NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F071676

Metagenome / Metatranscriptome Family F071676

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F071676
Family Type Metagenome / Metatranscriptome
Number of Sequences 122
Average Sequence Length 54 residues
Representative Sequence MLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQ
Number of Associated Samples 115
Number of Associated Scaffolds 122

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.18 %
% of genes near scaffold ends (potentially truncated) 99.18 %
% of genes from short scaffolds (< 2000 bps) 93.44 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.180 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(23.770 % of family members)
Environment Ontology (ENVO) Unclassified
(31.148 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(41.803 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 81.82%    β-sheet: 0.00%    Coil/Unstructured: 18.18%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 122 Family Scaffolds
PF13544Obsolete Pfam Family 9.02
PF07963N_methyl 9.02
PF14341PilX_N 5.74
PF12019GspH 0.82
PF00085Thioredoxin 0.82
PF00578AhpC-TSA 0.82


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.18 %
UnclassifiedrootN/A0.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459007|GJ61VE201BX64XAll Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium508Open in IMG/M
3300002907|JGI25613J43889_10071131All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium942Open in IMG/M
3300004157|Ga0062590_102070343All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium592Open in IMG/M
3300004799|Ga0058863_11752161All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium506Open in IMG/M
3300004800|Ga0058861_11160799All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1164Open in IMG/M
3300005093|Ga0062594_102063884All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium611Open in IMG/M
3300005167|Ga0066672_10092241All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1833Open in IMG/M
3300005330|Ga0070690_101661406All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium519Open in IMG/M
3300005336|Ga0070680_100453620All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1095Open in IMG/M
3300005345|Ga0070692_11322064All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium518Open in IMG/M
3300005356|Ga0070674_101403946All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium625Open in IMG/M
3300005437|Ga0070710_11477139All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium510Open in IMG/M
3300005441|Ga0070700_101606507All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium555Open in IMG/M
3300005445|Ga0070708_100549920All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1089Open in IMG/M
3300005457|Ga0070662_101498439All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium582Open in IMG/M
3300005530|Ga0070679_100092842All Organisms → cellular organisms → Bacteria3005Open in IMG/M
3300005530|Ga0070679_101332463All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium664Open in IMG/M
3300005545|Ga0070695_101115507All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium646Open in IMG/M
3300005549|Ga0070704_100112460All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2075Open in IMG/M
3300005556|Ga0066707_10518605All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium772Open in IMG/M
3300005569|Ga0066705_10617876All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium663Open in IMG/M
3300005719|Ga0068861_101664903All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium630Open in IMG/M
3300005890|Ga0075285_1063806All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium510Open in IMG/M
3300006163|Ga0070715_10749340All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium588Open in IMG/M
3300006755|Ga0079222_10042958All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2041Open in IMG/M
3300006796|Ga0066665_10087974All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2250Open in IMG/M
3300006796|Ga0066665_11518038All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium524Open in IMG/M
3300006797|Ga0066659_10219700All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1404Open in IMG/M
