NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F072085

Metagenome Family F072085

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072085
Family Type Metagenome
Number of Sequences 121
Average Sequence Length 45 residues
Representative Sequence LKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARLVMPALR
Number of Associated Samples 112
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.17 %
% of genes from short scaffolds (< 2000 bps) 88.43 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.893 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.264 % of family members)
Environment Ontology (ENVO) Unclassified
(28.099 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(33.058 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.48%    β-sheet: 0.00%    Coil/Unstructured: 53.52%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF01916DS 12.40
PF01625PMSR 11.57
PF09084NMT1 4.13
PF01717Meth_synt_2 3.31
PF09601DUF2459 2.48
PF03795YCII 2.48
PF02775TPP_enzyme_C 2.48
PF028262-Hacid_dh_C 1.65
PF03401TctC 0.83
PF13531SBP_bac_11 0.83
PF07355GRDB 0.83
PF04909Amidohydro_2 0.83
PF02913FAD-oxidase_C 0.83
PF00378ECH_1 0.83
PF13683rve_3 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG1899Deoxyhypusine synthaseTranslation, ribosomal structure and biogenesis [J] 12.40
COG0225Peptide methionine sulfoxide reductase MsrAPosttranslational modification, protein turnover, chaperones [O] 11.57
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.13
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 4.13
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 3.31
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 2.48
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.83
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.89 %
UnclassifiedrootN/A47.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_24790Not Available1286Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101848750All Organisms → cellular organisms → Bacteria1191Open in IMG/M
3300000579|AP72_2010_repI_A01DRAFT_1070539All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300000597|AF_2010_repII_A1DRAFT_10151122All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10071365All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium750Open in IMG/M
3300000891|JGI10214J12806_10143539Not Available710Open in IMG/M
3300000955|JGI1027J12803_103087574All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300003997|Ga0055466_10104794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium772Open in IMG/M
3300004019|Ga0055439_10197061All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300004057|Ga0055496_10029564All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300004463|Ga0063356_100619305Not Available1468Open in IMG/M
3300004463|Ga0063356_102068471All Organisms → cellular organisms → Bacteria863Open in IMG/M
3300004463|Ga0063356_102175261Not Available844Open in IMG/M
3300004480|Ga0062592_101304301All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300004808|Ga0062381_10244850All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300005218|Ga0068996_10104054All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300005290|Ga0065712_10001717All Organisms → cellular organisms → Bacteria6631Open in IMG/M
3300005332|Ga0066388_101938626All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300005347|Ga0070668_100064177All Organisms → cellular organisms → Bacteria2847Open in IMG/M
3300005445|Ga0070708_101846154All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300005445|Ga0070708_102223465All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005457|Ga0070662_101029646All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300005459|Ga0068867_100535701All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300005713|Ga0066905_100479504All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300005713|Ga0066905_102293520All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300005719|Ga0068861_100826879Not Available871Open in IMG/M
3300005764|Ga0066903_103591288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium835Open in IMG/M
3300005764|Ga0066903_104354297All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300005840|Ga0068870_11019500All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005879|Ga0075295_1027885Not Available694Open in IMG/M
3300005885|Ga0075284_1059314All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300005887|Ga0075292_1001426All Organisms → cellular organisms → Bacteria2978Open in IMG/M
3300005981|Ga0081538_10299007All Organisms → cellular organisms → Bacteria → Proteobacteria592Open in IMG/M
3300006806|Ga0079220_10925709All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300006844|Ga0075428_100556833All Organisms → cellular organisms → Bacteria1226Open in IMG/M
3300006852|Ga0075433_10108120All Organisms → cellular organisms → Bacteria2467Open in IMG/M
3300006854|Ga0075425_100550693All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1328Open in IMG/M
3300006894|Ga0079215_11515507All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300009111|Ga0115026_11347880Not Available588Open in IMG/M
3300009156|Ga0111538_10153432All Organisms → cellular organisms → Bacteria2926Open in IMG/M
3300009156|Ga0111538_13193637Not Available571Open in IMG/M
3300009162|Ga0075423_10062188Not Available3865Open in IMG/M
3300009162|Ga0075423_11392016Not Available751Open in IMG/M
3300009609|Ga0105347_1406422Not Available586Open in IMG/M
3300009777|Ga0105164_10034551All Organisms → cellular organisms → Bacteria2767Open in IMG/M
3300009820|Ga0105085_1060149All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300010043|Ga0126380_10103920All Organisms → cellular organisms → Bacteria1712Open in IMG/M
3300010043|Ga0126380_10373005All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella gemina1048Open in IMG/M
3300010047|Ga0126382_12543204Not Available500Open in IMG/M
3300010304|Ga0134088_10077514Not Available1550Open in IMG/M
3300010362|Ga0126377_11479221Not Available753Open in IMG/M
3300010398|Ga0126383_12016379Not Available664Open in IMG/M
3300011420|Ga0137314_1152320Not Available564Open in IMG/M
3300011439|Ga0137432_1024456All Organisms → cellular organisms → Bacteria1755Open in IMG/M
3300012034|Ga0137453_1017812Not Available1099Open in IMG/M
3300012133|Ga0137329_1041800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300012189|Ga0137388_10775924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium889Open in IMG/M
3300012208|Ga0137376_10186067All Organisms → cellular organisms → Bacteria1794Open in IMG/M
3300012209|Ga0137379_11537283Not Available566Open in IMG/M
3300012210|Ga0137378_10162473All Organisms → cellular organisms → Bacteria2073Open in IMG/M
3300012350|Ga0137372_10502590Not Available902Open in IMG/M
3300012493|Ga0157355_1040223Not Available521Open in IMG/M
3300012911|Ga0157301_10095248Not Available865Open in IMG/M
3300012930|Ga0137407_10144212All Organisms → cellular organisms → Bacteria2097Open in IMG/M
3300012931|Ga0153915_11013191All Organisms → cellular organisms → Bacteria → Proteobacteria967Open in IMG/M
3300012931|Ga0153915_13334849All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300012948|Ga0126375_10423687All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium969Open in IMG/M
3300013306|Ga0163162_10153518All Organisms → cellular organisms → Bacteria2421Open in IMG/M
3300014154|Ga0134075_10231195Not Available798Open in IMG/M
3300014254|Ga0075312_1000399All Organisms → cellular organisms → Bacteria6453Open in IMG/M
3300014255|Ga0075320_1039126Not Available827Open in IMG/M
3300014497|Ga0182008_10387503Not Available748Open in IMG/M
3300014968|Ga0157379_10627909Not Available1004Open in IMG/M
3300015373|Ga0132257_100316393Not Available1879Open in IMG/M
3300015374|Ga0132255_101474162Not Available1029Open in IMG/M
3300017936|Ga0187821_10516546Not Available500Open in IMG/M
3300018000|Ga0184604_10002211All Organisms → cellular organisms → Bacteria3033Open in IMG/M
3300018028|Ga0184608_10020255All Organisms → cellular organisms → Bacteria2406Open in IMG/M
3300018052|Ga0184638_1218691All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300018056|Ga0184623_10327548Not Available689Open in IMG/M
3300018072|Ga0184635_10042613All Organisms → cellular organisms → Bacteria1738Open in IMG/M
3300018081|Ga0184625_10266170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria897Open in IMG/M
3300018089|Ga0187774_10491222Not Available771Open in IMG/M
3300018422|Ga0190265_12633807All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → Steroidobacter → Steroidobacter soli600Open in IMG/M
3300018920|Ga0190273_11986850Not Available538Open in IMG/M
3300019377|Ga0190264_11835235Not Available547Open in IMG/M
3300021063|Ga0206227_1107282All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300021081|Ga0210379_10557037All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300021344|Ga0193719_10169358Not Available939Open in IMG/M
3300025537|Ga0210061_1005419Not Available1999Open in IMG/M
3300025550|Ga0210098_1027368Not Available883Open in IMG/M
3300025558|Ga0210139_1083231All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300025911|Ga0207654_10486366Not Available870Open in IMG/M
3300025930|Ga0207701_11056691Not Available674Open in IMG/M
3300025931|Ga0207644_11136204Not Available656Open in IMG/M
3300026118|Ga0207675_100889516Not Available906Open in IMG/M
3300026536|Ga0209058_1095942Not Available1514Open in IMG/M
3300027252|Ga0209973_1055412Not Available603Open in IMG/M
3300027543|Ga0209999_1040270Not Available875Open in IMG/M
3300027778|Ga0209464_10065074Not Available1215Open in IMG/M
3300027831|Ga0209797_10228771Not Available785Open in IMG/M
3300027874|Ga0209465_10119858All Organisms → cellular organisms → Bacteria1297Open in IMG/M
(restricted) 3300028043|Ga0233417_10659431Not Available502Open in IMG/M
3300028802|Ga0307503_10333869Not Available772Open in IMG/M
3300030006|Ga0299907_10662587All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300030620|Ga0302046_10224542Not Available1545Open in IMG/M
3300031229|Ga0299913_11392394All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium657Open in IMG/M
(restricted) 3300031248|Ga0255312_1202896Not Available501Open in IMG/M
3300031740|Ga0307468_100710532All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium842Open in IMG/M
3300031744|Ga0306918_10402873Not Available1066Open in IMG/M
3300031820|Ga0307473_10916731All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium634Open in IMG/M
3300032012|Ga0310902_11192852Not Available536Open in IMG/M
3300032017|Ga0310899_10239022Not Available821Open in IMG/M
3300032075|Ga0310890_10641835Not Available826Open in IMG/M
3300032157|Ga0315912_10131156Not Available1964Open in IMG/M
3300033412|Ga0310810_10053642All Organisms → cellular organisms → Bacteria4904Open in IMG/M
3300033414|Ga0316619_11895822Not Available541Open in IMG/M
3300033486|Ga0316624_11701603Not Available582Open in IMG/M
3300034147|Ga0364925_0104650Not Available1006Open in IMG/M
3300034178|Ga0364934_0344807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300034820|Ga0373959_0027176Not Available1135Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.26%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.13%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere4.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.31%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.48%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.48%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.48%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.65%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.65%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.65%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.65%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.65%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.65%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.65%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.83%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.83%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.83%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.83%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.83%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.83%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.83%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.83%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000579Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01EnvironmentalOpen in IMG/M
3300000597Forest soil microbial communities from Amazon forest - 2010 replicate II A1EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004057Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005879Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301EnvironmentalOpen in IMG/M
3300005885Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401EnvironmentalOpen in IMG/M
3300005887Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403EnvironmentalOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300009820Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012133Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT121_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012493Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014254Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2EnvironmentalOpen in IMG/M
3300014255Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2EnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017936Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300025537Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025550Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028043 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MGEnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031248 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_034428902199352025SoilVVGTTHVGLTFHFGGLSQEKVLKSMERCARLVLPELR
INPhiseqgaiiFebDRAFT_10184875013300000364SoilTTHIGLVFHFGGLSQEKVLKSMQRFARFVMPALRNT*
AP72_2010_repI_A01DRAFT_107053923300000579Forest SoilDVVGTTHIGLTFHFGGLSQDKVLKSMERFARSVMPQFR*
AF_2010_repII_A1DRAFT_1015112213300000597Forest SoilLKRIIDVVGTTHIGLTFHFGGLSQDKVLKSMERFARSVMPQFR*
AF_2010_repII_A001DRAFT_1007136533300000793Forest SoilVGTTHIGLVFHFGGLSQEKVLQSMERFARFVMPALR*
JGI10214J12806_1014353913300000891SoilILKRIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR*
JGI1027J12803_10308757413300000955SoilIIEVVGTTHIGLVFHFGGLSQEKVLKSMQRFARFVMPALRNT*
Ga0055466_1010479413300003997Natural And Restored WetlandsTQRIIETIGPTHIGLVFHFGGLTQQQVLKSMERFARVVAPALR*
