Metagenome Family F071807

Basic Information
Family ID	F071807
Family Type	Metagenome
Number of Sequences	121
Average Sequence Length	38 residues
Representative Sequence	VGLAATPSPRALGLAATPDPRALDVGLAARLCHKSVITK
Number of Associated Samples	18
Number of Associated Scaffolds	119

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	1.65 %
% of genes near scaffold ends (potentially truncated)	6.61 %
% of genes from short scaffolds (< 2000 bps)	42.15 %
Associated GOLD sequencing projects	18
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.28

Most Common Taxonomy
Group	Unclassified (61.983 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza (80.992 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (72.727 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 34.33% β-sheet: 0.00% Coil/Unstructured: 65.67%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 119 Family Scaffolds
PF00854	PTR2	3.36
PF01852	START	1.68
PF05212	DUF707	1.68
PF00967	Barwin	0.84
PF12776	Myb_DNA-bind_3	0.84
PF14244	Retrotran_gag_3	0.84
PF01459	Porin_3	0.84
PF13963	Transpos_assoc	0.84
PF03936	Terpene_synth_C	0.84
PF13976	gag_pre-integrs	0.84
PF07727	RVT_2	0.84
PF08284	RVP_2	0.84

COG ID	Name	Functional Category	% Frequency in 119 Family Scaffolds
COG3104	Dipeptide/tripeptide permease	Amino acid transport and metabolism [E]	3.36

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
All Organisms	root	All Organisms	38.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
cellular organisms	root	All Organisms → cellular organisms	38.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	35.54 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	2.48 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	33.88 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.65 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	33.88 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.65 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	33.88 %
Bacilli	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli	1.65 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	33.88 %
Lactobacillales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales	1.65 %
Chromatiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	22.31 %
Lactobacillaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae	1.65 %
Rheinheimera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	22.31 %
Weissella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	22.31 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	22.31 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	16.53 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	16.53 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	16.53 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	16.53 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	16.53 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	15.70 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Malpighiales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales	15.70 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Salicaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	15.70 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Saliceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	14.88 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Populus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	13.22 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	61.98 %