3300006854|Ga0075425_101303935All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium823Open in IMG/M
3300006854|Ga0075425_101816067All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium684Open in IMG/M
3300006876|Ga0079217_10599647All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300007004|Ga0079218_10245918All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1407Open in IMG/M
3300007076|Ga0075435_100344747All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1276Open in IMG/M
3300007265|Ga0099794_10185395All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1063Open in IMG/M
3300010118|Ga0127465_1042210All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium817Open in IMG/M
3300010403|Ga0134123_12850785All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium552Open in IMG/M
3300011332|Ga0126317_10895354All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium532Open in IMG/M
3300011996|Ga0120156_1080768All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium590Open in IMG/M
3300012010|Ga0120118_1042715All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium1160Open in IMG/M
3300012200|Ga0137382_11233333All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium530Open in IMG/M
3300012203|Ga0137399_10135390All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1952Open in IMG/M
3300012203|Ga0137399_10506007All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1013Open in IMG/M
3300012205|Ga0137362_10757992All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium833Open in IMG/M
3300012212|Ga0150985_119176891All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium941Open in IMG/M
3300012285|Ga0137370_10135994All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1412Open in IMG/M
3300012351|Ga0137386_10623277All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium776Open in IMG/M
3300012357|Ga0137384_11066785All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium649Open in IMG/M
3300012683|Ga0137398_10700678All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium704Open in IMG/M
3300012685|Ga0137397_10659719All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium778Open in IMG/M
3300012912|Ga0157306_10370551All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium550Open in IMG/M
3300012918|Ga0137396_10260431All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1280Open in IMG/M
3300012925|Ga0137419_10195373All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1495Open in IMG/M
3300012927|Ga0137416_10878397All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium796Open in IMG/M
3300012951|Ga0164300_11206572All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium502Open in IMG/M
3300012957|Ga0164303_10324619All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium918Open in IMG/M
3300012961|Ga0164302_11890716All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium507Open in IMG/M
3300012975|Ga0134110_10173637All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium897Open in IMG/M
3300012977|Ga0134087_10520676All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium602Open in IMG/M
3300013296|Ga0157374_12356454All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium560Open in IMG/M
3300013296|Ga0157374_12593791All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium534Open in IMG/M
3300013768|Ga0120155_1031099All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1688Open in IMG/M
3300014058|Ga0120149_1149577All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium642Open in IMG/M
3300014150|Ga0134081_10360256All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium536Open in IMG/M
3300014823|Ga0120170_1087353All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium641Open in IMG/M
3300015164|Ga0167652_1063058All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium667Open in IMG/M
3300015190|Ga0167651_1054642All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium832Open in IMG/M
3300015199|Ga0167647_1131716All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium570Open in IMG/M
3300015200|Ga0173480_10856034All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium586Open in IMG/M
3300015359|Ga0134085_10381359All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium630Open in IMG/M
3300017657|Ga0134074_1093458All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1031Open in IMG/M
3300018000|Ga0184604_10136975All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium796Open in IMG/M
3300018063|Ga0184637_10530849All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium679Open in IMG/M
3300018433|Ga0066667_11543687All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium589Open in IMG/M
3300018482|Ga0066669_11830047All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium562Open in IMG/M
3300019882|Ga0193713_1156756All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium607Open in IMG/M
3300019883|Ga0193725_1136124All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium543Open in IMG/M
3300019890|Ga0193728_1131997All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1119Open in IMG/M
3300020018|Ga0193721_1157402All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium542Open in IMG/M
3300021073|Ga0210378_10141838All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium929Open in IMG/M
3300021080|Ga0210382_10441532All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium576Open in IMG/M
3300021344|Ga0193719_10374298All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium590Open in IMG/M
3300021363|Ga0193699_10141300All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium988Open in IMG/M
3300021411|Ga0193709_1090152All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium671Open in IMG/M
3300021415|Ga0193694_1053487All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium553Open in IMG/M
3300021510|Ga0222621_1059797All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium801Open in IMG/M
3300022756|Ga0222622_10134549All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1573Open in IMG/M
3300025898|Ga0207692_11218262All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium500Open in IMG/M
3300025899|Ga0207642_10664032Not Available654Open in IMG/M
3300025906|Ga0207699_11203514All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium561Open in IMG/M
3300025907|Ga0207645_10145918All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1543Open in IMG/M
3300025910|Ga0207684_11742745All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium501Open in IMG/M
3300025921|Ga0207652_10163248All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1997Open in IMG/M
3300025927|Ga0207687_11683420All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium544Open in IMG/M
3300025929|Ga0207664_11358522All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium631Open in IMG/M
3300025939|Ga0207665_10855057All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium720Open in IMG/M
3300025949|Ga0207667_10139328All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2498Open in IMG/M
3300026023|Ga0207677_10037498All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium3169Open in IMG/M
3300026023|Ga0207677_11779198All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium572Open in IMG/M
3300026142|Ga0207698_11178133All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300026550|Ga0209474_10232004All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1153Open in IMG/M
3300027617|Ga0210002_1090704All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium549Open in IMG/M
3300027695|Ga0209966_1067647All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium779Open in IMG/M
3300027765|Ga0209073_10333684All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium608Open in IMG/M
3300027903|Ga0209488_10051784All Organisms → cellular organisms → Bacteria3021Open in IMG/M
3300028715|Ga0307313_10033631All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1457Open in IMG/M
3300028778|Ga0307288_10475443All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium515Open in IMG/M
3300028784|Ga0307282_10384200All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium680Open in IMG/M
3300028796|Ga0307287_10282495All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium628Open in IMG/M
3300028811|Ga0307292_10393970All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium588Open in IMG/M
3300028828|Ga0307312_10061484All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2265Open in IMG/M
3300028828|Ga0307312_10363989All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium947Open in IMG/M
3300028881|Ga0307277_10456922All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium572Open in IMG/M
3300028884|Ga0307308_10431622All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium632Open in IMG/M
3300030904|Ga0308198_1052101All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium637Open in IMG/M
3300030990|Ga0308178_1139019All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium549Open in IMG/M
3300031081|Ga0308185_1011989All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium931Open in IMG/M
3300031095|Ga0308184_1038472All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium583Open in IMG/M
3300031098|Ga0308191_1040710All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium517Open in IMG/M
3300031099|Ga0308181_1135084All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium565Open in IMG/M
3300031421|Ga0308194_10382352All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium509Open in IMG/M
3300031854|Ga0310904_10928923All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium616Open in IMG/M
3300031908|Ga0310900_11595650All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium552Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil23.77%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.48%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere9.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.92%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost4.10%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.28%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.28%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil2.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.46%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.46%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.46%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.64%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.64%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated1.64%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.64%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.64%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.64%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.82%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.82%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.82%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.82%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.82%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.82%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.82%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.82%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.82%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.82%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459007Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cmEnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005890Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300010118Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011996Permafrost microbial communities from Nunavut, Canada - A39_65cm_12MEnvironmentalOpen in IMG/M
3300012010Permafrost microbial communities from Nunavut, Canada - A7_35cm_12MEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014823Permafrost microbial communities from Nunavut, Canada - A3_80cm_0MEnvironmentalOpen in IMG/M
3300015164Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015190Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015199Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021411Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027617Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030904Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030990Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031081Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_159 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031095Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031098Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_186 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
L02_063374302170459007Grass SoilMPNNTERRGFAIPIALLVIAALTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIFLVRRDSL
JGI25613J43889_1007113113300002907Grasslands SoilMPNKTERRGFAIPIALLVIAALTIMIAGGFSVVSAERRSVADQKSQISAFRIAEQGLEIFLVRRDSLMT
Ga0062590_10207034313300004157SoilMPTNKGRRGFALPTAILVILVMTIMLTAGFAIVSAERRSVSDQKSQI
Ga0058863_1175216123300004799Host-AssociatedMLNNAERRGFAIPFAVLVIALLTIMLAGGFSLVSAERRSVADQKSQVSAFRIAEQGLELYLVRRD
Ga0058861_1116079913300004800Host-AssociatedMMNKTERRGFAIPIAVLVIAVLTIMIAGGFSIVSAERRSVADQKSQISAFRIAEQGLEIYLVARDSLIA
Ga0062594_10206388413300005093SoilMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLELYLIR
Ga0066672_1009224113300005167SoilMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQK
Ga0070690_10166140623300005330Switchgrass RhizosphereMVNNSERRGFAIPIAVLVIAVLTIMIAGGFSLVSAERRSVADQKSQVNAFRIAEQGLE
Ga0070680_10045362013300005336Corn RhizosphereMMNKTERRGFAIPIAVLVIAVLTIMIAGGFSIVSAERRSVADQKSQISAFRI
Ga0070692_1132206423300005345Corn, Switchgrass And Miscanthus RhizosphereMVNNSERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQVNAFRI
Ga0070674_10140394623300005356Miscanthus RhizosphereMLNNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIY
Ga0070710_1147713923300005437Corn, Switchgrass And Miscanthus RhizosphereMLNKTERRGFAIPTALLIIAALTIMVAGGFSLVSAERRSVADQKSQINAFRIAEQGLELF
Ga0070700_10160650713300005441Corn, Switchgrass And Miscanthus RhizosphereMLNNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQI
Ga0070708_10054992013300005445Corn, Switchgrass And Miscanthus RhizosphereMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQ
Ga0070662_10149843923300005457Corn RhizosphereMLNNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGL
Ga0070679_10009284213300005530Corn RhizosphereMLNNAERRGFAIPFAVLVIAVLTIMLAGGFSLVSAERRSVADQKSQVSAFRIAEQGLELYLVRRD
Ga0070679_10133246323300005530Corn RhizosphereMLNNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIYLIARDSLI
Ga0070695_10111550713300005545Corn, Switchgrass And Miscanthus RhizosphereMLNNSERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQ
Ga0070704_10011246013300005549Corn, Switchgrass And Miscanthus RhizosphereMLNNQRRGFAIPIAVLVIMVLTIMVAGGFSLVSAERRSVADQKSQISAFRIAEQGLEI
Ga0066707_1051860523300005556SoilMLNNNERRGFAIPIAILVIAVLTIMIAGGFSLVSA
Ga0066705_1061787613300005569SoilMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQVSAFRIAEQGLEVYLVSRDSLIALGQ
Ga0068861_10166490323300005719Switchgrass RhizosphereMLNKSERRGFAIPIAVLVIAVLTIMIAGGFSLVSAERRSVADQKSQMNAFRIAEQGLEIFLIRRDSLM
Ga0075285_106380623300005890Rice Paddy SoilMPNHSERRGFAIPIAILVILVLTIMIAGGFTLVSAERRSVADQKSQISAFRIAEQGLELY
Ga0070715_1074934023300006163Corn, Switchgrass And Miscanthus RhizosphereMLNQNERRGFAIPTALLIIAALTIMVAGGFSLVSAERRSVADQK
Ga0079222_1004295813300006755Agricultural SoilMMNNNRRGFAIPTAILVILVLTIMIAGGFSLVSAERRSVSDQKAQVGAFRIAEQ
Ga0066665_1008797453300006796SoilMPNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKS
Ga0066665_1151803823300006796SoilMLNNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKS
Ga0066659_1021970013300006797SoilMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEI
Ga0075425_10130393513300006854Populus RhizosphereMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLE
Ga0075425_10181606713300006854Populus RhizosphereMLNDNINRRGFAIPTAVLVIMVLTIMVAGGFSIVSAERRS
Ga0079217_1059964723300006876Agricultural SoilMLNNTRRRGFAIPVAILVILVLTIMVAGGFSLVSAERRSVADQKSQISAFRIAEQGLEVFLVRRDSLMK
Ga0079218_1024591833300007004Agricultural SoilMSNTIERRGFALPTAILVIAVMTIMIAGGFSLVSAERRSVSDQKAQITAFKIAEDGLELF
Ga0075435_10034474733300007076Populus RhizosphereMMNNNRRGFAIPTAILVILVLTIMIAGGFSLVSAERRSVSDQKAQV
Ga0099794_1018539523300007265Vadose Zone SoilMPNQTERRGFAIPVAILVIAVLTIMLAGGFSLVSAERRSVSDQKSQISAFRIAEQGLEIYLV
Ga0127465_104221013300010118Grasslands SoilMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVA
Ga0134123_1285078513300010403Terrestrial SoilMLNNQRRGFAIPIAVLVIMVLTIMVAGGFSLVSAERRSVADQKSQISAFRIAE
Ga0126317_1089535413300011332SoilMLNNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQK
Ga0120156_108076823300011996PermafrostMSNHVERRGFALPTAILVILAMTIMVAAGFSMVSAEHPSVSDQKSQISAFEIAEQ
Ga0120118_104271523300012010PermafrostMAKHNLTNRRGFAIPTAILVIAILTAALAAGFSLVSAENRSIADQKAQVTAFEL
Ga0137382_1123333323300012200Vadose Zone SoilMRNNTERRGFAIPIALLVIAALTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIFLVRRDSLM
Ga0137399_1013539013300012203Vadose Zone SoilMPNQTERRGFAIPVAILVIAVLTIMLAGGFSLVSAERR
Ga0137399_1050600713300012203Vadose Zone SoilMSNNSARRGFAIPIAVLVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEVFLV
Ga0137362_1075799213300012205Vadose Zone SoilMSNNAERRGFAIPIAVLVIAALTIMIAGGFSLVSAERRS
Ga0150985_11917689123300012212Avena Fatua RhizosphereMLNPNERRGFAIPIAVLVIAVLTIMIAGGFSLVSAERRSV
Ga0137370_1013599413300012285Vadose Zone SoilMLNNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQG
Ga0137386_1062327723300012351Vadose Zone SoilMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISA
Ga0137384_1106678523300012357Vadose Zone SoilMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAF
Ga0137398_1070067813300012683Vadose Zone SoilMPNKTERRGFAIPIALLVIAALTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIFLVRRD
Ga0137397_1065971923300012685Vadose Zone SoilMLNNAERRGFAIPIALLVIAVLTIMVAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIFLVRR
Ga0157306_1037055123300012912SoilMPNYTQRRGFAIPVAILVILVLTIMVAGGFSLVSAERRSVADQKSQISAF
Ga0137396_1026043113300012918Vadose Zone SoilMSNNSARRGFAIPIAVLVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEVFLVR
Ga0137419_1019537323300012925Vadose Zone SoilMLNQTERRGFAIPFAILVIAVLTIMLAGGFSLVSAERRSVSDQKSQISAFRIAVQGLEIYLVRAD*
Ga0137416_1087839723300012927Vadose Zone SoilMSNNSARRGFAIPIAVLVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEVFLVRRDSLMQGK
Ga0164300_1120657223300012951SoilMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVAD
Ga0164303_1032461923300012957SoilMMTNNERRGFAIPIALLVIAVLTIMIAGGFSIVSAERRSVAD
Ga0164302_1189071623300012961SoilMLNNNNRRGFAIPTAVLVIMVLTIMVAGGFSIVSAERRSVDDQKSQVSAFRIAEQGLEIYLV
Ga0134110_1017363713300012975Grasslands SoilMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFR
Ga0134087_1052067613300012977Grasslands SoilMLNNTERRGFAIPIAILVTAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIYLVARDS
Ga0157374_1235645413300013296Miscanthus RhizosphereMLNDNINRRGFAIPTAVLVIMVLTIMVAGGFSIVSAERRSVGDQKSQVSAFRIAEQGLEIYLIARDSLITAGT
Ga0157374_1259379123300013296Miscanthus RhizosphereMLSKNERRGFAIPTALLIIAALTIMVAGAFSLVSAERRSGAAQKSQSNAFTIAGQGLELFLV
Ga0120155_103109943300013768PermafrostMLNNVERRGFALPTAILVILVLAIMIAAGFSIVSAERRSVSDQKSQISAFEIAEQ
Ga0120149_114957723300014058PermafrostMLNNTERRGFAIPMAILVIAVLTIMLAGGFSLVSAERRSVSDQKSQINAFRIAE
Ga0134081_1036025613300014150Grasslands SoilMLNNKQRRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLELFLVRRDSLM
Ga0120170_108735323300014823PermafrostMAKHNLTNRRGFAIPTAILVIAILTAALAAGFSLVSAENRSIADQKAQVTAFE
Ga0167652_106305823300015164Glacier Forefield SoilMLNNTERRGFAIPIAILVIAVLTIMLAGGFSLVSAERRSVSDQKSQISAFRIAEQGLEV
Ga0167651_105464223300015190Glacier Forefield SoilMLNNTERRGFAIPVAILVIAVLTIMLAGGFSLVSAERRSVS
Ga0167647_113171613300015199Glacier Forefield SoilMLNNTKHRGFAIPIALLVIAVLTIMVAGGFSLVSAERRSVADQKSQISAF
Ga0173480_1085603423300015200SoilMVNNSERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQMNAFRIAEQGLEIFLVRRDSL
Ga0134085_1038135913300015359Grasslands SoilMLNNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQ
Ga0134074_109345813300017657Grasslands SoilMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLELFLVRRDSLM
Ga0184604_1013697523300018000Groundwater SedimentMLNNNERRGFAIPVALLVIAVLTIMVAGGFSLVSAERRSVADQKSQI
Ga0184637_1053084923300018063Groundwater SedimentMPNNTQRRGFAIPVAILVILVLTIMVAGGFSLVSAERRSVADQKSQISAF
Ga0066667_1154368723300018433Grasslands SoilMLNNSERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQG
Ga0066669_1183004723300018482Grasslands SoilMLNNTERRGFAIPIAVLVILVLTIMIAGGFSLVSAERRSVAD
Ga0193713_115675623300019882SoilMLNKTERGGFAIPTALLIIAALTIMVAGGFSLVSAERRSVADQKS
Ga0193725_113612423300019883SoilMPNNTARRGFAIPVALLIIAALTIMVAGGFSLVSAERRSVADQKSQISAFRIAEQG
Ga0193728_113199713300019890SoilMPNNTERRGFAIPIALLVIAALTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIFLVR
Ga0193721_115740213300020018SoilMLNNTQRRGFAIPVAILVILVLTIMVAGGFSLVSAERRSVADQKSQISAFRIAEQGLEI
Ga0210378_1014183823300021073Groundwater SedimentMLNNTQRRGFAIPVAILVILVLTIMVAGGFSLVSAERRSVADQKSQISAFR
Ga0210382_1044153213300021080Groundwater SedimentMMTNTERRGFAIPIALLVIAVLTIMIAGGFSIVSAERRSVADQKSQINAFRIAEQGL
Ga0193719_1037429823300021344SoilMMTNTERRGFAIPIALLVIAVLTIMIAGGFSIVSAERRSVADQKSQINAFRIAEQ
Ga0193699_1014130013300021363SoilMLNNTERRGFAIPFAVLVIAVLTIMLAGGFSIVSAERRSVADQKSQ
Ga0193709_109015213300021411SoilMLNNTERRGFAIPFAVLVIAVLTIMLAGGFSLVSAERRSVADQKSQISAFRIAEQGLELY
Ga0193694_105348723300021415SoilMSINTERRGFALPTAILVIAVLTIMVAGGFSIVSAERRSVADQKSQISAFRIAEQGL
Ga0222621_105979713300021510Groundwater SedimentMLNNTERRGFAIPVALLVIAVLTIMVAGGFSLVSAERRSVADQKSQISA
Ga0222622_1013454913300022756Groundwater SedimentMLNNTERRGFAIPVALLVIAVLTIMVAGGFSLVSAERRSVADQKSQIS
Ga0207692_1121826213300025898Corn, Switchgrass And Miscanthus RhizosphereMMNKTERRGFAIPIAVLVIAVLTIMIAGGFSIVSAERRSVADQK
Ga0207642_1066403223300025899Miscanthus RhizosphereMLNKSERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQMNA
Ga0207699_1120351423300025906Corn, Switchgrass And Miscanthus RhizosphereMLNNSERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQVSA
Ga0207645_1014591833300025907Miscanthus RhizosphereMLNNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQIS
Ga0207684_1174274513300025910Corn, Switchgrass And Miscanthus RhizosphereMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADKKSQISAFRIAEQGLE
Ga0207652_1016324813300025921Corn RhizosphereMPNHSERRGFAIPIAILVILVLTIMIAGGFSLVSAERRSV
Ga0207687_1168342013300025927Miscanthus RhizosphereMLNNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIYLVAR
Ga0207664_1135852213300025929Agricultural SoilMLNQNERRGFAIPTALLIIAALTIMVAGGFSLVSAERRSVADQKSQINAFRIAEQGLELFLVKRDSL
Ga0207665_1085505713300025939Corn, Switchgrass And Miscanthus RhizosphereMLNQNERRGFAIPTALLIIAALTIMVAGGFSLVSAERRSVADQKSQINAFRIAEQGLELFLVK
Ga0207667_1013932813300025949Corn RhizosphereMLSKNERRGFAIPTALLIIAALTIMVAGGFSLVSAERRSVADQKSQINAFRIAEQGLELFLVKR
Ga0207677_1003749863300026023Miscanthus RhizosphereMVNNSERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQVNAFRIAEQG
Ga0207677_1177919823300026023Miscanthus RhizosphereMMNNNRRGFAIPTAILVILVLTIMIAGGFSLVSAERRSARSAV
Ga0207698_1117813313300026142Corn RhizosphereMPNNSERRGFAIPIAILVILVLTIMIAGGFSLVSAERRSVADQKSQISAFR
Ga0209474_1023200433300026550SoilMLNNTERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIYLVARD
Ga0210002_109070423300027617Arabidopsis Thaliana RhizosphereMLNNKQRRGFAIPVAILVILVLTIMVAGGFSLVSAERRSVADQKSQISAFRIAEQGLELFLVRRDS
Ga0209966_106764713300027695Arabidopsis Thaliana RhizosphereMLNNKQRRGFAIPVAILVILVLTIMVAGGFSLVSAERRSVADQKSQ
Ga0209073_1033368423300027765Agricultural SoilMLNNKRRGFAIPTAILVILVLTVMVAGGFSLVSAER
Ga0209488_1005178463300027903Vadose Zone SoilMLTNTERRGFAIPVAILVIAVLTIMLAGGFSLVSAERRSVSDQKSQISAFRIAEQG
Ga0307313_1003363133300028715SoilMMTNTERRGFAIPIALLVIAVLTIMIAGGFSIVSAERRSVAD
Ga0307288_1047544323300028778SoilMLNNTERRGFAIPVALLVIAVLTIMVAGGFSLVSAERRSVADQKSQISAFRI
Ga0307282_1038420013300028784SoilMMTNSERRGFAIPIALLVIAVLTIMIAGGFSIVSAERRSVADQKSQINAFRIAEQGLE
Ga0307287_1028249513300028796SoilMLNNTQRRGFAIPVALLVIMVLTIMVAGGFSLVSAERRSVADQKSQISAFR
Ga0307292_1039397023300028811SoilMLNNTQRRGFAIPVALLVIMVLTIMVAGGFSLVSAERRSVAD
Ga0307312_1006148413300028828SoilMPNNAERRGFAIPIALLVIAALTIMIAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIFLVRRDSLMAGH
Ga0307312_1036398923300028828SoilMNNTERRGFAIPIAVLVIAVLTIMIAGGFSIVSAERRSVADQKSQISAFRIAEQGLEIYLVRRDSL
Ga0307277_1045692223300028881SoilMLNNKRRGFAIPTAILVILVLTIMLAGGFSLVSAERRSVADQKSQVAA
Ga0307308_1043162223300028884SoilMLNNTQRRGFAIPVAILVILVLTIMVAGGFSLVSAERRSVADQKSQISAFRIAEQGLEIFLV
Ga0308198_105210123300030904SoilMMTNSERRGFAIPIALLVIAVLTIMIAGGFSIVSA
Ga0308178_113901923300030990SoilMLNNTQRRGFAIPVAILVILVLTIMVAGGFSLVSAERRSVA
Ga0308185_101198923300031081SoilMMTNTERRGFAIPIALLVIAVLTIMIAGGFSIVSAERRSVADQKSQIIAFRIAEQGLEIYLIRRDSLLA
Ga0308184_103847213300031095SoilMSINTERRGFALPTAILVIAVLSIMVAGGFSIVSAERRSV
Ga0308191_104071023300031098SoilMLNKTERRGFAIPTALLIIAALTIMVAGGFSLVSAERRSVADQKSQISAF
Ga0308181_113508423300031099SoilMSINTERRGFALPTAILVIAVLTIMVAGGFSIVSAE
Ga0308194_1038235223300031421SoilMPNNTQRRGFAIPVAILVILVLTIMVAGGFSLVSAERRSVADQKSQISA
Ga0310904_1092892323300031854SoilMLHNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAER
Ga0310900_1159565023300031908SoilMLHNNERRGFAIPIAILVIAVLTIMIAGGFSLVSAERRSVADQKSQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.