_10062629523300004643SoilMYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRR*
Ga0062591_10114956433300004643SoilMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRK*
Ga0062591_10184729723300004643SoilMNSAMAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0062591_10235810413300004643SoilNSALAQVVIPYGNFDDGFEKYLVATITFLLLCVAVWHYFRGRK*
Ga0062591_10253303823300004643SoilMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0062594_10024440723300005093SoilMQMNSALAQVVIPHGNFDDGFEKYTVAAITFLLLCFAVWQYFRNRR*
Ga0062594_10219497913300005093SoilALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR*
Ga0066817_102279613300005146SoilMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRGRK*
Ga0066815_1000634133300005164SoilMNSALAQVVIPYGSFDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
Ga0066809_1010513123300005168SoilMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRN*
Ga0066810_1002111533300005169SoilMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRR*
Ga0068993_1009105433300005183Natural And Restored WetlandsMYMNTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRR*
Ga0068998_1000191513300005213Natural And Restored WetlandsMSTALAQVVIPIGDFGDGFEKYLVATITFLFLCFAVWQYFRR*
Ga0066388_10077650923300005332Tropical Forest SoilMSTALAQVVIPFGDFGDGFEKYLVATITFVLLCFAVWQYFRDRK*
Ga0066388_10393864123300005332Tropical Forest SoilMHMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0066388_10571096723300005332Tropical Forest SoilMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0070666_1008385613300005335Switchgrass RhizosphereQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVLRFFRNRDG*
Ga0070666_1067790523300005335Switchgrass RhizosphereMYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYLRDRK*
Ga0070669_10176957523300005353Switchgrass RhizospherePAAAQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG*
Ga0070709_1042933133300005434Corn, Switchgrass And Miscanthus RhizosphereAAQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG*
Ga0070714_10167128523300005435Agricultural SoilAQVVIPFGDFGDGFEKYLVAVIAFVLLCVAVWRFFRNRS*
Ga0070694_10178065923300005444Corn, Switchgrass And Miscanthus RhizosphereMQMNSALAQVVIPHGNFDDGFEKYTVAAITFLLLCFAVWQYFRNPR*
Ga0070679_10162333423300005530Corn RhizosphereMNSAMAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYF
Ga0070697_10046029333300005536Corn, Switchgrass And Miscanthus RhizosphereMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRR*
Ga0070664_10011994913300005564Corn RhizosphereYGWTHMGTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR*
Ga0066905_10092245913300005713Tropical Forest SoilLAQVVIPFGDFGGGFEKYLVATITFVLLCFAVWQFFRDRR*
Ga0075363_10074608113300006048Populus EndosphereCLRSTHMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0075366_1018294923300006195Populus EndosphereMNSALAQVVIPFGDFDDRFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0074056_1181982023300006574SoilMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRERK*
Ga0075433_1140120523300006852Populus RhizosphereTPAAAQVVIPFGDFGDGFEKYLVAAIAFVLLCVAVLRFFRNRDG*
Ga0075434_10020693033300006871Populus RhizosphereMYMSTALAQVVIPFGDFGDGFEKYLVATITFVLLCFAVWQYFRDRK*
Ga0079219_1027157023300006954Agricultural SoilMQMNSALAQVVIPHGNFDDGFEKYTVVAITFLLLCFAVWQYFGNRR*
Ga0079219_1033363933300006954Agricultural SoilMSTALAQVVIPFGDFGDGFEKHLIAAITFLLLCFAVGQYFRGRK*
Ga0111539_1010907613300009094Populus RhizosphereMYMSTALAQVVIPYGDFNDGFEKYLVATITFLLLCFAVWQYFRNRK*
Ga0105245_1174996923300009098Miscanthus RhizosphereMNSTLAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
Ga0126380_1047749423300010043Tropical Forest SoilVAQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNR*
Ga0126370_1042588523300010358Tropical Forest SoilMNAALAQVVIPFGDFDDGFEKYLVATITFLLLCVAVWQYYRDRK*
Ga0126376_1218731113300010359Tropical Forest SoilMQMNSALAQVVIPHGNFDDGFEKYTVVAITFLLLCFAVWQYFRNRR*
Ga0126376_1227527923300010359Tropical Forest SoilIPFGDFDDGFEKYLVATITFLLLCVAVWQYFRDRK*
Ga0126377_1000240963300010362Tropical Forest SoilMHMSTALAQVVIPFGDFGGGFEKYLVATITFVLLCFAVWQFFRNRK*
Ga0126377_1037432513300010362Tropical Forest SoilMQMSTALAQVVIPFGGFGDGFEKYLVATITFVLLCFAVWQYFRDRK*
Ga0134125_1007452833300010371Terrestrial SoilMNTALAQVVIPYGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0134127_1012783123300010399Terrestrial SoilMAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0157349_100979913300012489Unplanted SoilQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG*
Ga0157284_1023968813300012893SoilMNSALAQVVIPYGSFDDGFEKYLVAAITFLLLCFAVWQYFRDR
Ga0157299_1012396313300012899SoilELCLRSTHMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0157286_1016841813300012908SoilIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0157298_1021623823300012913SoilMYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR*
Ga0157310_1045167323300012916SoilMNSAMAQVVIPYGDFDDGFEKYLVTTITFLLLCFAVWQYFRDRK*
Ga0126375_1016721023300012948Tropical Forest SoilRGAAFGWTYMSTALAQVVIPFGDFGDGFEKYLVATITFVLLCFAVWQYFRDRK*
Ga0126375_1020150423300012948Tropical Forest SoilMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQFYRDRK*
Ga0164298_1052893333300012955SoilMNSALAQVVIPYGSFDDGFEKYLVAAITFLLLCFAVWQYLRDR
Ga0164303_1115500213300012957SoilPAAAQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVLRFFRNRDG*
Ga0164307_1016561913300012987SoilAGAFIDRAVAQVVIPFGDFGDGFEKYLVAVIAFVLLCIAVWRFFRNRS*
Ga0164306_1006971713300012988SoilIPFGDFGDGFEKYLVAGIAFVLLCVAVLRFFRNRDG*
Ga0075354_101603823300014308Natural And Restored WetlandsMYMSTALAQVVIPFGDFGDGFEKYLVAAITFLLLCFAVWQYFRDRQ*
Ga0132258_1034604053300015371Arabidopsis RhizosphereMYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRK*
Ga0132258_1375292533300015371Arabidopsis RhizospherePFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG*
Ga0132256_10076688313300015372Arabidopsis RhizosphereMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQY
Ga0132256_10307423913300015372Arabidopsis RhizosphereMNSALAQVVIPYGNLDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
Ga0132256_10316037123300015372Arabidopsis RhizosphereMNSALAQVVIPYGNYDDGFEKYLVAAITFLLLCFAVWQYFRDRK*
Ga0132257_10053125523300015373Arabidopsis RhizosphereMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAAWQYFRDRR*
Ga0132255_10218388913300015374Arabidopsis RhizosphereMYMSTALAQVVIPFGDFGDGFKKYLVATITFLLLCFAVW
Ga0132255_10510407213300015374Arabidopsis RhizosphereMNSALAQVVIPYGKFDDGFEKYLVAAITFLLLCFAVWQYLRDRK*
Ga0187785_1007137123300017947Tropical PeatlandMAQVLIPFGDYGDGFEKYLLAGIAFVLLCVAVWRFFRNRDG
Ga0173481_1000286423300019356SoilMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK
Ga0173482_1000603823300019361SoilMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0173479_1040557533300019362SoilMGTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDR
Ga0182009_1005536523300021445SoilMGTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR
Ga0247786_108952013300022883SoilMNSAMAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0247799_109742123300023072SoilMNSAMAQVVIPYGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0207666_100724713300025271Corn, Switchgrass And Miscanthus RhizosphereMNSTLAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK
Ga0207655_125154913300025728Miscanthus RhizosphereMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFA
Ga0207688_1004250223300025901Corn, Switchgrass And Miscanthus RhizosphereMNSALAQVVIPYGSFDDGFEKYLVAAITFLLLCFAVWQYLRDRK
Ga0207680_1070518323300025903Switchgrass RhizosphereMYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYLRDRK
Ga0207684_1172849313300025910Corn, Switchgrass And Miscanthus RhizosphereLRSTHMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0207707_1079495533300025912Corn RhizosphereMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVW
Ga0207660_1070740023300025917Corn RhizosphereRSELSAATGFAYGRTHMNSAMAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0207650_1020185823300025925Switchgrass RhizosphereTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR
Ga0207690_1179646023300025932Corn RhizosphereAGAFIDRAVAQVVIPFGDFGDGFEKYLVAVIAFVLLCVAVWRFFRNRS
Ga0207706_1161364913300025933Corn RhizosphereMYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRR
Ga0207709_1138950923300025935Miscanthus RhizosphereMYMSTALAQVVTPFGDFGDGFEKYLVATITFLLLCFAVWQYFRR
Ga0207679_1018070643300025945Corn RhizosphereMQMNSALAQVVIPHGNFDDGFEKYTVAAITFLLLCFAVWQYFRNRR
Ga0207679_1028234913300025945Corn RhizosphereWTHMGTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRR
Ga0210071_101644613300025955Natural And Restored WetlandsMSTALAQVVIPFGDFGDGFEKYLVATITFLFLCFAVWQYFRR
Ga0210089_103068223300025957Natural And Restored WetlandsMYMSTALAQVVIPFGDFGDGFEKYLVATITFLFLCFAVWQYFRR
Ga0207708_1088756623300026075Corn, Switchgrass And Miscanthus RhizospherePFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG
Ga0256821_100459433300026452SedimentMRAAYGRMYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLY
Ga0207530_10037513300026655SoilTHMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0207495_10017413300026761SoilMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQY
Ga0207450_10022113300026766SoilMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYL
Ga0209969_107592223300027360Arabidopsis Thaliana RhizosphereMNSALAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRR
Ga0207553_100508813300027435SoilTHMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK
Ga0207460_10291933300027482SoilMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQY
Ga0208890_101213323300027523SoilVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRK
Ga0208890_102832223300027523SoilMNSALAQVVIPYGNFDDGSEKYLVAAITFLLLCFAVWQYFRR
Ga0210002_100113833300027617Arabidopsis Thaliana RhizosphereMNSALAQVVIPYGNFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0210002_100117673300027617Arabidopsis Thaliana RhizosphereMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQ
Ga0209177_1022859113300027775Agricultural SoilRMQMNSALAQVVIPHGNFDDGFEKYTVVAITFLLLCFAVWQYFGNRR
Ga0209177_1035412613300027775Agricultural SoilAAAQVVIPFGDFGDGFEKYLVAGIAFVLLCVAVWRFFRNRDG
(restricted) Ga0255311_102221423300031150Sandy SoilMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYFRDRK
(restricted) Ga0255310_1000349923300031197Sandy SoilMNSALAQVVIPYGNFDDGFEKYLVAAVTFLLLCFAVWQYFRDRK
Ga0307469_1003363333300031720Hardwood Forest SoilMSTALAQVVIPFGDFGDGLEKYLVATITFLLLCFAVWQYFRDRK
Ga0307468_10035182433300031740Hardwood Forest SoilMYMSTALAQVVIPFGDFGDGLEKYLVATITFLLLCFAVWQYFRDRK
Ga0310885_1021761813300031943SoilMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFR
Ga0310884_1001034343300031944SoilAVGGDELCLRSTHMNSALAQVVIPFGDFDDGFEKYLVATITFLLLCFAVWQYFRDRK
Ga0307472_10109320613300032205Hardwood Forest SoilMYMSTALAQVVIPFGDFGDGFEKYLVATITFLLLCFAVWQYFRDRG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.