Populus trichocarpa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8.26 %
Populus euphratica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	1.65 %
Weissella confusa	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1.65 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.83 %
Populus alba	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	0.83 %
Rheinheimera tangshanensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300028786\|Ga0307517_10008996	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	14238	Open in IMG/M
3300028786\|Ga0307517_10012118	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	11876	Open in IMG/M
3300028786\|Ga0307517_10016801	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	9590	Open in IMG/M
3300028786\|Ga0307517_10028513	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae	6649	Open in IMG/M
3300028786\|Ga0307517_10030551	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	6308	Open in IMG/M
3300028786\|Ga0307517_10044403	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4701	Open in IMG/M
3300028786\|Ga0307517_10052998	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	4050	Open in IMG/M
3300028786\|Ga0307517_10055130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3910	Open in IMG/M
3300028786\|Ga0307517_10055130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3910	Open in IMG/M
3300028786\|Ga0307517_10066827	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	3301	Open in IMG/M
3300028786\|Ga0307517_10081653	Not Available	2753	Open in IMG/M
3300028786\|Ga0307517_10087595	All Organisms → cellular organisms → Eukaryota	2585	Open in IMG/M
3300028786\|Ga0307517_10144324	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1657	Open in IMG/M
3300028786\|Ga0307517_10177655	Not Available	1382	Open in IMG/M
3300028786\|Ga0307517_10207446	Not Available	1213	Open in IMG/M
3300028786\|Ga0307517_10225050	Not Available	1134	Open in IMG/M
3300028794\|Ga0307515_10012436	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16011	Open in IMG/M
3300028794\|Ga0307515_10014574	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	14554	Open in IMG/M
3300028794\|Ga0307515_10031931	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8747	Open in IMG/M
3300028794\|Ga0307515_10035470	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	8112	Open in IMG/M
3300028794\|Ga0307515_10039836	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	7455	Open in IMG/M
3300028794\|Ga0307515_10044307	Not Available	6877	Open in IMG/M
3300028794\|Ga0307515_10051919	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	6097	Open in IMG/M
3300028794\|Ga0307515_10052747	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6021	Open in IMG/M
3300028794\|Ga0307515_10063826	Not Available	5162	Open in IMG/M
3300028794\|Ga0307515_10082658	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4149	Open in IMG/M
3300028794\|Ga0307515_10098784	Not Available	3551	Open in IMG/M
3300028794\|Ga0307515_10137201	Not Available	2650	Open in IMG/M
3300028794\|Ga0307515_10168866	Not Available	2191	Open in IMG/M
3300028794\|Ga0307515_10201137	Not Available	1867	Open in IMG/M
3300028794\|Ga0307515_10493651	Not Available	835	Open in IMG/M
3300028794\|Ga0307515_10591955	Not Available	719	Open in IMG/M
3300028794\|Ga0307515_10936920	Not Available	500	Open in IMG/M
3300030521\|Ga0307511_10058626	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2973	Open in IMG/M
3300030521\|Ga0307511_10063554	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	2786	Open in IMG/M
3300030521\|Ga0307511_10092828	Not Available	2032	Open in IMG/M
3300030521\|Ga0307511_10380732	Not Available	590	Open in IMG/M
3300030521\|Ga0307511_10388204	Not Available	580	Open in IMG/M
3300030521\|Ga0307511_10409026	Not Available	554	Open in IMG/M
3300030522\|Ga0307512_10135114	Not Available	1531	Open in IMG/M
3300030522\|Ga0307512_10230100	Not Available	954	Open in IMG/M
3300030522\|Ga0307512_10230881	Not Available	951	Open in IMG/M
3300030522\|Ga0307512_10347370	Not Available	656	Open in IMG/M
3300030522\|Ga0307512_10367635	Not Available	623	Open in IMG/M
3300030522\|Ga0307512_10461015	Not Available	509	Open in IMG/M
3300031456\|Ga0307513_10028703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6355	Open in IMG/M
3300031456\|Ga0307513_10051192	All Organisms → cellular organisms → Eukaryota	4457	Open in IMG/M
3300031456\|Ga0307513_10058469	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4097	Open in IMG/M
3300031456\|Ga0307513_10060536	Not Available	4014	Open in IMG/M
3300031456\|Ga0307513_10066771	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	3777	Open in IMG/M
3300031456\|Ga0307513_10073150	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3569	Open in IMG/M
3300031456\|Ga0307513_10159983	Not Available	2146	Open in IMG/M
3300031456\|Ga0307513_10173150	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	2033	Open in IMG/M
3300031456\|Ga0307513_10203450	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1818	Open in IMG/M
3300031456\|Ga0307513_10251567	Not Available	1563	Open in IMG/M
3300031456\|Ga0307513_10259540	Not Available	1528	Open in IMG/M
3300031507\|Ga0307509_10038489	Not Available	5216	Open in IMG/M
3300031507\|Ga0307509_10049477	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus	4506	Open in IMG/M
3300031507\|Ga0307509_10136158	Not Available	2401	Open in IMG/M
3300031507\|Ga0307509_10151986	Not Available	2228	Open in IMG/M
3300031507\|Ga0307509_10160760	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2144	Open in IMG/M
3300031507\|Ga0307509_10183715	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	1952	Open in IMG/M
3300031507\|Ga0307509_10198807	Not Available	1844	Open in IMG/M
3300031507\|Ga0307509_10199587	Not Available	1839	Open in IMG/M
3300031507\|Ga0307509_10233586	Not Available	1639	Open in IMG/M
3300031507\|Ga0307509_10254852	Not Available	1535	Open in IMG/M
3300031507\|Ga0307509_10301209	Not Available	1351	Open in IMG/M
3300031507\|Ga0307509_10461396	Not Available	962	Open in IMG/M
3300031507\|Ga0307509_10588739	Not Available	786	Open in IMG/M
3300031616\|Ga0307508_10095539	Not Available	2563	Open in IMG/M
3300031616\|Ga0307508_10133742	Not Available	2083	Open in IMG/M
3300031616\|Ga0307508_10133742	Not Available	2083	Open in IMG/M
3300031616\|Ga0307508_10526907	Not Available	778	Open in IMG/M
3300031616\|Ga0307508_10694737	Not Available	626	Open in IMG/M
3300031649\|Ga0307514_10004530	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	12763	Open in IMG/M
3300031649\|Ga0307514_10131047	Not Available	1726	Open in IMG/M
3300031649\|Ga0307514_10194592	Not Available	1285	Open in IMG/M
3300031649\|Ga0307514_10278339	Not Available	960	Open in IMG/M
3300031649\|Ga0307514_10326258	Not Available	838	Open in IMG/M
3300031649\|Ga0307514_10345209	Not Available	798	Open in IMG/M
3300031649\|Ga0307514_10366695	Not Available	757	Open in IMG/M
3300031649\|Ga0307514_10554678	Not Available	529	Open in IMG/M
3300031730\|Ga0307516_10101602	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba	2691	Open in IMG/M
3300031730\|Ga0307516_10105122	Not Available	2635	Open in IMG/M
3300031730\|Ga0307516_10224991	Not Available	1583	Open in IMG/M
3300031730\|Ga0307516_10637244	Not Available	720	Open in IMG/M
3300031730\|Ga0307516_10742662	Not Available	640	Open in IMG/M
3300031838\|Ga0307518_10030713	Not Available	3892	Open in IMG/M
3300032354\|Ga0325403_1002833	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	15539	Open in IMG/M
3300032354\|Ga0325403_1002974	Not Available	15277	Open in IMG/M
3300032354\|Ga0325403_1003860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae	13785	Open in IMG/M
3300032354\|Ga0325403_1011555	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	8368	Open in IMG/M
3300032354\|Ga0325403_1023695	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5427	Open in IMG/M
3300032354\|Ga0325403_1036581	Not Available	3900	Open in IMG/M
3300032354\|Ga0325403_1042737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Rheinheimera → Rheinheimera tangshanensis	3407	Open in IMG/M
3300032354\|Ga0325403_1049326	Not Available	2970	Open in IMG/M
3300032354\|Ga0325403_1050095	Not Available	2922	Open in IMG/M
3300032354\|Ga0325403_1079008	Not Available	1694	Open in IMG/M
3300032354\|Ga0325403_1086423	Not Available	1488	Open in IMG/M
3300032354\|Ga0325403_1087121	Not Available	1469	Open in IMG/M
3300032354\|Ga0325403_1121187	Not Available	879	Open in IMG/M
3300032355\|Ga0325401_1068687	Not Available	2383	Open in IMG/M
3300032374\|Ga0325400_1111366	Not Available	1693	Open in IMG/M
3300032389\|Ga0325405_1001363	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	24769	Open in IMG/M
3300032389\|Ga0325405_1016474	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	6749	Open in IMG/M
3300032389\|Ga0325405_1040626	Not Available	3175	Open in IMG/M
3300032389\|Ga0325405_1052539	Not Available	2379	Open in IMG/M
3300032389\|Ga0325405_1071173	Not Available	1537	Open in IMG/M
3300032389\|Ga0325405_1114848	Not Available	665	Open in IMG/M
3300032735\|Ga0325410_1031930	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus euphratica	4171	Open in IMG/M
3300033160\|Ga0325402_1068614	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa	2011	Open in IMG/M
3300033179\|Ga0307507_10013007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10181	Open in IMG/M
3300033179\|Ga0307507_10036444	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	5028	Open in IMG/M
3300033179\|Ga0307507_10099575	Not Available	2441	Open in IMG/M
3300033179\|Ga0307507_10154170	Not Available	1718	Open in IMG/M
3300033179\|Ga0307507_10391734	Not Available	794	Open in IMG/M
3300033180\|Ga0307510_10041070	Not Available	5065	Open in IMG/M
3300033180\|Ga0307510_10059530	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3942	Open in IMG/M
3300033180\|Ga0307510_10137097	Not Available	2101	Open in IMG/M
3300033180\|Ga0307510_10173455	Not Available	1731	Open in IMG/M
3300033180\|Ga0307510_10481005	Not Available	683	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Roots	Host-Associated → Plants → Roots	80.99%
Wood	Host-Associated → Plants → Wood	19.01%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified	80.99%
Unclassified	Host-Associated → Plants → Wood → Unclassified	19.01%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	80.99%
Unclassified	Host-Associated → Plants → Wood → Unclassified → Unclassified	19.01%

Habitat	Taxonomy	Distribution
Ectomycorrhiza	Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza	80.99%
Xylem	Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem	19.01%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Host-Associated	Open in IMG/M
3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Host-Associated	Open in IMG/M
3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Host-Associated	Open in IMG/M
3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Host-Associated	Open in IMG/M
3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Host-Associated	Open in IMG/M
3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Host-Associated	Open in IMG/M
3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Host-Associated	Open in IMG/M
3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Host-Associated	Open in IMG/M
3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Host-Associated	Open in IMG/M
3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Host-Associated	Open in IMG/M
3300032354	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4	Host-Associated	Open in IMG/M
3300032355	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2	Host-Associated	Open in IMG/M
3300032374	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1	Host-Associated	Open in IMG/M
3300032389	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2	Host-Associated	Open in IMG/M
3300032735	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R3	Host-Associated	Open in IMG/M
3300033160	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R3	Host-Associated	Open in IMG/M
3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Host-Associated	Open in IMG/M
3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0307517_100089963	3300028786	Ectomycorrhiza	MGLAATSRPRALGLAATPNPRALDVSLVVRPCHESVTTK
Ga0307517_1001211812	3300028786	Ectomycorrhiza	VVLAATLCLRALSLAATPDRRALDLGLAARSCHESLITK
Ga0307517_100168011	3300028786	Ectomycorrhiza	VDIAATRDPRVLGLAATPNPKALDVDLAARWCHESVITK
Ga0307517_100285139	3300028786	Ectomycorrhiza	VGLAATSGSRVLGLAATLDPRALDVGMAAKPCHESMITK
Ga0307517_100305513	3300028786	Ectomycorrhiza	MGLAATSGSKDLGLATTPDPRALDVDLTARSCHENVITK
Ga0307517_100444035	3300028786	Ectomycorrhiza	VNLAATPSLRALGLAAAPDPRALDVGLTARLCHKSVIIK
Ga0307517_100529984	3300028786	Ectomycorrhiza	VDLAATPSPRALGLAATSDPRALNVGFAARSCHESVITK
Ga0307517_100551305	3300028786	Ectomycorrhiza	VGLAATPSLRALGLAATPDPRALDVSLTARLCHESVITK
Ga0307517_100551306	3300028786	Ectomycorrhiza	MGLAATPGSKAFGLAATPDLRALDVGLAAGLCHESVITK
Ga0307517_100668275	3300028786	Ectomycorrhiza	VGLAVTPGSRALSLAATLDPRALKMGLTTRSCHESVITK
Ga0307517_100816533	3300028786	Ectomycorrhiza	VGLVATPGSRALGLAATLDPRALDVSLIVKPCHESVITK
Ga0307517_100875951	3300028786	Ectomycorrhiza	VGLTTTSSPRALSLAATSDPRALDVGLAIRQCHESVITK
Ga0307517_101443242	3300028786	Ectomycorrhiza	VSLTATPGPRALGLAAPPDPRALDVGRAARLCHESVITK
Ga0307517_101776552	3300028786	Ectomycorrhiza	MGLDTTPGPRALSPATTQDPRALDVGLAARSCHESVITK
Ga0307517_102074463	3300028786	Ectomycorrhiza	VGLAATPIPRALGLATTPDPRALDVDLIVKSCHESVITK
Ga0307517_102250502	3300028786	Ectomycorrhiza	VGLTATSDPRALSLAATPDPKALDVDLAVKSCHESMMTK
Ga0307515_1001243610	3300028794	Ectomycorrhiza	MAATRDPRALGLAATPNPKALDVDLAARSCHESVITK
Ga0307515_1001457411	3300028794	Ectomycorrhiza	VVLAATLCLRALSLAATPDRRALDVGLAARSCHESLITK
Ga0307515_100319318	3300028794	Ectomycorrhiza	VGLAATPIPRALGLAATPDPRALGLGLTVRSCHESVITK
Ga0307515_100354704	3300028794	Ectomycorrhiza	VDLAATPSSKVLGLAATLNPRALDVGLTARSCHESVITK
Ga0307515_100398361	3300028794	Ectomycorrhiza	MDLTATSSPRALGLTATPNPRALDLGLAAKLWHESVITK
Ga0307515_100443073	3300028794	Ectomycorrhiza	VDLAATPSTRVLGLTATPDPRAMDIGLTARSCHESVITK
Ga0307515_100519195	3300028794	Ectomycorrhiza	VSLTTTPDPKALSLAATPNPGALDVATRSCHENVITK
Ga0307515_100527475	3300028794	Ectomycorrhiza	VNLAATPSLRAFGLAAAPDPRALDVGLTARLCHKSAIIK
Ga0307515_100638261	3300028794	Ectomycorrhiza	VDLAATPSSRALSLAATLDPRALDVDLTARSSHESVITK
Ga0307515_100826582	3300028794	Ectomycorrhiza	VGLATTPSLRALGLAATPNPRALDVSLTARLCHESVITK
Ga0307515_100987842	3300028794	Ectomycorrhiza	VSLAATPGSVALGLIETLDPRALDVSLTARACHKSVITK
Ga0307515_101372011	3300028794	Ectomycorrhiza	VGLATTPGPRALGLVATPDPRALDVAARPCYESVITK
Ga0307515_101688663	3300028794	Ectomycorrhiza	MDLTATPGPKALGLAATPNPRVLDVGLTARSCHENMITK
Ga0307515_102011372	3300028794	Ectomycorrhiza	VGLAVTPGSRALSLAATPDPGALEVGLATRSYHESVITK
Ga0307515_104936511	3300028794	Ectomycorrhiza	VSLAATPSLRALSLATTLDPRAFDASLIAMPCYESVMTKLKKINIKK
Ga0307515_105919551	3300028794	Ectomycorrhiza	LPATSGPRTLGLVATPDPRALDMGLATRSCHESMITK
Ga0307515_109369201	3300028794	Ectomycorrhiza	VDLAATSSPRALGLAATPDPIALDVGLAARSCHESVITR
Ga0307511_100586263	3300030521	Ectomycorrhiza	VGLAVTPGSRALSLAATPDPRALKIGLATRSCHESVITK
Ga0307511_100635543	3300030521	Ectomycorrhiza	VGLAATPSPRALGLAATPDPRALDVGLAARLYHKSVTTK
Ga0307511_100928281	3300030521	Ectomycorrhiza	MAAKRDPIALGLAATPNPKALDVDLAARSCYESVITK
Ga0307511_103807321	3300030521	Ectomycorrhiza	MGLAVTSRPRALGLAATPNPRALDVSLVVRPCHESMTTK
Ga0307511_103882041	3300030521	Ectomycorrhiza	VGLASTPIPRALGLAATPDPRALGLGLTVRSCHESVITK
Ga0307511_104090261	3300030521	Ectomycorrhiza	DLAATPSSRVLGLAATLDPRTLDVGLTARSCHESVITK
Ga0307512_101351141	3300030522	Ectomycorrhiza	VDLVATLGSKVFGLAATPDLRALDVGLAARSCHESVITK
Ga0307512_102301002	3300030522	Ectomycorrhiza	VGLPATSGPRTLGLVATPDPRALDMGLATRSCHESMITK
Ga0307512_102308812	3300030522	Ectomycorrhiza	MGLAATSRPRALGLAATPNPRALDVSLVVRSCHESVTTK
Ga0307512_103473702	3300030522	Ectomycorrhiza	LVATPGSRALGLAATLDPRALDVSLIVKPCHESVITK
Ga0307512_103676351	3300030522	Ectomycorrhiza	LAATPGPXTFSLAATPDPRALDVDLAARPYHESVITK
Ga0307512_104610151	3300030522	Ectomycorrhiza	VDLAATPSSRALSLAATLDPRALDVDLTARSGHESVITK
Ga0307513_100287037	3300031456	Ectomycorrhiza	VDLIATSNPRALSLATTSDPRALDVGLATRSCHESVITK
Ga0307513_100511922	3300031456	Ectomycorrhiza	LHDSSLSGFAATPGPRASSLAATQDSRALNVGLAARSCHESIITK
Ga0307513_100584692	3300031456	Ectomycorrhiza	MGLTATSRPRALDLAATPNPRALDVSLVVRPCHESVTTK
Ga0307513_100605364	3300031456	Ectomycorrhiza	VGLAATPSPRALGLAATPDPRALDVGLAARLCHKSVITK
Ga0307513_100667713	3300031456	Ectomycorrhiza	MAATRDPIALGLAATPNPKALDVDLAARSCYESVITK
Ga0307513_100731501	3300031456	Ectomycorrhiza	VGLAATLGLRALGLAATPDPKAFDVSLTARLCHKSVITK
Ga0307513_101599833	3300031456	Ectomycorrhiza	VGIAVTLGSRALSLAATLDPRALEVGLATRSCHENVITK
Ga0307513_101731503	3300031456	Ectomycorrhiza	VSLTATPGPRALGLAAPPDPTALDVGRAARLCHESVITK
Ga0307513_102034503	3300031456	Ectomycorrhiza	VDLAATSSPRALGLAATPDPIALDVSLAARSCHESVITR
Ga0307513_102515672	3300031456	Ectomycorrhiza	VGLAATSIPRALGLAATPDPRALGLGLTVRSCHESVITK
Ga0307513_102595402	3300031456	Ectomycorrhiza	VGLATTSGARALSLAATSDPRALDVGLTIRQCHESVITK
Ga0307509_100384891	3300031507	Ectomycorrhiza	VDLAATPSSRALGLAATLDPRTLDVGLTARSCHESVITK
Ga0307509_100494771	3300031507	Ectomycorrhiza	VSLTATPGPRALGLTAPPDPRALDVGRAARLCHESVITK
Ga0307509_101361581	3300031507	Ectomycorrhiza	VGLAVTSGSRALSLAATPDPGALEVGLATRSYHESVITK
Ga0307509_101519862	3300031507	Ectomycorrhiza	VGLTTISGSRALSLAATSDPRALDVGLAIRQCHESVITK
Ga0307509_101607601	3300031507	Ectomycorrhiza	VGLAATRGLRALGLAATPDPKAFDVSLTARLCHKSVITK
Ga0307509_101837153	3300031507	Ectomycorrhiza	VGLAATPSPRALGPDPRALDVGLAARSCHKSVTTK
Ga0307509_101988073	3300031507	Ectomycorrhiza	VSLTTTPDPKALSLAATPNPRALDVATRSCHENVITK
Ga0307509_101995872	3300031507	Ectomycorrhiza	VSLAATPGSVALGLIETLDPRALDVSLTARACHKSMITK
Ga0307509_102335861	3300031507	Ectomycorrhiza	MGLAATPGSKDLGLATTPDPRALDVDLTARSCHENVITK
Ga0307509_102548522	3300031507	Ectomycorrhiza	VGLTVTPGSRALSLAATLDPRALKMGLTTRSCHESVITK
Ga0307509_103012091	3300031507	Ectomycorrhiza	VGLAATPSPRALGLAATPDPRALDVGLAARLCHKSVTTK
Ga0307509_104613961	3300031507	Ectomycorrhiza	VGLAATPCSKAFGLAATPDLRALDVGLAARLCHENVISK
Ga0307509_105887391	3300031507	Ectomycorrhiza	MAAKRDPRALGLAATPNPKALDVDLAARSCHESVITK
Ga0307508_100955391	3300031616	Ectomycorrhiza	VDLAATPSPRVLGLTATPDPRAMDIGLTARSCHESVITK
Ga0307508_101337421	3300031616	Ectomycorrhiza	VDLVATLGSKAFGLATTPDLRALDVGLAARSYHESMITK
Ga0307508_101337422	3300031616	Ectomycorrhiza	VGLAATIGLRALGLAATPDPKAFDVSLTARLCHKSVITK
Ga0307508_105269071	3300031616	Ectomycorrhiza	VGLAATPDSVALGLLETLDPRALDVSLTARPCYKSVITK
Ga0307508_106947371	3300031616	Ectomycorrhiza	AATSGSKDLGLATTPDPRALDVDLTARSCHENVITK
Ga0307514_100045307	3300031649	Ectomycorrhiza	VGLTATPSPRALGLAATPDPRALNVGLAARLCHKSVTTK
Ga0307514_101310474	3300031649	Ectomycorrhiza	VGLAVTPGSRALSLAATPDPRALEIGLATRSCHESVM
Ga0307514_101945921	3300031649	Ectomycorrhiza	VGLPATSGPRTLGLVATPDPRALDVGLATRSCHESMITK
Ga0307514_102783391	3300031649	Ectomycorrhiza	VGLAATPCSKAFGLAATPDLRALDVGLAARLCHENVITK
Ga0307514_103262581	3300031649	Ectomycorrhiza	VDLTATLGLRALGLAATPDPRAFDVSLTARLCHKSVITK
Ga0307514_103452091	3300031649	Ectomycorrhiza	VGLAVTPSSRALSLAATPDPRALEVGLATRSCHESVITK
Ga0307514_103666951	3300031649	Ectomycorrhiza	VDVAATLGPIALGPAVTLDPRVLDVDLTVRSCHESVITK
Ga0307514_105546781	3300031649	Ectomycorrhiza	VSLTATPGPRALGLAAPPDPRALDVGRAAKLCHESVITK
Ga0307516_101016021	3300031730	Ectomycorrhiza	MGLAATPIPRALGLATTPDPRALDVGLTVRLCHESVITK
Ga0307516_101051221	3300031730	Ectomycorrhiza	VDLTATPSPRALGLAATPNPRALDVGLTAESCHESVITK
Ga0307516_102249912	3300031730	Ectomycorrhiza	VGLVATPSSRALGLAATLDPRALDVSLIVKPCHESVITK
Ga0307516_106372441	3300031730	Ectomycorrhiza	VDLAATPSSRALGLAATLDPRTLDVGLTARSCHESVITKYKKN
Ga0307516_107426622	3300031730	Ectomycorrhiza	VGLATTPSLRALGLAATPNPRALDVSLTARLYHESVITK
Ga0307518_100307133	3300031838	Ectomycorrhiza	VDLTTTPSPKALGLVATPDPRALDVGLATRSCHESVITK
Ga0325403_10028331	3300032354	Xylem	VCLAATPGSKAFGLAATPDLRALDVGLAVRLCYESVITK
Ga0325403_10029748	3300032354	Xylem	VDVAAMSGLRALGLAVTLDPRVLDVDLTAKLCHESVITK
Ga0325403_10038606	3300032354	Xylem	VDLTVTLSLRALGLTATPDPRALDVGLAARSYHKSVIAK
Ga0325403_10115558	3300032354	Xylem	VDLAATSGPRALSLAATSDPRALDVGLAVRQCHESVITK
Ga0325403_10236951	3300032354	Xylem	MSLAATPGPKALGLATMPGPRALDLGLTARLCHENVITK
Ga0325403_10365812	3300032354	Xylem	LHDSSLNGFAATPGSRASSLAATQDPGALNVGLVARSCHESVITK
Ga0325403_10427372	3300032354	Xylem	VVLAAILCLRALSLAATPDRRALDVGLAARSCHESLITK
Ga0325403_10493262	3300032354	Xylem	VGLAAIPSPRALGLAATPDPRALDVGLAARLCHKSMTTK
Ga0325403_10500951	3300032354	Xylem	VGLAATPSPRALGLAATPDPRALDVGLAARLYHKSVITK
Ga0325403_10790081	3300032354	Xylem	VGLTATSGPRALGLAATPDPRALDVGLAARSCHESMITK
Ga0325403_10864232	3300032354	Xylem	VSLAATPSSVALGLIETPDPRTLDVSLTARPHHKKVITK
Ga0325403_10871211	3300032354	Xylem	VSLAATPGSVALGLIETPDPKTLDVSLTARPHHKKVITK
Ga0325403_11211871	3300032354	Xylem	VDLAATPCPRAVGLAVTPDPRALDVDLAARSCHENVITK
Ga0325401_10686871	3300032355	Xylem	VSLFAMPGPRALGLTAISDSRALDVSLVARSCHESVITK
Ga0325400_11113663	3300032374	Xylem	VGLTATSGPRALGLAATPDPRALDVGLAARPCHESMITK
Ga0325405_10013633	3300032389	Xylem	VDLAATPCPRAVGLAVTPNPRALDVDLAARSCHENVITK
Ga0325405_10164747	3300032389	Xylem	VNLAATPNPRALGLATTPDPRALDVGLVARSCNENMINK
Ga0325405_10406261	3300032389	Xylem	VNLAVTPCPKAVGLAATLDPRALDVDLATRSCHENMITK
Ga0325405_10525393	3300032389	Xylem	MSLAATSGPKALNLITTPDPRALDVGLTARLCHKNVITK
Ga0325405_10711731	3300032389	Xylem	VGLAATPSLRVLGLASTPDPRALDVSLTVRLCHESVITK
Ga0325405_11148481	3300032389	Xylem	VCLAATSGSKTFGLAATPDLRALDVGLAVKLCYESVITK
Ga0325410_10319301	3300032735	Xylem	MSLAATSGPKALNLVTTPDPRALDVGLTARLCHKNVITK
Ga0325402_10686141	3300033160	Xylem	DLAITSGSRALCLAATPEPRVLNVSLAARSCHESVINK
Ga0307507_100130072	3300033179	Ectomycorrhiza	VDIAATRDPRALGLAATPNPKALDVDLAARWCHESVITK
Ga0307507_100364445	3300033179	Ectomycorrhiza	VGLAATSGSRVLGLAATLDPRALDVGLAAKPCHESMITK
Ga0307507_100995753	3300033179	Ectomycorrhiza	VGLAVTPGSRALSLAATPDPRALEIGLATRSCHESVITK
Ga0307507_101541702	3300033179	Ectomycorrhiza	VGLVTTPSLKASGLATTPNPRALDVSLTARLCHESVITK
Ga0307507_103917341	3300033179	Ectomycorrhiza	GLATTSGSVALGLIETRDQRALDVSLTARPCHKSVITK
Ga0307510_100410701	3300033180	Ectomycorrhiza	VDLAATPSSRVLGLAATLDPRTLDVGLTARSCHESVITK
Ga0307510_100595301	3300033180	Ectomycorrhiza	VDIAATRDPRALGLAATPNPKALDVDLAARWCHESV
Ga0307510_101370972	3300033180	Ectomycorrhiza	MGLAATLGSKDLGLATTPDPRALDVDLTARSCHENVITK
Ga0307510_101734551	3300033180	Ectomycorrhiza	VSLAATSDPRALSLAATPDPKALDVDLAVKSCHESMMTK
Ga0307510_104810052	3300033180	Ectomycorrhiza	VGLTTISGPRALSLAATSDPRALDVGLAIRQCHESVITK

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.28
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.28
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F071807

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign