Metagenome Family F072067

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F072067
Family Type	Metagenome
Number of Sequences	121
Average Sequence Length	43 residues
Representative Sequence	MTSNYALERSVRGSSERAAGAQTIIAPAARVSRLARPAQRGR
Number of Associated Samples	73
Number of Associated Scaffolds	119

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	47.50 %
% of genes near scaffold ends (potentially truncated)	60.33 %
% of genes from short scaffolds (< 2000 bps)	76.86 %
Associated GOLD sequencing projects	69
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (55.372 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.570 % of family members)
Environment Ontology (ENVO)	Unclassified (33.058 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (24.793 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.35
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 119 Family Scaffolds
PF01381	HTH_3	5.88
PF04365	BrnT_toxin	2.52
PF05016	ParE_toxin	2.52
PF14384	BrnA_antitoxin	2.52
PF05973	Gp49	2.52
PF03473	MOSC	1.68
PF01872	RibD_C	1.68
PF12973	Cupin_7	0.84
PF03734	YkuD	0.84
PF10675	DUF2489	0.84
PF10861	DUF2784	0.84
PF14119	DUF4288	0.84
PF11746	DUF3303	0.84
PF03703	bPH_2	0.84
PF00583	Acetyltransf_1	0.84
PF07007	LprI	0.84
PF05901	Excalibur	0.84
PF06271	RDD	0.84
PF14078	DUF4259	0.84
PF09951	DUF2185	0.84
PF16826	DUF5076	0.84
PF03500	Cellsynth_D	0.84
PF01551	Peptidase_M23	0.84
PF09720	Unstab_antitox	0.84
PF06315	AceK_kinase	0.84
PF04828	GFA	0.84
PF08974	DUF1877	0.84
PF07087	DUF1353	0.84
PF00753	Lactamase_B	0.84
PF02810	SEC-C	0.84
PF11342	DUF3144	0.84
PF03061	4HBT	0.84

COG ID	Name	Functional Category	% Frequency in 119 Family Scaffolds
COG2929	Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system	Defense mechanisms [V]	2.52
COG3657	Putative component of the toxin-antitoxin plasmid stabilization module	Defense mechanisms [V]	2.52
COG4679	Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system	Defense mechanisms [V]	2.52
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	1.68
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	1.68
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.84
COG1714	Uncharacterized membrane protein YckC, RDD family	Function unknown [S]	0.84
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.84
COG3402	Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain	Function unknown [S]	0.84
COG3428	Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain	Function unknown [S]	0.84
COG3755	Uncharacterized conserved protein YecT, DUF1311 family	Function unknown [S]	0.84
COG3791	Uncharacterized conserved protein	Function unknown [S]	0.84
COG4579	Isocitrate dehydrogenase kinase/phosphatase	Signal transduction mechanisms [T]	0.84

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	55.37 %
Unclassified	root	N/A	44.63 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	55.37 %
Unclassified	root	N/A	44.63 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	55.37 %
Unclassified	root	N/A	44.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.63 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	28.10 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	1.65 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.65 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.63 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	9.92 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4.13 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	1.65 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.83 %
bacterium BMS3Abin06	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Abin06	0.83 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.83 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.63 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2.48 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	2.48 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.65 %
Nevskiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales	1.65 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.83 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.83 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.83 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.83 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.83 %
bacterium BMS3Abin06	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Abin06	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.63 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1.65 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.65 %
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	0.83 %
Synechococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales	0.83 %
Woeseiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae	0.83 %
Rhodovibrionaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae	0.83 %
Steroidobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae	0.83 %
Sinobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae	0.83 %
Methylophilaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae	0.83 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	0.83 %
Gallionellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae	0.83 %
Nitrosomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.83 %
bacterium BMS3Abin06	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Abin06	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.63 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.65 %
Pelagibius	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Pelagibius	0.83 %
Woeseia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia	0.83 %
Prochlorococcaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae	0.83 %
Steroidobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter	0.83 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.83 %
Polaromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas	0.83 %
Nitrosospira	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira	0.83 %
Solimonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas	0.83 %
Methylotenera	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera	0.83 %
Sideroxydans	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Sideroxydans	0.83 %
Lysobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.83 %
bacterium BMS3Abin06	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Abin06	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.63 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.65 %
Woeseia oceani	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani	0.83 %
Pelagibius marinus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Pelagibius → Pelagibius marinus	0.83 %
unclassified Methylotenera	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → unclassified Methylotenera	0.83 %
unclassified Polaromonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas	0.83 %
unclassified Nitrosospira	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira	0.83 %
Lysobacter silvisoli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter silvisoli	0.83 %
Sideroxydans lithotrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Sideroxydans → Sideroxydans lithotrophicus	0.83 %
Solimonas soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas → Solimonas soli	0.83 %
Steroidobacter agariperforans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agariperforans	0.83 %
Cyanobium	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	0.83 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.83 %
bacterium BMS3Abin06	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Abin06	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.63 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.65 %
Nitrosospira sp. Nsp18	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp. Nsp18	0.83 %
Polaromonas sp. 28-63-22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. 28-63-22	0.83 %
unclassified Cyanobium	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium	0.83 %
Methylotenera sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → unclassified Methylotenera → Methylotenera sp.	0.83 %
Woeseia oceani	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani	0.83 %
Pelagibius marinus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Pelagibius → Pelagibius marinus	0.83 %
Lysobacter silvisoli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter silvisoli	0.83 %
Sideroxydans lithotrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Sideroxydans → Sideroxydans lithotrophicus	0.83 %
Solimonas soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas → Solimonas soli	0.83 %
Steroidobacter agariperforans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agariperforans	0.83 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.83 %
bacterium BMS3Abin06	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Abin06	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.63 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1.65 %
Cyanobium sp.	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp.	0.83 %
Nitrosospira sp. Nsp18	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp. Nsp18	0.83 %
Polaromonas sp. 28-63-22	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. 28-63-22	0.83 %
Methylotenera sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → unclassified Methylotenera → Methylotenera sp.	0.83 %
Woeseia oceani	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani	0.83 %
Pelagibius marinus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Pelagibius → Pelagibius marinus	0.83 %
Lysobacter silvisoli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter silvisoli	0.83 %
Sideroxydans lithotrophicus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Sideroxydans → Sideroxydans lithotrophicus	0.83 %
Solimonas soli	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas → Solimonas soli	0.83 %
Steroidobacter agariperforans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agariperforans	0.83 %
Rhodanobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	0.83 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.83 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.83 %