Ga0055439_1019706123300004019Natural And Restored WetlandsCVKILKSIIDVVGTTHIGLVFHFGGLGQERVLKSMERFARFVMPVLKHSPA*
Ga0055496_1002956423300004057Natural And Restored WetlandsIIDTVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR*
Ga0063356_10061930523300004463Arabidopsis Thaliana RhizosphereIEVVGTTHVGLTFHFGGLSQDKVLKSMERCSDSVLPALR*
Ga0063356_10206847123300004463Arabidopsis Thaliana RhizosphereLKRISETVGTTHIGLTFHFGGLSQDKVLKSMQRCAKSVLPALR*
Ga0063356_10217526123300004463Arabidopsis Thaliana RhizosphereIEVVGTTHIGLTFHFGGLSQDKVLGSMERSARSVLPALRQH*
Ga0062592_10130430123300004480SoilRIIEVVGTTHIGLTFHFGGLSQERVLKSMDRCAKLVLPGLR*
Ga0062381_1024485013300004808Wetland SedimentSCVRILKRIIEIIGTNHIGLTFHFGGLSQDKALKSMERFAKLVMPALR*
Ga0068996_1010405413300005218Natural And Restored WetlandsGVFGGPETCARILKRIIEVVGTTHIGLTFHFGGLGQDKVLKSMERCAKLVLPALR*
Ga0065712_1000171773300005290Miscanthus RhizospherePETCVRILKRIIEIVGTSHVGLTFHFGGLSQNQVLQSMERCARAVLPAFR*
Ga0066388_10193862613300005332Tropical Forest SoilETCARILKRIIDVVGATHIGLTFHFGGLSQNKVLKSMERFARSVMPQFR*
Ga0070668_10006417713300005347Switchgrass RhizosphereIIEVVGTAHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR*
Ga0070708_10184615413300005445Corn, Switchgrass And Miscanthus RhizosphereGPTHIGLVFHFGGLSQEKVLKSMERFARSVMPALRTANS*
Ga0070708_10222346513300005445Corn, Switchgrass And Miscanthus RhizosphereGGPETCARIIKRIIEVVGTTHIGLTFHFGGLAQDKVLKSMERCAKVVLAGLR*
Ga0070662_10102964623300005457Corn RhizospherePETCVRILKRVIEVVGTTHVGLTFHFGGLSQAKVLKSMERCARLVLPALR*
Ga0068867_10053570113300005459Miscanthus RhizosphereCVRILKQIIAVMGTTHIGLTFHFGGLSQDKILKSMQRCARNVLPGLR*
Ga0066905_10047950423300005713Tropical Forest SoilTCTRILKRIIEIVGTTHIGLTFHFGGLRQDKVLKSMERFARLVMPALK*
Ga0066905_10229352023300005713Tropical Forest SoilGTTHIGLTFHFGGLSQDKVLKSMERFARSVMPQFR*
Ga0068861_10082687913300005719Switchgrass RhizosphereRILKQIIAVMGTTHIGLTFHFGGLSQDKILKSMQRCARNVLPGLR*
Ga0066903_10359128813300005764Tropical Forest SoilRIIEVVGTTHIGLVFHFGGLSQEKVLKSMERFARFVMPGLRNT*
Ga0066903_10435429713300005764Tropical Forest SoilILKRIIDVVGATHIGLTFHFGGLSQDKVLKSMERFARSVMPHFR*
Ga0068870_1101950023300005840Miscanthus RhizosphereCARILKQIIAVMGTTHIGLTFHFGGLSQDKILKSMQRCARNVLPGLR*
Ga0075295_102788513300005879Rice Paddy SoilRIIEVVGTTHIGLTFHFGGLSQDKVLDSMERCARSVLPALRQH*
Ga0075284_105931423300005885Rice Paddy SoilVFGGPQTCARILKRIIEVVGTTHIGLTFHFGGLSQDKVLDSMERCARSVLPALRQH*
Ga0075292_100142613300005887Rice Paddy SoilVVGTTHIGLTFHFGGLSQDKVLDSMERCARSVLPALRQH*
Ga0081538_1029900713300005981Tabebuia Heterophylla RhizosphereGPDTCVAVLRKIISLVGATHIGLTFHFGGLSQDKVLQSMNRFASQVKPALVT*
Ga0079220_1092570913300006806Agricultural SoilCVEILQSIREVLAPTHVGIVFHFGGLSQQKVLKSMERFARYVMPALQSN*
Ga0075428_10055683313300006844Populus RhizosphereRILKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARLVMPALK*
Ga0075433_1010812013300006852Populus RhizosphereVFGGPETCVRILKRIIDVVGTTHIGFTFHFGGLSQEKVLKSMERCARFVLPALR*
Ga0075425_10055069313300006854Populus RhizosphereTHIGLVFHFGGLSQEKVLKSMERFARSVMPALRTANS*
Ga0079215_1151550723300006894Agricultural SoilLGTTHIGLTFHFGGLNQQKVLKSMERFARQVRPALG*
Ga0115026_1134788023300009111WetlandFGGPESCVRILKRIIETVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR*
Ga0111538_1015343233300009156Populus RhizosphereILKRIIEIVGTSHVGLTFHFGGLSQNQVLQSMERCARAVLPAFR*
Ga0111538_1319363713300009156Populus RhizosphereVFGGPEACVRILKRIIETVATNHVGLTFHFGGLSQERVLGSMERCARAVLPALR*
Ga0075423_1006218813300009162Populus RhizosphereRGIFGGPETCVRILKRVIEVVGTTHVGLTFHFGGLSQEKVLKSMERCARLVLPELR*
Ga0075423_1139201623300009162Populus RhizosphereRGVFGGPETCVRILKRIIDVVGTTHIGLTFHFGGLSQEKVLKSMERCARFVLPALR*
Ga0105347_140642213300009609SoilSCVRILKRIVETVGTTHIGLTFHFGGLSQDKVLKSMERCAKLVLAGLR*
Ga0105164_1003455133300009777WastewaterIGLVFHFGGLGQDKILKSMERFARFVAPAFKEQQG*
Ga0105085_106014923300009820Groundwater SandCTRILKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARWVMPALR*
Ga0126380_1010392013300010043Tropical Forest SoilIIDVVGTTHIGLTFHFGGLRQDKVLKSMERFARLVMPALK*
Ga0126380_1037300513300010043Tropical Forest SoilPETCVRQLKRAQDILQPSHVGLVFHFGGMKQDKVLKSMERFARLVAPALR*
Ga0126382_1254320423300010047Tropical Forest SoilETCAHILKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR*
Ga0134088_1007751423300010304Grasslands SoilCVRILKRIIDVGAWSHIGLTFHFGGLSQEKVLKSMERCARLVLPALR*
Ga0126377_1147922113300010362Tropical Forest SoilLKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR*
Ga0126383_1201637913300010398Tropical Forest SoilILKRIIEIVGTTHIGLTFHFGGLRQDKVLKSMERFARLVMPALK*
Ga0137314_115232023300011420SoilVGTTHIGLTFHFGGLGQDKVLKSMERCAKLVLAGLR*
Ga0137432_102445643300011439SoilVRQIIDVVGTTHIGLTFHFGGLGQDKVLKSMERFARLVMPALK*
Ga0137453_101781223300012034SoilRILQRIIDVVGTTHIGLTFHFVGLGQDKVLKSMERCAKLVVPALRSALKS*
Ga0137329_104180013300012133SoilILRKIIDVVGVTHIGLTFHFGGLSQKKALKSMERFARQVRPAF*
Ga0137388_1077592423300012189Vadose Zone SoilGLVFHFGGLSQEKVLKSMERFARFVMPALRTANS*
Ga0137376_1018606743300012208Vadose Zone SoilLKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARLVMPALR*
Ga0137379_1153728323300012209Vadose Zone SoilVGTTHIGLTFHFGGLSQEKVLKSMERCARFVLPALR*
Ga0137378_1016247333300012210Vadose Zone SoilRMLKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARLVMPALK*
Ga0137372_1050259013300012350Vadose Zone SoilARILKRIIDVVGTTHIGLTFHFGGLSQERVLKSMERCARFVLPALR*
Ga0157355_104022313300012493Unplanted SoilETCVRILKRVIEVVGTTHVGLTFHFGGLSQAKVLKSMERCARLVLPELR*
Ga0157301_1009524813300012911SoilSCVRILKRIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR*
Ga0137407_1014421213300012930Vadose Zone SoilTCARILKRIIEVVGTTHIGLTFHFGGLSQDKVLKSMERFARLVMPALK*
Ga0153915_1101319113300012931Freshwater WetlandsRGVFGGPETCVRILKRIIEVVGPTHIGLVFHFGGLSQDKVLKSMERCARQAMPALR*
Ga0153915_1333484913300012931Freshwater WetlandsIIDTIGPTHIGLVFHFGGLSQQKVLKSMERFARVIAPTPR*
Ga0126375_1042368733300012948Tropical Forest SoilCVRILKRIIEVVGTTHIGLVFHFGGLSQEKVLKSVERFARFVMPALR*
Ga0163162_1015351833300013306Switchgrass RhizosphereLKRVIEVVGTTHVGLTFHFGGLSQAKVLKSMERCARLVLPVLR*
Ga0134075_1023119523300014154Grasslands SoilIDVVGTTHIGLTFHFGGLSQEKVLKSMERCARLVLPALR*
Ga0075312_100039913300014254Natural And Restored WetlandsTCKHILRRIGEIVGTTHVGLTFHFGGLGQDKVLRSMERCVRYVLPALR*
Ga0075320_103912623300014255Natural And Restored WetlandsGPQTCARILKRIIEVLGTTHIGLTFHFGGLSQDKVLDSMERCARSVLPALRQH*
Ga0182008_1038750313300014497RhizosphereVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR*
Ga0157379_1062790923300014968Switchgrass RhizosphereVFGGPESCVRILKRIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR*
Ga0132257_10031639323300015373Arabidopsis RhizosphereVFGGPETCVRILKRIIEIVGTSHVGLTFHFGGLSQNQVLQSMERCARAVLPAFR*
Ga0132255_10147416213300015374Arabidopsis RhizosphereCVRILKRVIEVVGTTHVGLTFHFGGLSQAKVLKSMERCSRLVLPELR*
Ga0187821_1051654623300017936Freshwater SedimentRMLKRIIEVVGTTHVGLTFHFGGLGQEKILRSMERCARAVLPVLR
Ga0184604_1000221113300018000Groundwater SedimentQIIDVVGTTHIGLTFHFGGLSQDKILKSLQRCARNVLPGLR
Ga0184608_1002025533300018028Groundwater SedimentCVRILKRIIDVVGTTHIGLTFHFGGLSQEKILRSMERCARLVLPALR
Ga0184638_121869113300018052Groundwater SedimentGPETCARILQRIIDVVGTTHIGLTFHFGGLGQDKVLKSMERCARQVLPQVR
Ga0184623_1032754813300018056Groundwater SedimentPETCARIFKRIIEVVGTTHIGLTFHFGGLGQDKVLKSMERCAKSVLVGLR
Ga0184635_1004261313300018072Groundwater SedimentIEVVGTTHIGLTFHYGGLSQDKVLKSMERFARWVMPQFR
Ga0184625_1026617013300018081Groundwater SedimentTCAQILRKIIDVIGVTHIGLTFHFGGLSQKKVLKSMERFARQVRPTF
Ga0187774_1049122223300018089Tropical PeatlandKRIIKVVGATHIGLTFHFGGLSQDKVLKSMERFARWVMPALK
Ga0190265_1263380713300018422SoilVEVVGTTHIGLTFHFGGLSQEKVLKSMERFARQVRPALG
Ga0190273_1198685013300018920SoilRILKRIVETVGTTHIGLTFHFGGLSQGKVLQSMERCAKSVLPALR
Ga0190264_1183523523300019377SoilIVEVVGTTHIGLTFHFGGLSQDKVLSSMERCARSVLPALR
Ga0206227_110728213300021063Deep Subsurface SedimentTCARILQRIIDVVRTTHIGLTFHFGGLGQDKVLKSMERCAKLVVPALRSALKS
Ga0210379_1055703713300021081Groundwater SedimentEACAKILKKIIETVGPTHIGLVFHFGGLSQDKVLKSMERCARQVMPALR
Ga0193719_1016935813300021344SoilVGTTHVGLTFHFGGLSQAKVLKSMERCARLVLPELR
Ga0210061_100541933300025537Natural And Restored WetlandsQTCARILKRIIEVVGTTHIGLTFHFGGLSQDKVLDSMERCARSVLPALRQH
Ga0210098_102736823300025550Natural And Restored WetlandsGPESCVGILKRIVDVVGTTHIGLTFHFGGLGQHKALKSIERFAKLVMPALR
Ga0210139_108323113300025558Natural And Restored WetlandsCVKILKSIIDVVGTTHIGLVFHFGGLGQERVLKSMERFARFVMPVLKHSPA
Ga0207654_1048636613300025911Corn RhizosphereFGGPESCVSILKRIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR
Ga0207701_1105669113300025930Corn, Switchgrass And Miscanthus RhizosphereKRIIEIVGAIHVGLTFHFGGLPQNRVLQSMERCARVVLPAFR
Ga0207644_1113620423300025931Switchgrass RhizosphereRIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR
Ga0207675_10088951613300026118Switchgrass RhizosphereESCVRILKRIIEVVGTTHVGLTFHFGGLSQDRVLQSMQRCAQLVLPALR
Ga0209058_109594223300026536SoilRIIDVVGTTHIGLTFHFGGLSQEKVLKSMERCARLVLPALR
Ga0209973_105541223300027252Arabidopsis Thaliana RhizosphereGVFGGPQTCARILKRIIEVVGTTHIGLTFHFGGLSQDKVLGSMERSARSVLPALRQH
Ga0209999_104027013300027543Arabidopsis Thaliana RhizosphereEVVGTTHIGLTFHFGGLSQEKVLSSMERCARSVLPALR
Ga0209464_1006507423300027778Wetland SedimentSCVRILKRIIEIIGTNHIGLTFHFGGLSQDKALKSMERFAKLVMPALR
Ga0209797_1022877123300027831Wetland SedimentETVGTDHIGLTFHFGGLSQDKVLKSMERFAESVMPALR
Ga0209465_1011985833300027874Tropical Forest SoilRIIEIVGTTHIGLTFHFGGLRQDKVLKSMERFARSVMAQFR
(restricted) Ga0233417_1065943123300028043SedimentVVGTTHIGLTFHFAGLSQDKVLKSMERCATLVLPSLR
Ga0307503_1033386923300028802SoilVRILRRIIDTVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALG
Ga0299907_1066258723300030006SoilVRILKRIIDVLRPTQIGLVFHFGGLGQDKVLRSMERFANSVAPVLR
Ga0302046_1022454223300030620SoilGPESCARILKRIIEVVGTTHIGLTFHFGGLGQDRVLKSMERCARLVLPALR
Ga0299913_1139239413300031229SoilEKIVEVVGTTHIGLTFHFGGLSQDKVLKSIERFARLVRPALGA
(restricted) Ga0255312_120289613300031248Sandy SoilCVRMLRSIIDTVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR
Ga0307468_10071053223300031740Hardwood Forest SoilGTTHIGLVFHFGGLSQKKVLKSMERFARFVMPALRTANS
Ga0306918_1040287313300031744SoilTCARILKDIIETVGTNHIGLTFHFGGLSQERVLRSMQRCARVVLPALR
Ga0307473_1091673123300031820Hardwood Forest SoilGPETCVRILKRIIEVVGTTHIGLTFHFGGLAQDKVLKSMERFARVVMPPLK
Ga0310902_1119285213300032012SoilIFGGPETCARILKRVIEVVGTTHVGLTFHFGGLSQEKVLKSMERCARLVLPELR
Ga0310899_1023902223300032017SoilTTHIGLTFHFGGLSQDKVLKSMARCSDSVLPALRSQPSRTKT
Ga0310890_1064183523300032075SoilRILKRVIEIVGASHVGLTFHFGGLPQNRVLQSMERCVRVVLPAFR
Ga0315912_1013115623300032157SoilIIDTVGTTHIGLTFHFGGLSQDKVLKSMERCAKFVLPGLR
Ga0310810_1005364213300033412SoilRGVFGGPETCVRILKRIIEIVGTSHVGLTFHFGGLSQNQVLQSMERCARAVLPAFR
Ga0316619_1189582223300033414SoilKRISETVGTTHIGLTFHFGGLSQDKVLKSMERCAKSVLPALR
Ga0316624_1170160323300033486SoilIEVVGTTHVGLTFHFGGLGQEKILRSMERCARAVLPALR
Ga0364925_0104650_13_1773300034147SedimentVFGGPASCVRILKRIVETVGTTHIGLTFHFGGLSQDKVLKSMERCAESVLPALR
Ga0364934_0344807_3_1313300034178SedimentLRKIIDLVGATHIGLTFHFGGLSQKNVLKSMERFARQVRPAF
Ga0373959_0027176_2_1363300034820Rhizosphere SoilILKRIIEVVGTTHIGLTFHFGGLGQDKVLKSMERFARSVMPALK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.