Basic Information | |
---|---|
Family ID | F071681 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 122 |
Average Sequence Length | 43 residues |
Representative Sequence | AAHEDGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 122 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.62 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.180 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (22.131 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.492 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.082 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.50% β-sheet: 8.33% Coil/Unstructured: 79.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 122 Family Scaffolds |
---|---|---|
PF01494 | FAD_binding_3 | 94.26 |
PF13564 | DoxX_2 | 3.28 |
PF07992 | Pyr_redox_2 | 0.82 |
PF13368 | Toprim_C_rpt | 0.82 |
PF07167 | PhaC_N | 0.82 |
COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
---|---|---|---|
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 188.52 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 94.26 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 94.26 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 94.26 |
COG3243 | Poly-beta-hydroxybutyrate synthase | Lipid transport and metabolism [I] | 0.82 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.18 % |
Unclassified | root | N/A | 0.82 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459005|F1BAP7Q02JNL2U | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 555 | Open in IMG/M |
3300001356|JGI12269J14319_10188726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 825 | Open in IMG/M |
3300003218|JGI26339J46600_10067950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 918 | Open in IMG/M |
3300003218|JGI26339J46600_10115692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
3300003659|JGI25404J52841_10031065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1142 | Open in IMG/M |
3300004643|Ga0062591_101610282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
3300004977|Ga0072329_1371008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 992 | Open in IMG/M |
3300005164|Ga0066815_10012071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1086 | Open in IMG/M |
3300005327|Ga0070658_10695344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 882 | Open in IMG/M |
3300005366|Ga0070659_100837069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 801 | Open in IMG/M |
3300005435|Ga0070714_101260852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 721 | Open in IMG/M |
3300005435|Ga0070714_102038119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 559 | Open in IMG/M |
3300005436|Ga0070713_101561727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
3300005459|Ga0068867_101132205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
3300005541|Ga0070733_10626250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
3300005545|Ga0070695_100246341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1299 | Open in IMG/M |
3300005614|Ga0068856_101685131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 646 | Open in IMG/M |
3300005614|Ga0068856_101946590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 598 | Open in IMG/M |
3300005834|Ga0068851_10660728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 640 | Open in IMG/M |
3300006028|Ga0070717_10133762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2134 | Open in IMG/M |
3300006028|Ga0070717_10493982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1106 | Open in IMG/M |
3300006028|Ga0070717_11138461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 710 | Open in IMG/M |
3300006086|Ga0075019_11048457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
3300006102|Ga0075015_100559009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
3300006102|Ga0075015_100934362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
3300006163|Ga0070715_10661451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 619 | Open in IMG/M |
3300006173|Ga0070716_100813395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 724 | Open in IMG/M |
3300006173|Ga0070716_100833958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
3300006237|Ga0097621_100345741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1321 | Open in IMG/M |
3300006354|Ga0075021_10788287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 613 | Open in IMG/M |
3300006755|Ga0079222_10764204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 780 | Open in IMG/M |
3300006755|Ga0079222_12506560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
3300006804|Ga0079221_10709405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 702 | Open in IMG/M |
3300006893|Ga0073928_10105704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2351 | Open in IMG/M |
3300009523|Ga0116221_1089406 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1371 | Open in IMG/M |
3300009525|Ga0116220_10073577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1435 | Open in IMG/M |
3300009551|Ga0105238_13037744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
3300009624|Ga0116105_1053487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 933 | Open in IMG/M |
3300009683|Ga0116224_10179263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1017 | Open in IMG/M |
3300009683|Ga0116224_10433539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 626 | Open in IMG/M |
3300009683|Ga0116224_10519833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 568 | Open in IMG/M |
3300009698|Ga0116216_10037614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3000 | Open in IMG/M |
3300009698|Ga0116216_10233174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1126 | Open in IMG/M |
3300009698|Ga0116216_10656576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 631 | Open in IMG/M |
3300009700|Ga0116217_10272478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1094 | Open in IMG/M |
3300009824|Ga0116219_10466744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 700 | Open in IMG/M |
3300009839|Ga0116223_10285218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 989 | Open in IMG/M |
3300010048|Ga0126373_10530557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1223 | Open in IMG/M |
3300010341|Ga0074045_10442812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 839 | Open in IMG/M |
3300010379|Ga0136449_101988399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 859 | Open in IMG/M |
3300010379|Ga0136449_102360411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 769 | Open in IMG/M |
3300010379|Ga0136449_102739880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
3300010876|Ga0126361_10582875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1100 | Open in IMG/M |
3300011084|Ga0138562_1183359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 538 | Open in IMG/M |
3300012285|Ga0137370_11038672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 504 | Open in IMG/M |
3300013306|Ga0163162_11886590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 684 | Open in IMG/M |
3300014199|Ga0181535_10384787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 824 | Open in IMG/M |
3300015374|Ga0132255_105741527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 525 | Open in IMG/M |
3300016387|Ga0182040_10648868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 859 | Open in IMG/M |
3300017823|Ga0187818_10027332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2442 | Open in IMG/M |
3300017926|Ga0187807_1079609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1024 | Open in IMG/M |
3300017928|Ga0187806_1372535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
3300017946|Ga0187879_10651006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
3300017955|Ga0187817_10924442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 558 | Open in IMG/M |
3300018001|Ga0187815_10491683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 525 | Open in IMG/M |
3300018043|Ga0187887_10166984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1315 | Open in IMG/M |
3300020002|Ga0193730_1073391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 972 | Open in IMG/M |
3300020580|Ga0210403_10999696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
3300021374|Ga0213881_10011574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3621 | Open in IMG/M |
3300021377|Ga0213874_10153951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces afghaniensis → Streptomyces afghaniensis 772 | 804 | Open in IMG/M |
3300021475|Ga0210392_10352788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1065 | Open in IMG/M |
3300021560|Ga0126371_11661204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 763 | Open in IMG/M |
3300025910|Ga0207684_10410034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1165 | Open in IMG/M |
3300025927|Ga0207687_10286678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1322 | Open in IMG/M |
3300025939|Ga0207665_11191009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
3300025986|Ga0207658_10395489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1214 | Open in IMG/M |
3300026142|Ga0207698_10190095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1828 | Open in IMG/M |
3300027003|Ga0207722_1024844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
3300027035|Ga0207776_1028291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 720 | Open in IMG/M |
3300027039|Ga0207855_1023414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 839 | Open in IMG/M |
3300027497|Ga0208199_1012372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1971 | Open in IMG/M |
3300027604|Ga0208324_1003059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6129 | Open in IMG/M |
3300027725|Ga0209178_1176480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 748 | Open in IMG/M |
3300027727|Ga0209328_10129905 | Not Available | 768 | Open in IMG/M |
3300027853|Ga0209274_10458893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 659 | Open in IMG/M |
3300027854|Ga0209517_10019543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6396 | Open in IMG/M |
3300027854|Ga0209517_10386017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 791 | Open in IMG/M |
3300027867|Ga0209167_10481218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 679 | Open in IMG/M |
3300028380|Ga0268265_12121573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
3300028381|Ga0268264_10881701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 897 | Open in IMG/M |
3300028768|Ga0307280_10022619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1821 | Open in IMG/M |
3300030494|Ga0310037_10204894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 872 | Open in IMG/M |
3300030494|Ga0310037_10324942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 650 | Open in IMG/M |
3300030707|Ga0310038_10223675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 885 | Open in IMG/M |
3300031524|Ga0302320_10412249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1695 | Open in IMG/M |
3300031564|Ga0318573_10292151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 872 | Open in IMG/M |
3300031564|Ga0318573_10784992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 512 | Open in IMG/M |
3300031573|Ga0310915_10123495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1769 | Open in IMG/M |
3300031668|Ga0318542_10699177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
3300031708|Ga0310686_104357027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
3300031716|Ga0310813_10548990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1016 | Open in IMG/M |
3300031736|Ga0318501_10202343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1039 | Open in IMG/M |
3300031765|Ga0318554_10253471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1002 | Open in IMG/M |
3300031769|Ga0318526_10348674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 605 | Open in IMG/M |
3300031832|Ga0318499_10435938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 500 | Open in IMG/M |
3300031896|Ga0318551_10312467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 885 | Open in IMG/M |
3300031897|Ga0318520_10392009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 848 | Open in IMG/M |
3300031918|Ga0311367_11261105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 732 | Open in IMG/M |
3300031954|Ga0306926_11643929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 735 | Open in IMG/M |
3300032008|Ga0318562_10364274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 840 | Open in IMG/M |
3300032076|Ga0306924_12180890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 565 | Open in IMG/M |
3300032160|Ga0311301_10041292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 11108 | Open in IMG/M |
3300032160|Ga0311301_10314846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2489 | Open in IMG/M |
3300032160|Ga0311301_12477218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 581 | Open in IMG/M |
3300032770|Ga0335085_10351255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1728 | Open in IMG/M |
3300032805|Ga0335078_12422676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 545 | Open in IMG/M |
3300032828|Ga0335080_10363656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1559 | Open in IMG/M |
3300032828|Ga0335080_11081621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 812 | Open in IMG/M |
3300032892|Ga0335081_10494991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1540 | Open in IMG/M |
3300032954|Ga0335083_10765984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 777 | Open in IMG/M |
3300033158|Ga0335077_11982849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
3300033289|Ga0310914_10633729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 962 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 22.13% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.20% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.10% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.28% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.28% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.28% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.46% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.46% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.64% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.64% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.64% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.64% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.64% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.64% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.64% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.82% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.82% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.82% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.82% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.82% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.82% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.82% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.82% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.82% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.82% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.82% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.82% |
Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.82% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.82% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.82% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.82% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.82% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300003218 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 | Environmental | Open in IMG/M |
3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004977 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 67 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011084 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027003 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes) | Environmental | Open in IMG/M |
3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E41_06639360 | 2170459005 | Grass Soil | RVTAAHEDGRLVLTVTGADPDRVRDAVTGFALTIRSGPSPAEQTTNK |
JGI12269J14319_101887262 | 3300001356 | Peatlands Soil | TVTGADPGRVRDAVAGFAVTVRCGPSPAEQTTSK* |
JGI26339J46600_100679502 | 3300003218 | Bog Forest Soil | ETDARVTAAHEDGRLVVTVTGADPGRVRDAIAGFALTVRSGPPPATQTTKE* |
JGI26339J46600_101156922 | 3300003218 | Bog Forest Soil | AHEDGRLVVTVTGADPGRVRDAVAGFALTVRCGPPPAPQTTSK* |
JGI25404J52841_100310652 | 3300003659 | Tabebuia Heterophylla Rhizosphere | YEDGRLVLTVTGAEPGQVRDAIAGYALTVRPGPSPAPRPA* |
Ga0062591_1016102822 | 3300004643 | Soil | AAAHEDGRLVLTVTGADPGRVREAVAGFALTVRCGPATAPQTAVNDPQKGPRP* |
Ga0072329_13710081 | 3300004977 | Peatlands Soil | EDGRLVLTVTGADPDRVQDAVAGFALTVRSGPSPTPQSTSK* |
Ga0066815_100120712 | 3300005164 | Soil | DGRLVLTVTGADPDPVRDAVAGFALTIRCGPSPAAQTTAN* |
Ga0070658_106953442 | 3300005327 | Corn Rhizosphere | GRLVLTVTGADPGRVRDAVAGFALTIRSGPSPAAQTTAN* |
Ga0070659_1008370691 | 3300005366 | Corn Rhizosphere | TAAHEDGRLVLIVTGADPGRIREAVAGFAVTVRSGPSPAAQTTAN* |
Ga0070714_1012608521 | 3300005435 | Agricultural Soil | TAAHENGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPQISVNDPQKGPRP* |
Ga0070714_1020381191 | 3300005435 | Agricultural Soil | QVTAAHEDGRLVLTVTGADPDRVRDAVAGFALTIRCGPATAPQTAVK* |
Ga0070713_1015617272 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | AAHEDGRMVLTVTGADPGRVRDAVAGFALTVRSGPPSAAQTTANWPAEKGTRP* |
Ga0068867_1011322051 | 3300005459 | Miscanthus Rhizosphere | ADARVTAAHEDGRMVLTVTGADPGRVRDAVAGFALTIRSGPSPAAQTTAN* |
Ga0070733_106262502 | 3300005541 | Surface Soil | DAGTSAAHEDGRLIVTVTGADPGRVRDAVAGFALTIRVETPTHQTAEH* |
Ga0070695_1002463411 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | GRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPQIAVK* |
Ga0068856_1016851312 | 3300005614 | Corn Rhizosphere | GRLVLTVTGADPDRVRDAVAGFALTIRCGPATAPQTAVK* |
Ga0068856_1019465902 | 3300005614 | Corn Rhizosphere | HEDGRLVVTVTGAGPGRVRNAVAGFALTVRCGPSPAEQTTTN* |
Ga0068851_106607282 | 3300005834 | Corn Rhizosphere | AAHEDGRMVLTVTGADPGRVRDAVAGFALTVRSGPPSAAQTTAN* |
Ga0070717_101337623 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GRLIVTVTGADPGRVRDAVAGFALTVRSGPPPAAQTTAN* |
Ga0070717_104939822 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DGRLVVTVTGADPDRVQDAVAGFALTVRSGPSPIPQTTE* |
Ga0070717_111384612 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | DGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPRSP* |
Ga0075019_110484572 | 3300006086 | Watersheds | DARVTAAHEDGRLVVTVTGADPDRVQDAVAGFALTVRSGPSPTPQSTSK* |
Ga0075015_1005590092 | 3300006102 | Watersheds | AAHEDGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK* |
Ga0075015_1009343621 | 3300006102 | Watersheds | HGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPAN* |
Ga0070715_106614512 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TVTGADPGRVRDAVAGFALTVRSGPSPAAQTAAN* |
Ga0070716_1008133952 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAAHEDGRLVLTVTGADPDRVRDAVAGFALTIRSGPSPAEQTTNK* |
Ga0070716_1008339581 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | EDGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPQIAVK* |
Ga0097621_1003457411 | 3300006237 | Miscanthus Rhizosphere | VLTVTGADPGRVRDAVAGFALTIRSGPSPAAQTTAN* |
Ga0075021_107882871 | 3300006354 | Watersheds | AHEDGRLVLTVTGADPDRVRDAVAGFALTVRAGPSPATQTT* |
Ga0079222_107642041 | 3300006755 | Agricultural Soil | QVTAAHDDGRLVLTVNGADPDRVHDAVAGVALTVPCGPATAPQTAVK* |
Ga0079222_125065602 | 3300006755 | Agricultural Soil | AHRDGRLVVTVAGADPGQVRDAITGFALAVTTVPWPDPAGEA* |
Ga0079221_107094052 | 3300006804 | Agricultural Soil | TAAHEDGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPRSP* |
Ga0073928_101057041 | 3300006893 | Iron-Sulfur Acid Spring | LTVTGADPDRVRDAVAGFALTVRCRPATAPQTTVT* |
Ga0116221_10894062 | 3300009523 | Peatlands Soil | AAYEDGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTSK* |
Ga0116220_100735771 | 3300009525 | Peatlands Soil | TVTGADPGRVRDAVAGFALTVRSGPSPAAQTTSK* |
Ga0105238_130377441 | 3300009551 | Corn Rhizosphere | LTVTGADPGRVRDAVAGFALTVRSGPPSAAQTTAN* |
Ga0116105_10534872 | 3300009624 | Peatland | TVTGADPGRVRDAVAGFALTVRSGPSPAAQTTPN* |
Ga0116224_101792631 | 3300009683 | Peatlands Soil | VVTVTGADPGRVRDAVAGFALTVRSGPSPAPATAAN* |
Ga0116224_104335391 | 3300009683 | Peatlands Soil | TAAHEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK* |
Ga0116224_105198331 | 3300009683 | Peatlands Soil | TAAHEDGRLVVTVTGTDPGRVREAVAGFALTIRTGPSPAAQTAAN* |
Ga0116216_100376144 | 3300009698 | Peatlands Soil | ARATAAHEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPQSAVN* |
Ga0116216_102331742 | 3300009698 | Peatlands Soil | GRLVVTVTGADPGRVRDAVAGFALTVRSGPSPTAQTTSK* |
Ga0116216_106565761 | 3300009698 | Peatlands Soil | AYEDGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPQITNK* |
Ga0116217_102724781 | 3300009700 | Peatlands Soil | HEDGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAEQTTNK* |
Ga0116219_104667441 | 3300009824 | Peatlands Soil | AYEDGRLVLTVTGADSSQVRAALAGFALAVRCGPATAPRSP* |
Ga0116223_102852182 | 3300009839 | Peatlands Soil | VTVTGADPGRVRDAVAGFALTIRTGPSPAAQTAAN* |
Ga0126373_105305571 | 3300010048 | Tropical Forest Soil | HEDGRLVVTVTGADPGLVRDAVAGFALTVRCGPSPAPQTAAQ* |
Ga0074045_104428122 | 3300010341 | Bog Forest Soil | VTAAHEDGRLVVTVTGADPDRVQDAVAGFALTVRSAPPPAPQSTKK* |
Ga0136449_1019883991 | 3300010379 | Peatlands Soil | EHGRLVVTVTGADPGRVRDAVAGFALTVRCGPSPAAQTTSK* |
Ga0136449_1023604112 | 3300010379 | Peatlands Soil | VTAAHEDGRLVVTVTGADPGRVRDAVAGFALTVRTGPSPAPQSAVN* |
Ga0136449_1027398802 | 3300010379 | Peatlands Soil | GLPAARAAATHEDGRLVLTVTGADPGRVRDAVAGFALTVRCGPSPCPQTSPK* |
Ga0126361_105828751 | 3300010876 | Boreal Forest Soil | RLVLTVTGADPDRVRDAVAGFALTVRSGPSPAAQTTAN* |
Ga0138562_11833591 | 3300011084 | Peatlands Soil | EDGRLVVTVTGADPGRVREAVAGFALTVRCGPSPAAQTTSK* |
Ga0137370_110386721 | 3300012285 | Vadose Zone Soil | QVTAAHENGRLVLTVTVADPGRVRDAVAGFALTVRSGPSPAAQTTAN* |
Ga0163162_118865902 | 3300013306 | Switchgrass Rhizosphere | VLTVPGADPGRVRDAVAGFALTVLSWPSTAAQTTAN* |
Ga0181535_103847871 | 3300014199 | Bog | TVTGADPGRVRDAVAGFTLTVRSGPSPAAQTTNK* |
Ga0132255_1057415271 | 3300015374 | Arabidopsis Rhizosphere | TVTGADPGRIRDAVAGFALTVRSGPPPVPRTTNK* |
Ga0182040_106488682 | 3300016387 | Soil | AGAAAANEDGRLVLTVTGADPGHVRDAVAGYALTVRPGPSPAPRPA |
Ga0187818_100273321 | 3300017823 | Freshwater Sediment | VVTVTGADPGRVRDTVAGFALTIRCGPSPAPEDHREVTRRK |
Ga0187807_10796091 | 3300017926 | Freshwater Sediment | LPDAQATAAHEDGRLVVTVTGTDPGRVREAVAGFALTIRTGPSPAAQTAAN |
Ga0187806_13725351 | 3300017928 | Freshwater Sediment | AIAAHEDGRLVVTVTGADPGQVRDALAGFALIVRSAPPPAGRTAAD |
Ga0187879_106510061 | 3300017946 | Peatland | ITVTGADPGRVRDAVAGFTLTVRSGPSPAAQTTNK |
Ga0187817_109244422 | 3300017955 | Freshwater Sediment | LVLTVTGADPGRVRDAVAGFALTVRCGPAPAPENAVK |
Ga0187815_104916832 | 3300018001 | Freshwater Sediment | VTVTGADPGQVRDALAGFALIVRSAPPPAGRTAAD |
Ga0187887_101669842 | 3300018043 | Peatland | ATAAHESGRLVITVTGADPDRVQDAVAGFALTVRSGPSPAEQTTNK |
Ga0193730_10733911 | 3300020002 | Soil | GRLVVTVTGADPGQVRDSVAGFALTVRSGPSPAEQTTNK |
Ga0210403_109996962 | 3300020580 | Soil | ATAAHEDGRLVLTVTGADPGRARDAVAGFALTIRSGPSPVAQTTAN |
Ga0213881_100115741 | 3300021374 | Exposed Rock | DARVTAAHEDGRLAVTVTGADPGRVRNAVAGFALTVRCGPSPAPQTIVK |
Ga0213874_101539511 | 3300021377 | Plant Roots | VVTVTGADPGRVRDAAAGFALTVRAEPAPAAQTAAT |
Ga0210392_103527882 | 3300021475 | Soil | ATAAHEDGRLVVTVTGADPSRVRDAVAGFALTVRCGPSSAAQTAAN |
Ga0126371_116612042 | 3300021560 | Tropical Forest Soil | ARAAAAYEDGRLVLTVTGADPDRVRDAVAGYALTVRPGPSPAPRPA |
Ga0207684_104100342 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | RLVVTVTGADPDRVRDAVAGFALTVRCGPSPSPQTAAK |
Ga0207687_102866781 | 3300025927 | Miscanthus Rhizosphere | GTQVTAAHEDGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPQIAVK |
Ga0207665_111910093 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | AGTVTADQEDGRLVVTVTGMDPELVREAVAGFALAVRVAP |
Ga0207658_103954892 | 3300025986 | Switchgrass Rhizosphere | EDGRMVLTVTGADPGRVRDAVAGFALTVRSGPPSAAQTTAN |
Ga0207698_101900952 | 3300026142 | Corn Rhizosphere | RVTAAHEDGRMVLTVTGADPGRVRDAVAGFALTVRSGPPSAAQTTANWPAEKGTRP |
Ga0207722_10248442 | 3300027003 | Tropical Forest Soil | ARAAAAHEDGRLVVTVTGADPGQARDAVAGFALTIRTGPSPAPQTTAT |
Ga0207776_10282911 | 3300027035 | Tropical Forest Soil | AHEDGRLVVTVTGADPGQAREAVAGFALTIRTGPSPASQTTAT |
Ga0207855_10234141 | 3300027039 | Tropical Forest Soil | RATAAHEDGRLVVTVTGADPGQARDALAGFAITVRSEPSSAPQTAAN |
Ga0208199_10123722 | 3300027497 | Peatlands Soil | GVADARVTAAYEDGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTSK |
Ga0208324_10030596 | 3300027604 | Peatlands Soil | EHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPQSAVN |
Ga0209178_11764802 | 3300027725 | Agricultural Soil | ALTVTGADPGRVRDAVAGFALTVRSEPSPAAQTTAN |
Ga0209328_101299052 | 3300027727 | Forest Soil | TAAHEDGRLVVTVTGTDHGRVRDAVAGFALTVRSGPPPAPQTTPK |
Ga0209274_104588932 | 3300027853 | Soil | VADARVTAAHEDGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAEQTTNK |
Ga0209517_100195438 | 3300027854 | Peatlands Soil | AYEDGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK |
Ga0209517_103860172 | 3300027854 | Peatlands Soil | LVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK |
Ga0209167_104812182 | 3300027867 | Surface Soil | EDGRLIVTVTGADPGRVRDAVAGFALTIRVETPTHQTAEH |
Ga0268265_121215731 | 3300028380 | Switchgrass Rhizosphere | DGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTAN |
Ga0268264_108817012 | 3300028381 | Switchgrass Rhizosphere | QVTAAHEDGRLVLTVTGADPDRVRDAVAGFALTVRCGPATAPQIAVK |
Ga0307280_100226191 | 3300028768 | Soil | ENGRLVLTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTNK |
Ga0310037_102048941 | 3300030494 | Peatlands Soil | GLPDARADAAYEHGRLVVTVTGADPGRVRDAVAGFALTVRSRPSPAPAN |
Ga0310037_103249421 | 3300030494 | Peatlands Soil | RATAAHEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPQSAVN |
Ga0310038_102236752 | 3300030707 | Peatlands Soil | EHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTAK |
Ga0302320_104122491 | 3300031524 | Bog | AHEHGRLVITVTGADPDRVQDAVAGFALTVRSGPSPAEQTTNK |
Ga0318573_102921511 | 3300031564 | Soil | LVRGGAGAAAAYEDGRLVLTVTGADPGHVRDAVAGYALTVRPGPSPAPRPA |
Ga0318573_107849921 | 3300031564 | Soil | PAAAHQDGRLIVTVTGADPGRVREAVAGFALTIRTGPSPAAQTAAN |
Ga0310915_101234952 | 3300031573 | Soil | ARATAAHEDGRLVVTVTGADPDRVRDAVAGFALSVRCGTSPASQTAAQ |
Ga0318542_106991771 | 3300031668 | Soil | AAHEDGRLVVTVTGADPGRVREAVAGFALTIRTGPSPAQTTAN |
Ga0310686_1043570272 | 3300031708 | Soil | SAAHEDGRLIVTVTGADPGRVRDAVAGFALTIRTGPSPAAPAAAN |
Ga0310813_105489902 | 3300031716 | Soil | RLVLTVTGADPGRVRDAVAGFALTVRSGPSPATQTTAN |
Ga0318501_102023432 | 3300031736 | Soil | RATAAHEDGRLVVTVTGADPDRVRDAVAGFALSVRCGTSPASQTAAQ |
Ga0318554_102534712 | 3300031765 | Soil | AAHEDGRLVVTVTGADPGRVRDAVAGFAVTVRCGPSPAPHTTAK |
Ga0318526_103486741 | 3300031769 | Soil | VVTVTGADPDRVRDAVAGFALSVRCGTSPASQTAAQ |
Ga0318499_104359382 | 3300031832 | Soil | AVTAAHEDGRLVVTVTGADLDRVQDAVNGFALTVRCGPLPAPQTAAN |
Ga0318551_103124672 | 3300031896 | Soil | ATAAHEDGRLVVTVTGADPGRVRDAVAGFAVTVRCGPSPAPQTTAK |
Ga0318520_103920091 | 3300031897 | Soil | GLTDAQATAAHEDGRLVVTVTGADPGRVREAVAGFALTIRTGPSPAQTTAN |
Ga0311367_112611051 | 3300031918 | Fen | QVIAAHEDGRLVLTVTGADLGRVRDAVAGFALTVRCGPATAPGSP |
Ga0306926_116439291 | 3300031954 | Soil | ARATAAHEDGRLVVTVTGADPGRVRDAVAGFAVTVRCGPSPAPHTTAK |
Ga0318562_103642742 | 3300032008 | Soil | DGRLVVTVTGADPGRVRDAVAGFAVTVRCGPSPAPHTTAK |
Ga0306924_121808901 | 3300032076 | Soil | TAAHEDGRLVVTVTGADPGRVRDAVAGFALAIRIGPSPAPQTTAT |
Ga0311301_100412929 | 3300032160 | Peatlands Soil | ARATAAHEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAPQSAVN |
Ga0311301_103148461 | 3300032160 | Peatlands Soil | IAAYEDGRLVLTVTGADSSQVRAALAGFALAVRCGPATAPRSP |
Ga0311301_124772182 | 3300032160 | Peatlands Soil | AAHEHGRLVVTVTGADPGRVRDAVAGFALTVRSGPSPAAQTTSK |
Ga0335085_103512552 | 3300032770 | Soil | TAEHEDGQLVVTVAGADPARIRDAVTGFALTVRCGPSPAPQTAAQ |
Ga0335078_124226762 | 3300032805 | Soil | GLADARVTAAYEDGRLVVTVTGADPGRVQDAVAGFALTVRSGPPPAVQTTSN |
Ga0335080_103636561 | 3300032828 | Soil | EDGRLVVTVTGADPGRVRDAVAGFTLFTLTVRSGALPAAQTTSK |
Ga0335080_110816212 | 3300032828 | Soil | PDARATAAHENGQLVITVTGADPGRVRDAVAGFTLTVRCGPPPAEQTTNK |
Ga0335081_104949912 | 3300032892 | Soil | DGRLVLTVTGADPDRVRDALAGFALTVRCGPATAPENAVR |
Ga0335083_107659841 | 3300032954 | Soil | LADPQVTAAHEDGRLVVAVTGADPGRVRDAVAGFALTVRCGPATAPENAVK |
Ga0335077_119828492 | 3300033158 | Soil | LVLTVTGADPGRARDAVAGFALTIRSGSSPAAQTTAN |
Ga0310914_106337291 | 3300033289 | Soil | GLPDARATAAHEDGRLVVTVTGADPDRVRDAVAGFALSVRCGTSPASQTAAQ |
⦗Top⦘ |