bacterium BMS3Abin06	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Abin06	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000363\|ICChiseqgaiiFebDRAFT_14388979	All Organisms → cellular organisms → Bacteria	1839	Open in IMG/M
3300000956\|JGI10216J12902_102753823	All Organisms → cellular organisms → Bacteria	724	Open in IMG/M
3300000956\|JGI10216J12902_104035533	All Organisms → cellular organisms → Bacteria → Proteobacteria	2108	Open in IMG/M
3300003990\|Ga0055455_10160011	Not Available	692	Open in IMG/M
3300004006\|Ga0055453_10183136	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Sideroxydans → Sideroxydans lithotrophicus	652	Open in IMG/M
3300004013\|Ga0055465_10026028	Not Available	1401	Open in IMG/M
3300004022\|Ga0055432_10159343	All Organisms → cellular organisms → Bacteria	631	Open in IMG/M
3300004022\|Ga0055432_10239105	Not Available	532	Open in IMG/M
3300004024\|Ga0055436_10320194	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300004025\|Ga0055433_10090471	All Organisms → cellular organisms → Bacteria	683	Open in IMG/M
3300004052\|Ga0055490_10070599	All Organisms → cellular organisms → Bacteria	946	Open in IMG/M
3300004114\|Ga0062593_100243949	All Organisms → cellular organisms → Bacteria	1477	Open in IMG/M
3300004114\|Ga0062593_100428577	Not Available	1195	Open in IMG/M
3300004156\|Ga0062589_100021038	All Organisms → cellular organisms → Bacteria	3084	Open in IMG/M
3300004156\|Ga0062589_100021038	All Organisms → cellular organisms → Bacteria	3084	Open in IMG/M
3300004156\|Ga0062589_101256915	Not Available	712	Open in IMG/M
3300004157\|Ga0062590_101225805	Not Available	733	Open in IMG/M
3300004463\|Ga0063356_102213254	Not Available	837	Open in IMG/M
3300004463\|Ga0063356_102356870	Not Available	813	Open in IMG/M
3300004463\|Ga0063356_102537615	Not Available	786	Open in IMG/M
3300004463\|Ga0063356_103045000	Not Available	722	Open in IMG/M
3300004463\|Ga0063356_103458537	Not Available	680	Open in IMG/M
3300004463\|Ga0063356_103571847	Not Available	670	Open in IMG/M
3300004463\|Ga0063356_104133170	Not Available	625	Open in IMG/M
3300004463\|Ga0063356_105148162	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter	562	Open in IMG/M
3300004463\|Ga0063356_105500100	Not Available	544	Open in IMG/M
3300004479\|Ga0062595_101417032	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium BMS3Abin06	634	Open in IMG/M
3300005183\|Ga0068993_10195839	Not Available	701	Open in IMG/M
3300005459\|Ga0068867_101880914	Not Available	564	Open in IMG/M
3300005543\|Ga0070672_100722122	All Organisms → cellular organisms → Bacteria → Proteobacteria	873	Open in IMG/M
3300006845\|Ga0075421_100035074	All Organisms → cellular organisms → Bacteria → Proteobacteria	6351	Open in IMG/M
3300006846\|Ga0075430_101519319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. 28-63-22	550	Open in IMG/M
3300006852\|Ga0075433_11483669	Not Available	586	Open in IMG/M
3300006871\|Ga0075434_102522719	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp.	515	Open in IMG/M
3300006918\|Ga0079216_10361711	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	892	Open in IMG/M
3300007004\|Ga0079218_10010641	All Organisms → cellular organisms → Bacteria → Proteobacteria	4520	Open in IMG/M
3300007004\|Ga0079218_10019579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3648	Open in IMG/M
3300007004\|Ga0079218_10360061	All Organisms → cellular organisms → Bacteria → Proteobacteria	1217	Open in IMG/M
3300007004\|Ga0079218_10633930	All Organisms → cellular organisms → Bacteria → Proteobacteria	985	Open in IMG/M
3300007004\|Ga0079218_11120575	All Organisms → cellular organisms → Bacteria	805	Open in IMG/M
3300009087\|Ga0105107_10985030	Not Available	587	Open in IMG/M
3300009610\|Ga0105340_1004663	All Organisms → cellular organisms → Bacteria → Proteobacteria	5650	Open in IMG/M
3300009678\|Ga0105252_10002278	All Organisms → cellular organisms → Bacteria	7896	Open in IMG/M
3300009870\|Ga0131092_10428868	Not Available	1218	Open in IMG/M
3300009870\|Ga0131092_10573917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	992	Open in IMG/M
3300009870\|Ga0131092_11503784	Not Available	510	Open in IMG/M
3300009873\|Ga0131077_10043172	All Organisms → cellular organisms → Bacteria	6545	Open in IMG/M
3300009873\|Ga0131077_10066447	All Organisms → cellular organisms → Bacteria	7508	Open in IMG/M
3300009873\|Ga0131077_11522368	Not Available	549	Open in IMG/M
3300010362\|Ga0126377_10354107	Not Available	1466	Open in IMG/M
3300010362\|Ga0126377_10447417	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1313	Open in IMG/M
3300010362\|Ga0126377_11086180	All Organisms → cellular organisms → Bacteria	868	Open in IMG/M
3300010362\|Ga0126377_11373510	Not Available	779	Open in IMG/M
3300010362\|Ga0126377_12295319	Not Available	616	Open in IMG/M
3300010362\|Ga0126377_12895984	Not Available	554	Open in IMG/M
3300010362\|Ga0126377_13269989	All Organisms → cellular organisms → Bacteria	524	Open in IMG/M
3300011405\|Ga0137340_1010163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter agariperforans	1690	Open in IMG/M
3300011420\|Ga0137314_1086307	Not Available	767	Open in IMG/M
3300011435\|Ga0137426_1081102	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	893	Open in IMG/M
3300012133\|Ga0137329_1058815	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300012173\|Ga0137327_1115074	All Organisms → cellular organisms → Bacteria → Proteobacteria	596	Open in IMG/M
3300012179\|Ga0137334_1000717	All Organisms → cellular organisms → Bacteria	5804	Open in IMG/M
3300012225\|Ga0137434_1012391	Not Available	1009	Open in IMG/M
3300014296\|Ga0075344_1134390	All Organisms → cellular organisms → Bacteria → Proteobacteria	535	Open in IMG/M
3300014299\|Ga0075303_1024290	Not Available	912	Open in IMG/M
3300014299\|Ga0075303_1130502	Not Available	518	Open in IMG/M
3300014312\|Ga0075345_1088808	Not Available	685	Open in IMG/M
3300014876\|Ga0180064_1037507	All Organisms → cellular organisms → Bacteria	953	Open in IMG/M
3300018084\|Ga0184629_10176279	Not Available	1096	Open in IMG/M
3300018429\|Ga0190272_10396911	All Organisms → cellular organisms → Bacteria	1124	Open in IMG/M
3300018429\|Ga0190272_11542354	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Solimonas → Solimonas soli	678	Open in IMG/M
3300018429\|Ga0190272_12754481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp. Nsp18	541	Open in IMG/M
3300018481\|Ga0190271_12371563	All Organisms → cellular organisms → Bacteria	634	Open in IMG/M
3300019356\|Ga0173481_10622684	Not Available	571	Open in IMG/M
3300019360\|Ga0187894_10473377	Not Available	547	Open in IMG/M
3300019458\|Ga0187892_10014928	Not Available	8557	Open in IMG/M
3300019458\|Ga0187892_10014928	Not Available	8557	Open in IMG/M
3300019458\|Ga0187892_10067429	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhodovibrionaceae → Pelagibius → Pelagibius marinus	2309	Open in IMG/M
3300019487\|Ga0187893_10240436	All Organisms → cellular organisms → Bacteria	1344	Open in IMG/M
3300019487\|Ga0187893_10241802	Not Available	1339	Open in IMG/M
3300019487\|Ga0187893_10253148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1295	Open in IMG/M
3300019487\|Ga0187893_10333130	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	1061	Open in IMG/M
3300019487\|Ga0187893_10339328	Not Available	1047	Open in IMG/M
3300019487\|Ga0187893_10405127	Not Available	922	Open in IMG/M
3300019487\|Ga0187893_10481459	Not Available	815	Open in IMG/M
3300019487\|Ga0187893_10518469	All Organisms → cellular organisms → Bacteria	773	Open in IMG/M
3300019487\|Ga0187893_10581280	Not Available	714	Open in IMG/M
3300019487\|Ga0187893_10760657	Not Available	592	Open in IMG/M
3300020221\|Ga0194127_10788766	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300022204\|Ga0224496_10003900	All Organisms → cellular organisms → Bacteria	8501	Open in IMG/M
3300022214\|Ga0224505_10000593	All Organisms → cellular organisms → Bacteria → Proteobacteria	24451	Open in IMG/M
3300025106\|Ga0209398_1011462	All Organisms → cellular organisms → Bacteria → Proteobacteria	2905	Open in IMG/M
3300027362\|Ga0208320_1000897	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → unclassified Methylotenera → Methylotenera sp.	3557	Open in IMG/M
3300027513\|Ga0208685_1003817	All Organisms → cellular organisms → Bacteria → Proteobacteria	4368	Open in IMG/M
3300027533\|Ga0208185_1006191	All Organisms → cellular organisms → Bacteria → Proteobacteria	3014	Open in IMG/M
3300027573\|Ga0208454_1001244	All Organisms → cellular organisms → Bacteria → Proteobacteria	10781	Open in IMG/M
3300027717\|Ga0209998_10113512	All Organisms → cellular organisms → Bacteria	678	Open in IMG/M
3300027886\|Ga0209486_10035200	All Organisms → cellular organisms → Bacteria → Proteobacteria	2435	Open in IMG/M
3300027886\|Ga0209486_10753780	Not Available	633	Open in IMG/M
3300027907\|Ga0207428_11087945	Not Available	559	Open in IMG/M
3300028648\|Ga0268299_1003964	All Organisms → cellular organisms → Bacteria → Proteobacteria	12479	Open in IMG/M
3300028648\|Ga0268299_1012219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Woeseiaceae → Woeseia → Woeseia oceani	4095	Open in IMG/M
3300028648\|Ga0268299_1014564	All Organisms → cellular organisms → Bacteria	3520	Open in IMG/M
3300030606\|Ga0299906_10962241	Not Available	626	Open in IMG/M
3300030620\|Ga0302046_10433459	Not Available	1079	Open in IMG/M
3300030620\|Ga0302046_10650966	All Organisms → cellular organisms → Bacteria	856	Open in IMG/M
3300030620\|Ga0302046_11260708	Not Available	579	Open in IMG/M
3300031455\|Ga0307505_10035245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → Lysobacter silvisoli	2252	Open in IMG/M
3300031576\|Ga0247727_10560529	Not Available	869	Open in IMG/M
3300031731\|Ga0307405_10554126	Not Available	931	Open in IMG/M
3300031858\|Ga0310892_10347535	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	951	Open in IMG/M
3300031995\|Ga0307409_102726457	Not Available	522	Open in IMG/M
3300032002\|Ga0307416_100178786	Not Available	1986	Open in IMG/M
3300032017\|Ga0310899_10040077	All Organisms → cellular organisms → Bacteria	1657	Open in IMG/M
3300032144\|Ga0315910_10166326	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1646	Open in IMG/M
3300032144\|Ga0315910_10390544	Not Available	1065	Open in IMG/M
3300032157\|Ga0315912_10043976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3548	Open in IMG/M
3300032157\|Ga0315912_10888730	Not Available	708	Open in IMG/M
3300034169\|Ga0370480_0279979	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	561	Open in IMG/M
3300034194\|Ga0370499_0130234	Not Available	644	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	75.21%
Host-Associated	Host-Associated	17.36%
Engineered	Engineered	7.44%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	51.24%
Aquatic	Environmental → Aquatic	23.97%
Plants	Host-Associated → Plants	17.36%
Wastewater	Engineered → Wastewater	7.44%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	38.84%
Sediment	Environmental → Aquatic → Sediment	12.40%
Cave	Environmental → Terrestrial → Cave	12.40%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.92%
Marine	Environmental → Aquatic → Marine	9.09%
Rhizosphere	Host-Associated → Plants → Rhizosphere	7.44%
Activated Sludge	Engineered → Wastewater → Activated Sludge	7.44%
Freshwater	Environmental → Aquatic → Freshwater	2.48%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	33.88%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	12.40%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	12.40%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	9.92%
Wetlands	Environmental → Aquatic → Marine → Wetlands	7.44%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	7.44%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	6.61%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	4.96%
Sediment	Environmental → Aquatic → Marine → Sediment	1.65%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.83%
Lake	Environmental → Aquatic → Freshwater → Lake	0.83%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.83%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	17.36%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	12.40%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	12.40%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	12.40%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	9.92%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	7.44%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	7.44%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	6.61%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.96%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.48%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	1.65%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.65%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.83%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	11.57%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	11.57%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	9.09%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	9.09%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	7.44%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	6.61%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	5.79%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	5.79%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	4.96%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.13%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	3.31%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.48%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	2.48%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	2.48%
Wastewater	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater	2.48%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	1.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.65%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.65%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.83%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.83%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	0.83%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.83%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.83%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000363	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300003990	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2	Environmental	Open in IMG/M
3300004006	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2	Environmental	Open in IMG/M
3300004013	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2	Environmental	Open in IMG/M
3300004022	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1	Environmental	Open in IMG/M
3300004024	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2	Environmental	Open in IMG/M
3300004025	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1	Environmental	Open in IMG/M
3300004052	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D2	Environmental	Open in IMG/M
3300004114	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005183	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1	Environmental	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009610	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700	Environmental	Open in IMG/M
3300009678	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100	Environmental	Open in IMG/M
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered	Open in IMG/M
3300009873	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant	Engineered	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300011405	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2	Environmental	Open in IMG/M
3300011420	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2	Environmental	Open in IMG/M
3300011435	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2	Environmental	Open in IMG/M
3300012133	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2	Environmental	Open in IMG/M
3300012173	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2	Environmental	Open in IMG/M
3300012179	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2	Environmental	Open in IMG/M
3300012225	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2	Environmental	Open in IMG/M
3300014296	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1	Environmental	Open in IMG/M
3300014299	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1	Environmental	Open in IMG/M
3300014312	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1	Environmental	Open in IMG/M
3300014876	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019360	White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300019487	White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG	Environmental	Open in IMG/M
3300020221	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m	Environmental	Open in IMG/M
3300022204	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1	Environmental	Open in IMG/M
3300022214	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1	Environmental	Open in IMG/M
3300025106	Groundwater microbial communities from Big Spring, Nevada to study Microbial Dark Matter (Phase II) - Ash Meadows Big Spring (SPAdes)	Environmental	Open in IMG/M
3300027362	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 (SPAdes)	Environmental	Open in IMG/M
3300027513	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)	Environmental	Open in IMG/M
3300027533	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)	Environmental	Open in IMG/M
3300027573	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)	Environmental	Open in IMG/M
3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028648	Activated sludge microbial communities from bioreactor in Nijmegen, Gelderland, Netherland - NOB reactor	Engineered	Open in IMG/M
3300030606	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125	Environmental	Open in IMG/M
3300030620	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111	Environmental	Open in IMG/M
3300031455	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S	Environmental	Open in IMG/M
3300031576	Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25	Environmental	Open in IMG/M
3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Host-Associated	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032017	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4	Environmental	Open in IMG/M
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M
3300034169	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15	Environmental	Open in IMG/M
3300034194	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
ICChiseqgaiiFebDRAFT_143889795	3300000363	Soil	MSETSNYALERLVMAWQGRAAGAGTIIAPAARGPGFLRPAQRGR*
JGI10216J12902_1027538231	3300000956	Soil	MPNYALERSVKGWWGRAAGAQTIIAPAARVSRLARPAQ
JGI10216J12902_1040355334	3300000956	Soil	MGVVMPNYTLERAVTCSSERAAGARTIMAPAAPGECLARPAQRGR*
Ga0055455_101600112	3300003990	Natural And Restored Wetlands	MSRLPNYALERSVRGSSERAAGAQTIIAPAARVSRLARPAQRG
Ga0055453_101831363	3300004006	Natural And Restored Wetlands	MTAIQFATSNYALERAVKSWSERTAGAQKIIAPAARRPGSAAAAQRGR*
Ga0055465_100260281	3300004013	Natural And Restored Wetlands	MSNYALERTVKSPSKRAAGAQKIIAPAARRSGSCPAAQRGR*
Ga0055432_101593432	3300004022	Natural And Restored Wetlands	NYALERSVKSWSERAAGARTIIAPAARWLRSCAAAQRGRWA*
Ga0055432_102391051	3300004022	Natural And Restored Wetlands	MPNYALERSVKGLGERAAGARNIVAPAARVSRVARPAQRGR*
Ga0055436_103201941	3300004024	Natural And Restored Wetlands	PLDRASGASGITGLMPNYALERSVKSSSERAAGAQKIIAPAARWPGSRAAAQRGR*
Ga0055433_100904712	3300004025	Natural And Restored Wetlands	MMPNYALERPVRSSSERAAGAQNIIAPAARWPGSRAAAQRGR*
Ga0055490_100705991	3300004052	Natural And Restored Wetlands	MPPELPNYALERSVTALSERAAGAQRDFTPAARWNSLARP
Ga0062593_1002439491	3300004114	Soil	SNYALERSVTALSERAAGAQKIVLPAARVSRLARPAQRGR*
Ga0062593_1004285773	3300004114	Soil	MTRRAAYGVTPNYALERSVTALSVRAAGARRDFAPTARWRHITRPAQRGR*
Ga0062589_1000210383	3300004156	Soil	MTRRAAYGVTPNYALERSVTALSVRAAGACRDFAPTARWRHITRPARRGR*
Ga0062589_1000210385	3300004156	Soil	VSLQSNYALERSVTALSERAAGAQKIVLPAARVSRLARPAQRGR*
Ga0062589_1012569152	3300004156	Soil	MGWLPNYALERSVTGFSERAAGARINIAPAARRPRCARPDQRGRLAADCARDN*
Ga0062590_1012258051	3300004157	Soil	MGWLPNYALERSVTGFSERAAGARINIAPAARRPRCARPDQRGRLAAD
Ga0063356_1022132541	3300004463	Arabidopsis Thaliana Rhizosphere	AMTPNYALERSETGSNERAAGAQKIIAPAARGNGPARPAQRGRLAP*
Ga0063356_1023568702	3300004463	Arabidopsis Thaliana Rhizosphere	MMWPNYALESVKGFGWRAAGAPEEFAAAARWLRLARPAQRGR*
Ga0063356_1025376153	3300004463	Arabidopsis Thaliana Rhizosphere	VLRSNYALERSVRGLSERAAGARTIFAPAARRPCLARPAQRGRWA
Ga0063356_1030450002	3300004463	Arabidopsis Thaliana Rhizosphere	TPNYALERAVRALSERTAGARRDFTPAARWPRLALPAQRGR*
Ga0063356_1034585372	3300004463	Arabidopsis Thaliana Rhizosphere	MIAAPPNNALERSVRGLQERAAGARTIIAPAARVSRLTRPAQRERWASIS
Ga0063356_1035718472	3300004463	Arabidopsis Thaliana Rhizosphere	MPSNYALERAVGALSERAVRVQNDSTLAARRLRVARPAQRGR*
Ga0063356_1041331702	3300004463	Arabidopsis Thaliana Rhizosphere	MTPNNALERSVMGLKERAAGAQKIIAPAAHIGRLARPAQRGR
Ga0063356_1051481621	3300004463	Arabidopsis Thaliana Rhizosphere	MKPNYALERAAKACGWRAAGAQNIIAPAARWLRLARPAQRGRWASL*
Ga0063356_1055001002	3300004463	Arabidopsis Thaliana Rhizosphere	MFLAVTTLLPNNALERSVRGFSERAAGARTIVAPAARVSRLARP
Ga0062595_1014170322	3300004479	Soil	MSSNYALERSEKESRKRAAGARNIVAPAARVSRLARPAQRGR*
Ga0068993_101958391	3300005183	Natural And Restored Wetlands	RAVVTPNYALERSVKSSSKRAAGARKIIAPGARLPRLARPAQRGR*
Ga0068867_1018809141	3300005459	Miscanthus Rhizosphere	MVRPNYALERSVKGSSERAAGARTIIAPAARGPRLARPAQRGR
Ga0070672_1007221223	3300005543	Miscanthus Rhizosphere	RSVRGSSERAAGALEIVALAAPIGGEPRPAQRGR*
Ga0075421_10003507410	3300006845	Populus Rhizosphere	MPARLPNYALERSVTRWLWRAAGARTIIAPAARWPRLARPAQRGR*
Ga0075430_1015193192	3300006846	Populus Rhizosphere	MPSNYALERSVVGSSKRAAGARKIIAFAARILRLARPAQRGR*
Ga0075433_114836692	3300006852	Populus Rhizosphere	MLPNYALERSVTDSSERAAGAQTIITPAARRPRCARPAQR
Ga0075434_1025227192	3300006871	Populus Rhizosphere	MLPNYALERSVTSLSERATGAQTITAPAARRPRCAR
Ga0079216_103617112	3300006918	Agricultural Soil	MDARSNYALERSVTGWIKRAAGARAMIAPAARIMRRARPAQRGR*
Ga0079218_100106414	3300007004	Agricultural Soil	MMPNYALERSVTAWSERAAGAPEKFALAARWFGLARPAQRGR*
Ga0079218_100195793	3300007004	Agricultural Soil	MDARSNYALERSVTGWIKRAAGARAMIAPAARIMRRTRPAQRGR*
Ga0079218_103600613	3300007004	Agricultural Soil	MMPNYALELSVTGFSERAAGAQTIIAPAARRSGWPQPAKRGR*
Ga0079218_106339304	3300007004	Agricultural Soil	LERSVRALSERAAGAQNIIAPAARWPRLARPAQRGR*
Ga0079218_111205753	3300007004	Agricultural Soil	MRSNYALERSVTGSSERAAGAQTIIAPAARRPRLAR
Ga0105107_109850301	3300009087	Freshwater Sediment	MRSNYALERSVKGSSERAAGAQTIVAPAARRPRLAR
Ga0105340_100466311	3300009610	Soil	MPPNNALERSVTALSERAAGARTIVAPAVRRPRTARPAQRGR*
Ga0105252_100022781	3300009678	Soil	PNYALERAVRALSERAAGAPEEFAPATRCNGLARPAQRGR*
Ga0131092_104288681	3300009870	Activated Sludge	CGFQLAMTPNYALERAVKSRSERAAGARTIIAPAARRPRSAAAAQRGR*
Ga0131092_105739173	3300009870	Activated Sludge	MTPNYALERAVKSWSERAAGAQKIIAPAARWPRSAAAAQRGR*
Ga0131092_115037841	3300009870	Activated Sludge	NYALERSVKSWSERAAGAQKIIAPAARRPGSAAAAQRGR*
Ga0131077_1004317212	3300009873	Wastewater	MLPNFALERSGTALSVRAAVALAILAPAARWPRRARPAQRGR*
Ga0131077_100664472	3300009873	Wastewater	MDLALGLAPPNYALERSVTRSSMRAAGAQKIIAPAARFSRRARPAQRGR*
Ga0131077_115223681	3300009873	Wastewater	VTSNYALERSVRALSERAAGARTIIAPAARWPRLARPAQ
Ga0126377_103541074	3300010362	Tropical Forest Soil	GITGLMPNYALERSGTALSERAAGAQEIIAPAARRPRLARPAQRGR*
Ga0126377_104474174	3300010362	Tropical Forest Soil	MTANYALERSLKGLWERAAGARKIIVPAARRPRPARP
Ga0126377_110861804	3300010362	Tropical Forest Soil	NYALERSGTALSERAARVRNDFTLAARRPRGARPAQRGR*
Ga0126377_113735101	3300010362	Tropical Forest Soil	ALERSVTALSLRAAGARKIIAPAARGPRFTRPAQRGR*
Ga0126377_122953191	3300010362	Tropical Forest Soil	MLPNYALERSGTALSLRAAGARNIIAPAARCPGCARTAQ
Ga0126377_128959841	3300010362	Tropical Forest Soil	SNYALERSVTALSQRAAGAQKIIAPAARRPRRARPAQRGR*
Ga0126377_132699892	3300010362	Tropical Forest Soil	MTDLTSNYALERSGTALSERAAGARKIIAPAARGPGCARTAQRG
Ga0137340_10101634	3300011405	Soil	VVRMRPNNALERSVKDCGWRAAGARTIIAPAARQMRFVRPAQ
Ga0137314_10863071	3300011420	Soil	MPPNNALERSVTALSERAAGARTIVAPAVRRPRTARPAQR
Ga0137426_10811021	3300011435	Soil	GIVVEMGVWSNYALERSVRAVSERAAAARRHFTPAARWPRIVRPAQRGR*
Ga0137329_10588152	3300012133	Soil	ALERAVRALSERAAGAPEEFAPATRCNGLARPAQRGR*
Ga0137327_11150742	3300012173	Soil	SNYALERSVTGFRERAAGARTIIAPTTRRPRLARPAQRGR*
Ga0137334_100071712	3300012179	Soil	MTNCLLSNYALERSVTALSERAAGAWTIVAPAARRPRFARPAQRGR*
Ga0137434_10123914	3300012225	Soil	VPPNYALERAVRALSERAAGAPEEFAPATRCNGLARPAQRGR*
Ga0075344_11343901	3300014296	Natural And Restored Wetlands	VTSNYALERSVTGSSERAAGARKEFTPAARWNSFARPAQRGR
Ga0075303_10242903	3300014299	Natural And Restored Wetlands	SNYALERAVKSWSERAAGARRDFTPAARWNGLARPAQRGR*
Ga0075303_11305022	3300014299	Natural And Restored Wetlands	ALERSVTALSERAAGAPEEFAPAARWNGLARPAQRGR*
Ga0075345_10888081	3300014312	Natural And Restored Wetlands	LPNNALERPVNGHPLCAAGAQTIIAPAALGKGLARPAQRGR*
Ga0180064_10375071	3300014876	Soil	IKMPNYALERSVTGFSERAAGAQTIIAPAARRPRLARPAQRGR*
Ga0184629_101762792	3300018084	Groundwater Sediment	MRCHKMFELRSNYALERSVKGLSVRAAGARNHYAPAARWLRLARPAQRGR
Ga0190272_103969112	3300018429	Soil	MQIYARACSNNALERSVTGLSEGTAGARTIIAHAARVMRLARPAQRGR
Ga0190272_115423541	3300018429	Soil	MRPNNALERSVKGQSERAAGAQTIIAPAARWLRLARPAQRGR
Ga0190272_127544812	3300018429	Soil	LLSTENRLHLVYEFASSNNALERSVTGLSERAAGAQTIIAPAARWFGLARPAQRGR
Ga0190271_123715631	3300018481	Soil	MNPMSVWSNYAFERSVRGLSERAAGAQTIIAPAARWFGLARPAQRG
Ga0173481_106226842	3300019356	Soil	VSLQSNYALERSVTALSERAAGAQKIVLPAARVSRLARPAQRGR
Ga0187894_104733771	3300019360	Microbial Mat On Rocks	MDNVSGASGITGLMPNYALERSVTALSKRAAGAQIIIIAPAARWPRIARPAQRGL
Ga0187892_100149281	3300019458	Bio-Ooze	MAVARLMSNYALERSVKSWGRRAAGARTIFAPAARYPRSTAAAQRGR
Ga0187892_1001492816	3300019458	Bio-Ooze	MGTIAPPNYALERSVRDWSERAAGARTIIAPAARVVRLARSAQRGR
Ga0187892_100674296	3300019458	Bio-Ooze	SNYALERSVTQLSERAAGARKIIAPAVRCPGCARTAQRGR
Ga0187893_102404361	3300019487	Microbial Mat On Rocks	MNACNEQLPNYALERTVIALSERAAGALTIIAPAARWPRIARPAQRGR
Ga0187893_102418022	3300019487	Microbial Mat On Rocks	MRSNYAFERSVKGWSERAAGAPTIIAPAARRLRCTAAAQRER
Ga0187893_102531482	3300019487	Microbial Mat On Rocks	MMPNYAFERSVTRMSLRAAGAQAIFAPAARWPRLARPAQRGR
Ga0187893_103331302	3300019487	Microbial Mat On Rocks	MSNYALERSVRDWSERAAGARTIIAPAARRPGCARPAQRGR
Ga0187893_103393281	3300019487	Microbial Mat On Rocks	TFLSESGMSFGIVPSNYALERSVTQLSERAAGARKIIAPAVRCPGCARTAQRGR
Ga0187893_104051273	3300019487	Microbial Mat On Rocks	MPNYAFERSVTRMSLRAAGARTIIAPAARRPRFARTAQRGRYAAL
Ga0187893_104814591	3300019487	Microbial Mat On Rocks	NYAFERSVTGLLERAAGVQYDFTPAARRPRFARPAQRGR
Ga0187893_105184692	3300019487	Microbial Mat On Rocks	NYALERSVTALSKRAAGAQKIIAPAARRPRFARPAQRGR
Ga0187893_105812801	3300019487	Microbial Mat On Rocks	SNYALERSVKSWSERAAGARTIIAPAARRQSFAQPAQRKR
Ga0187893_107606572	3300019487	Microbial Mat On Rocks	TFLSESGMSFGIVPSNYALERSVTQLSERAAGARKIIAPAARRRGRARSAQRGR
Ga0194127_107887662	3300020221	Freshwater Lake	PNYALERTVKGSSKRAAGAPEEFAPAARWNGLARPAQRGR
Ga0224496_100039003	3300022204	Sediment	MPNNALERTVRSWSEHAAGARTIFAPAARVSRLARPAQRGRYTPPKLFLNA
Ga0224505_1000059330	3300022214	Sediment	VMPNNALERTVRSWSEHAAGARTIFAPAARVSRLARPAQRGRYTPPKLFLNA
Ga0209398_10114624	3300025106	Groundwater	MLPNFALERSGTALSVRAAVALEILAPAARWPRRARPAQRGR
Ga0208320_10008974	3300027362	Soil	MSNYALERSVRDSSERAAGAQTIIAPAARRPGCARPAQRGR
Ga0208685_10038179	3300027513	Soil	MTNCLLSNYALERSVTALSERAAGAWTIVAPAARRPRFARPAQRGR
Ga0208185_10061918	3300027533	Soil	NYALERAVRALSERAAGAPEEFAPATRCNGLARPAQRGR
Ga0208454_100124421	3300027573	Soil	MPPNNALERSVTALSERAAGARTIVAPAVRRPRTARPAQRGR
Ga0209971_11530281	3300027682	Arabidopsis Thaliana Rhizosphere	MSNYALERSMTGSAVGAAGAPEIIAPAAPAIRRAR
Ga0209998_101135122	3300027717	Arabidopsis Thaliana Rhizosphere	MSETSNYALERLVMAWQGRAAGAGTIIAPAARGPGFPRPAQRER
Ga0209486_100352006	3300027886	Agricultural Soil	MMPNYALELSVTGFSERAVGAQTIIAPAARRSGWPQPAKRGR
Ga0209486_107537802	3300027886	Agricultural Soil	VPPNYALERSVRGWSERAAGAQTIIAPAARRPGCARPAQRGR
Ga0207428_110879451	3300027907	Populus Rhizosphere	MPARLPNYALERSVTRWLWRAAGARTIIAPAARWPRLA
Ga0268299_100396413	3300028648	Activated Sludge	MPNYALERAVRALSERAAGAQKIVAPAARWPRVARPAQRGR
Ga0268299_10122193	3300028648	Activated Sludge	MNAMRSNYALERAVRALSERAAGAQKIVAPAARRPRVARPAQRGR
Ga0268299_10145641	3300028648	Activated Sludge	PNYALERSVKALSERAAGAPEKFAPAARWPRYARPAQRGR
Ga0299906_109622411	3300030606	Soil	MQSNYALERSVKGLSERAAGAQTIIAPAARWLRLARPA
Ga0302046_104334593	3300030620	Soil	MQSNYALERSVKGLSERAAGAQTIIAPAARWLRLARPAQRG
Ga0302046_106509661	3300030620	Soil	PNYALERAVKGSSERAAGARTIFAPAARRLRLARPAQRGR
Ga0302046_112607081	3300030620	Soil	MTPNYALERSVRGSSERATGARTIFAPAARWNGLAR
Ga0307505_100352454	3300031455	Soil	MDLISNYALERPVKGLCERAAGARTIIAPAARRSFCARTAQRGR
Ga0247727_105605293	3300031576	Biofilm	ESTFTLIVTTMTSNYALERSVKGFRERAAGAQTIIAPAARQPGCARPAQRGR
Ga0307405_105541263	3300031731	Rhizosphere	TNLEGHPSQMMPNYALERAVKGSRERAAGARKIIAPAARGPGCDRPAQRGR
Ga0310892_103475353	3300031858	Soil	PNYALERAVRALSERAAGAPEEFAPAARWPRCARPAQRGR
Ga0307409_1027264571	3300031995	Rhizosphere	NYALVRSVCGFRERAAGARTIIAPAARWPRIARPAQRGR
Ga0307416_1001787862	3300032002	Rhizosphere	MKLRTPNYALERSVKRLHERAAGAQKIIAPAARRPRFARTAQRGR
Ga0310899_100400774	3300032017	Soil	ERAVKGCGWRAAGAPEEFAPVARWPRLARPAQRGR
Ga0315910_101663261	3300032144	Soil	MTSNYALERSVRGSSERAAGAQTIIAPAARVSRLARPAQRGR
Ga0315910_103905442	3300032144	Soil	MVMSNYALERSVTGFRERAAGAQKIIAPAARVSRRARPAQRGR
Ga0315912_100439763	3300032157	Soil	MSNYALERSVRGLCERAAGAQTIIAPAARVSRLARPAQRGR
Ga0315912_108887301	3300032157	Soil	SQLNQGNDPLATSNYALERTVKGLCERAAGAQTIIAPAARCPRLARPAQRGR
Ga0370480_0279979_425_559	3300034169	Untreated Peat Soil	MKTVRSNVMTSNYALERSVKTCGSRAAGARSDFTPAARLPRLARP
Ga0370499_0130234_3_110	3300034194	Untreated Peat Soil	MPNYALERSVKGCGWRAAGAQKILSPAARCNGLARP

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F072067

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences