Metagenome / Metatranscriptome Family F072104

Basic Information
Family ID	F072104
Family Type	Metagenome / Metatranscriptome
Number of Sequences	121
Average Sequence Length	49 residues
Representative Sequence	VPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA
Number of Associated Samples	87
Number of Associated Scaffolds	121

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	32.77 %
% of genes near scaffold ends (potentially truncated)	77.69 %
% of genes from short scaffolds (< 2000 bps)	91.74 %
Associated GOLD sequencing projects	86
AlphaFold2 3D model prediction	No

Most Common Taxonomy
Group	Eukaryota (85.124 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (45.454 % of family members)
Environment Ontology (ENVO)	Unclassified (70.248 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (56.198 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 4.08% β-sheet: 0.00% Coil/Unstructured: 95.92%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 121 Family Scaffolds
PF00665	rve	4.96
PF03732	Retrotrans_gag	1.65
PF10536	PMD	0.83
PF13960	DUF4218	0.83
PF04398	DUF538	0.83
PF13963	Transpos_assoc	0.83

COG ID	Name	Functional Category	% Frequency in 121 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	4.96
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	4.96
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	4.96
COG4584	Transposase	Mobilome: prophages, transposons [X]	4.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	85.95 %
Unclassified	root	N/A	14.05 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	85.12 %
Unclassified	root	N/A	14.05 %
Viruses	superkingdom	All Organisms → Viruses	0.83 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	85.12 %
Unclassified	root	N/A	14.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	85.12 %
Unclassified	root	N/A	14.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	85.12 %
Unclassified	root	N/A	14.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	83.47 %
Unclassified	root	N/A	14.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	83.47 %
Unclassified	root	N/A	14.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	38.84 %
Unclassified	root	N/A	14.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	38.84 %
Unclassified	root	N/A	14.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	38.84 %
Unclassified	root	N/A	14.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	38.84 %
Unclassified	root	N/A	14.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	38.84 %
Unclassified	root	N/A	14.05 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	37.19 %
Unclassified	root	N/A	14.05 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	1.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	37.19 %
Unclassified	root	N/A	14.05 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	1.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	37.19 %
Unclassified	root	N/A	14.05 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	1.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	37.19 %
Unclassified	root	N/A	14.05 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	1.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	37.19 %
Unclassified	root	N/A	14.05 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	1.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	26.45 %
Unclassified	root	N/A	14.05 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	6.61 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	1.65 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	25.62 %
Unclassified	root	N/A	14.05 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	6.61 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	1.65 %
Chloridoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.05 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	6.61 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	3.31 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	1.65 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	0.83 %
Eragrostideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.05 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	6.61 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	3.31 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	1.65 %
Eragrostidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae	0.83 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.05 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	6.61 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	3.31 %
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	1.65 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	0.83 %
Eragrostis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.05 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	3.31 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	1.65 %
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	1.65 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.83 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.05 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	2.48 %
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	1.65 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	1.65 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.83 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.05 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2.48 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	1.65 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	1.65 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.83 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.05 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2.48 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	1.65 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	1.65 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.83 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	14.05 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2.48 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	1.65 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	1.65 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.83 %
Eragrostis curvula	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	0.83 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004480\|Ga0062592_102451374	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	524	Open in IMG/M
3300005335\|Ga0070666_11093826	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	592	Open in IMG/M
3300005338\|Ga0068868_100042135	Not Available	3561	Open in IMG/M
3300005344\|Ga0070661_101662426	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	540	Open in IMG/M
3300005366\|Ga0070659_101364802	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	629	Open in IMG/M
3300005367\|Ga0070667_101360925	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	665	Open in IMG/M
3300005367\|Ga0070667_102082588	Not Available	534	Open in IMG/M
3300005531\|Ga0070738_10374105	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	570	Open in IMG/M
3300005537\|Ga0070730_10878791	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	562	Open in IMG/M
3300005564\|Ga0070664_101431393	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	653	Open in IMG/M
3300005617\|Ga0068859_103002721	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	515	Open in IMG/M
3300005841\|Ga0068863_101759422	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	629	Open in IMG/M
3300005843\|Ga0068860_102229552	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	568	Open in IMG/M
3300005843\|Ga0068860_102855166	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	500	Open in IMG/M
3300006804\|Ga0079221_10487091	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	796	Open in IMG/M
3300009972\|Ga0105137_106938	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	583	Open in IMG/M
3300009975\|Ga0105129_103353	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	850	Open in IMG/M
3300009976\|Ga0105128_101430	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	1104	Open in IMG/M
3300009976\|Ga0105128_104784	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	791	Open in IMG/M
3300009980\|Ga0105135_108221	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	757	Open in IMG/M
3300009980\|Ga0105135_111428	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	690	Open in IMG/M
3300009980\|Ga0105135_113469	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	658	Open in IMG/M
3300009981\|Ga0105133_129822	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	516	Open in IMG/M
3300009985\|Ga0105036_119670	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	605	Open in IMG/M
3300009994\|Ga0105126_1005802	Not Available	1056	Open in IMG/M
3300010371\|Ga0134125_12016122	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	627	Open in IMG/M
3300010397\|Ga0134124_11705838	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	662	Open in IMG/M
3300010399\|Ga0134127_12993269	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	551	Open in IMG/M
3300010401\|Ga0134121_10174466	Not Available	1846	Open in IMG/M
3300012949\|Ga0153798_10144154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	963	Open in IMG/M
3300013000\|Ga0157360_1188328	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	667	Open in IMG/M
3300013000\|Ga0157360_1313721	Not Available	507	Open in IMG/M
3300014968\|Ga0157379_11493865	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	657	Open in IMG/M
3300015270\|Ga0182183_1075918	Not Available	542	Open in IMG/M
3300015278\|Ga0182099_1054256	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	551	Open in IMG/M
3300015288\|Ga0182173_1000036	Not Available	5631	Open in IMG/M
3300015305\|Ga0182158_1000043	Not Available	5851	Open in IMG/M
3300015309\|Ga0182098_1073694	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	612	Open in IMG/M
3300015311\|Ga0182182_1054797	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	670	Open in IMG/M
3300015311\|Ga0182182_1087829	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	568	Open in IMG/M
3300015311\|Ga0182182_1093213	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	556	Open in IMG/M
3300015315\|Ga0182120_1038646	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	805	Open in IMG/M
3300015315\|Ga0182120_1116264	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	540	Open in IMG/M
3300015316\|Ga0182121_1020253	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1032	Open in IMG/M
3300015317\|Ga0182136_1114718	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	546	Open in IMG/M
3300015319\|Ga0182130_1076084	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	626	Open in IMG/M
3300015324\|Ga0182134_1122072	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	543	Open in IMG/M
3300015327\|Ga0182114_1105916	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	601	Open in IMG/M
3300015327\|Ga0182114_1159116	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	506	Open in IMG/M
3300015328\|Ga0182153_1023443	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	973	Open in IMG/M
3300015328\|Ga0182153_1039578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	824	Open in IMG/M
3300015328\|Ga0182153_1049816	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	762	Open in IMG/M
3300015328\|Ga0182153_1056730	Not Available	729	Open in IMG/M
3300015330\|Ga0182152_1140898	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	523	Open in IMG/M
3300015330\|Ga0182152_1151760	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	506	Open in IMG/M
3300015335\|Ga0182116_1092475	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	668	Open in IMG/M
3300015335\|Ga0182116_1097647	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	654	Open in IMG/M
3300015335\|Ga0182116_1098625	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	651	Open in IMG/M
3300015335\|Ga0182116_1135158	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	571	Open in IMG/M
3300015340\|Ga0182133_1009907	All Organisms → Viruses → Predicted Viral	1438	Open in IMG/M
3300015340\|Ga0182133_1058692	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	816	Open in IMG/M
3300015340\|Ga0182133_1060007	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	810	Open in IMG/M
3300015340\|Ga0182133_1190103	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	504	Open in IMG/M
3300015348\|Ga0182115_1083718	Not Available	987	Open in IMG/M
3300015348\|Ga0182115_1116860	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	845	Open in IMG/M
3300015350\|Ga0182163_1244485	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	562	Open in IMG/M
3300015352\|Ga0182169_1195626	Not Available	661	Open in IMG/M
3300015353\|Ga0182179_1280193	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	540	Open in IMG/M
3300015353\|Ga0182179_1298436	Not Available	524	Open in IMG/M
3300015354\|Ga0182167_1269691	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	610	Open in IMG/M
3300015354\|Ga0182167_1341768	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	524	Open in IMG/M
3300017412\|Ga0182199_1092097	Not Available	686	Open in IMG/M
3300017421\|Ga0182213_1080311	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	900	Open in IMG/M
3300017421\|Ga0182213_1197338	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	572	Open in IMG/M
3300017439\|Ga0182200_1095349	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	610	Open in IMG/M
3300017439\|Ga0182200_1096814	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	607	Open in IMG/M
3300017445\|Ga0182198_1179633	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	528	Open in IMG/M
3300017689\|Ga0182231_1016333	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	1358	Open in IMG/M
3300017691\|Ga0182212_1088257	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	693	Open in IMG/M
3300017691\|Ga0182212_1100359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	650	Open in IMG/M
3300017691\|Ga0182212_1146837	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	537	Open in IMG/M
3300017692\|Ga0182210_1070048	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	735	Open in IMG/M
3300017693\|Ga0182216_1190960	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	536	Open in IMG/M
3300017792\|Ga0163161_10102958	Not Available	2127	Open in IMG/M
3300020077\|Ga0206351_10149602	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	515	Open in IMG/M
3300020077\|Ga0206351_10468545	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	629	Open in IMG/M
3300020080\|Ga0206350_11586321	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1078	Open in IMG/M
3300020081\|Ga0206354_11676902	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	3069	Open in IMG/M
3300023205\|Ga0255814_10427476	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	1711	Open in IMG/M
3300023205\|Ga0255814_10879025	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	534	Open in IMG/M
3300023300\|Ga0256702_11003154	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	846	Open in IMG/M
3300023300\|Ga0256702_12134423	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	531	Open in IMG/M
3300023300\|Ga0256702_12293182	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	722	Open in IMG/M
3300025530\|Ga0207866_1044047	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	585	Open in IMG/M
3300025924\|Ga0207694_11729266	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	526	Open in IMG/M
3300025936\|Ga0207670_11940825	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	501	Open in IMG/M
3300025938\|Ga0207704_11260710	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	631	Open in IMG/M
3300025941\|Ga0207711_11170842	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	710	Open in IMG/M
3300025944\|Ga0207661_11668508	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	582	Open in IMG/M
3300026755\|Ga0207632_102280	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	539	Open in IMG/M
3300027637\|Ga0209818_1171682	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	620	Open in IMG/M
3300027886\|Ga0209486_10774234	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	626	Open in IMG/M
3300028058\|Ga0268332_1062310	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	551	Open in IMG/M
3300028143\|Ga0268348_1012068	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Chloridoideae → Eragrostideae → Eragrostidinae → Eragrostis → Eragrostis curvula	640	Open in IMG/M
3300028253\|Ga0268316_1022993	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	516	Open in IMG/M
3300028381\|Ga0268264_12563598	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	515	Open in IMG/M
3300028467\|Ga0268333_1002317	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	845	Open in IMG/M
3300028467\|Ga0268333_1013181	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	518	Open in IMG/M
3300028476\|Ga0268329_1009539	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	703	Open in IMG/M
3300029799\|Ga0311022_12246643	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	836	Open in IMG/M
3300031357\|Ga0307435_1106146	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	647	Open in IMG/M
3300031996\|Ga0308176_10664384	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	1078	Open in IMG/M
3300032004\|Ga0307414_12187858	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	516	Open in IMG/M
3300032465\|Ga0214493_1128437	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	594	Open in IMG/M
3300032514\|Ga0214502_1011271	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	2648	Open in IMG/M
3300032689\|Ga0214497_1056506	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	870	Open in IMG/M
3300032792\|Ga0314744_1000902	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3405	Open in IMG/M
3300032890\|Ga0314747_1032506	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	786	Open in IMG/M
3300033526\|Ga0314761_1000793	Not Available	3667	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	77.69%
Environmental	Environmental	15.70%
Engineered	Engineered	6.61%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	76.03%
Terrestrial	Environmental → Terrestrial	14.88%
Bioreactor	Engineered → Bioreactor	4.13%
Fungi	Host-Associated → Fungi	1.65%
Solid Waste	Engineered → Solid Waste	1.65%
Aquatic	Environmental → Aquatic	0.83%
Lab Enrichment	Engineered → Lab Enrichment	0.83%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	52.89%
Soil	Environmental → Terrestrial → Soil	14.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.26%
Unclassified	Host-Associated → Plants → Unclassified	7.44%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.61%
Aerobic	Engineered → Bioreactor → Aerobic	2.48%
Mycelium	Host-Associated → Fungi → Mycelium	1.65%
Landfill	Engineered → Solid Waste → Landfill	1.65%
Marine	Environmental → Aquatic → Marine	0.83%
Phylloplane	Host-Associated → Plants → Phylloplane	0.83%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.83%
Anaerobic	Engineered → Bioreactor → Anaerobic	0.83%
Unclassified	Engineered → Bioreactor → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	52.89%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	13.22%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	7.44%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.61%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.96%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.31%
Unclassified	Engineered → Bioreactor → Aerobic → Unclassified	2.48%
Loam	Environmental → Terrestrial → Soil → Loam	1.65%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified	1.65%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	1.65%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.83%
Endophytes	Host-Associated → Plants → Phylloplane → Endophytes	0.83%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified	0.83%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	0.83%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	52.89%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	8.26%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	7.44%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.61%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.96%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.31%
Unclassified	Engineered → Bioreactor → Aerobic → Unclassified → Unclassified	2.48%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.65%
Unclassified	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified	1.65%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	1.65%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.83%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.83%
Unclassified	Host-Associated → Plants → Phylloplane → Endophytes → Unclassified	0.83%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified	0.83%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified	0.83%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	45.45%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	7.44%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	4.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.13%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.31%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	3.31%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.48%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.48%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.48%
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	2.48%
Food Waste	Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste	2.48%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.65%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.65%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.65%
Fungus Garden	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden	1.65%
Food Waste	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Food Waste	1.65%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.83%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.83%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.83%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.83%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.83%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.83%
Switchgrass Leaf	Host-Associated → Plants → Phylloplane → Endophytes → Unclassified → Switchgrass Leaf	0.83%
Ionic Liquid And High Solid Enriched	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched	0.83%
Anaerobic Digester Digestate	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate	0.83%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental	Open in IMG/M
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated	Open in IMG/M
3300009975	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG	Host-Associated	Open in IMG/M
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated	Open in IMG/M
3300009980	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009985	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_101 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300012949	Switchgrass enrichment cultures co-assembly	Engineered	Open in IMG/M
3300013000	Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM1	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015316	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017692	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300023205	Combined Assembly of Gp0242100, Gp0242119	Engineered	Open in IMG/M
3300023300	Food waste microbial community from Durham, Ontario, Canada. Combined Assembly of Gp0238881, Gp0242100	Engineered	Open in IMG/M
3300025530	Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-3-D (SPAdes)	Engineered	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300026755	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01K5-12 (SPAdes)	Environmental	Open in IMG/M
3300027637	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)	Environmental	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028467	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300029799	Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119	Engineered	Open in IMG/M
3300031357	Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-70	Environmental	Open in IMG/M
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental	Open in IMG/M
3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Host-Associated	Open in IMG/M
3300032465	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032514	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032689	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032890	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F072104

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0062592_1024513741	3300004480	Soil	DLSVSGDKFDLVEVDPHDPTTASELEAPMQSLNQLPMVTNLASARSA*
Ga0070666_110938262	3300005335	Switchgrass Rhizosphere	VPDLSVSGDKFDLVEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0068868_1000421351	3300005338	Miscanthus Rhizosphere	DSRGVPDLSVSGDNFDLVEVDPHDPTTTSEPEAPMQSLNQLPMVTNLAGARSA*
Ga0070661_1016624261	3300005344	Corn Rhizosphere	NLIPLDRAGVPDLSVSGDNSDLVEVDPHDPTTTSDPEAPMQSLNQLPMVTDLADARSA*
Ga0070659_1013648021	3300005366	Corn Rhizosphere	GNLIPLDRAGVPDLSVSGDNSDLVEVDPHDPTTTSEPEAPMQSLNQLPMVTDLADARSA*
Ga0070667_1013609251	3300005367	Switchgrass Rhizosphere	DRAGVPDLSVSGDKFDLAEDDPHDPTTTSEPEVPMQSLNQLPVVTDLVGARSA*
Ga0070667_1020825882	3300005367	Switchgrass Rhizosphere	LCKDVLETLIDRAGVPDLSVSGDKFDLAEDDPHDPTMTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0070738_103741051	3300005531	Surface Soil	VPDLSVSGDKFDLVEDDPHDPTTTSEPEVPMQSLNQLPVVTDLVDARSA*
Ga0070730_108787911	3300005537	Surface Soil	LSVSGDNFDLVEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0070664_1014313932	3300005564	Corn Rhizosphere	LIPLDRAGVPDLSVSGDNSDLVEVDPHDPTTTSEPEAPMQSLNQLPMVTDLAAARSA*
Ga0068859_1030027212	3300005617	Switchgrass Rhizosphere	KFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVGARSA*
Ga0068863_1017594222	3300005841	Switchgrass Rhizosphere	VPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPV
Ga0068860_1022295521	3300005843	Switchgrass Rhizosphere	LIPLDRAGVPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0068860_1028551661	3300005843	Switchgrass Rhizosphere	VSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVGARSA*
Ga0079221_104870912	3300006804	Agricultural Soil	GECDRGAVPDLSVSGDNFDLVEGDPHDPTTTSEPEAPMQSLNQLPVVTDLADARSA*
Ga0105137_1069381	3300009972	Switchgrass Associated	DKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0105129_1033531	3300009975	Switchgrass Associated	ICDRAGVPDLSVSRDKFDIAEDDPHDPTTTSEPEALMQSLNQLPVVTDLVGARSA*
Ga0105128_1014302	3300009976	Switchgrass Associated	VPDLSVSGDKFDLAEDDSHDPTTTSEPKAPMQSLNQLPVVTDLVDARSA
Ga0105128_1047842	3300009976	Switchgrass Associated	FDLAEDDPHDPTTMSEPEAPMQSLNQLPVVTDLVGARSA*
Ga0105135_1082212	3300009980	Switchgrass Associated	SVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVGARSA*
Ga0105135_1114281	3300009980	Switchgrass Associated	GDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDAISA*
Ga0105135_1134692	3300009980	Switchgrass Associated	EDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0105133_1298221	3300009981	Switchgrass Associated	VPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVT
Ga0105036_1196701	3300009985	Switchgrass Leaf	VPDLSVSRDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0105126_10058022	3300009994	Switchgrass Associated	SVSGDKFDLAGDDPHNPTMTSEPEALMQLLNQLPVVTDLVGARST*
Ga0134125_120161221	3300010371	Terrestrial Soil	VPDLSVSGDKFDLAEDDPHDPTTMSKPEAPMQSLNQLPVVTDLVGAR
Ga0134124_117058381	3300010397	Terrestrial Soil	VPDLSVSGDEFDLVEDDPHDPTTTSEPEAPMQSLNQLLVVTDLVDARSA*
Ga0134127_129932692	3300010399	Terrestrial Soil	FDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVGARSA*
Ga0134121_101744661	3300010401	Terrestrial Soil	VPDLSVSGDKFDLAEDDPHDLTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0153798_101441542	3300012949	Switchgrass Degrading	MPYDRAGVPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0157360_11883281	3300013000	Fungus Garden	KFDLVEVDPHDPTTTSEPEAPMQSLNQLPMVTDLAGARSA*
Ga0157360_13137211	3300013000	Fungus Garden	VPDLSVSGDNFDLVEVDPHDPTTTSEPEASMQSLNQLPVVN
Ga0157379_114938651	3300014968	Switchgrass Rhizosphere	VPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0182183_10759181	3300015270	Switchgrass Phyllosphere	MHLNAGVPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLN
Ga0182099_10542562	3300015278	Switchgrass Phyllosphere	LIPLDRGGVPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0182173_10000362	3300015288	Miscanthus Phyllosphere	GVPDLSVSGDNFDLVEVDPHDPTTTSEPEAPMQSLNQLPMVTNLAGARSA*
Ga0182158_10000431	3300015305	Miscanthus Phyllosphere	GVPDLSVSGDNFDLVEVDPHDPTTTSEPEAPMQSLNQLPMVTNLASARSA*
Ga0182098_10736941	3300015309	Switchgrass Phyllosphere	MQMPVDRAGVPDLSVSGDNFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLV
Ga0182182_10547971	3300015311	Switchgrass Phyllosphere	PLDRVGVPDLSVSGDKFDLVEDDPHDPTTTSEPEAPMQSLNQLLVVTDLIDARSA*
Ga0182182_10878291	3300015311	Switchgrass Phyllosphere	MQMTLIDRAGVPNLSVSGDKFDLAEDDPHDPTTMSEPEAPMQSLNQLPMVTDLVGARSA*
Ga0182182_10932131	3300015311	Switchgrass Phyllosphere	VPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVGARS
Ga0182120_10386461	3300015315	Switchgrass Phyllosphere	MQKTDRAGVPDLSVSRDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0182120_11162642	3300015315	Switchgrass Phyllosphere	VPDLSVSGDKFDLAEDDPHDPTTTNEPEAPMQSLNQ
Ga0182121_10202531	3300015316	Switchgrass Phyllosphere	VPDLSVSGDEFDLVEDDPHDPTTTSEPEAPMQSPNQLHVVT
Ga0182136_11147181	3300015317	Switchgrass Phyllosphere	VPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPAVTDLVDARSA*
Ga0182130_10760843	3300015319	Switchgrass Phyllosphere	VPDLSVSGDRFDLVEDAPHDPTTTSEPEAPMQSLNQLP
Ga0182130_11116752	3300015319	Switchgrass Phyllosphere	MRFDRAGVPDLSVSRDKFDLAEDDPHDPTTTSEPEAPMQSLNQ
Ga0182134_11220721	3300015324	Switchgrass Phyllosphere	VPDLLVSGDKFNLVEDDPHDPTTMSEPEAPMQSLNQLP
Ga0182114_11059161	3300015327	Switchgrass Phyllosphere	VPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVV
Ga0182114_11591161	3300015327	Switchgrass Phyllosphere	VPDLSVSVDKFDLAEDDPHDPTTTSEPEAPIQSLNQLPVVTDLVDARSA*SR
Ga0182153_10234431	3300015328	Switchgrass Phyllosphere	RAGVPDLWVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVGARSA*
Ga0182153_10395781	3300015328	Switchgrass Phyllosphere	KFDLVEDDPHDPTTMSEPKAPMQSLNQLPMVTDHARSA*
Ga0182153_10498162	3300015328	Switchgrass Phyllosphere	MQHHMEVTDRAGVPNLWVSGDKFDLVEDDPHDPTTMSEPKAPMQSLNQLPVVTDLVDARSA*
Ga0182153_10567301	3300015328	Switchgrass Phyllosphere	DLVEDDPHNPTTTSEPKAPMQSLNQLPVVTDLVDARLA*
Ga0182152_11408981	3300015330	Switchgrass Phyllosphere	VPDLSVSGDKFDLVEDAPHDPTTTSEPEAPMQSLNQLHVVTDLV
Ga0182152_11517601	3300015330	Switchgrass Phyllosphere	MAEEGWTQGDRAGVPDLSVSGDKFDLVEDDPHDPTTTSEPEAPMQSLNQLPVVT
Ga0182116_10924751	3300015335	Switchgrass Phyllosphere	VPDLSVSGDKFDLAEDDPHDPTTTSESEAPMQSLNQLPVVTDLV
Ga0182116_10976471	3300015335	Switchgrass Phyllosphere	VPDLSVSGDKFDLSEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVD
Ga0182116_10986251	3300015335	Switchgrass Phyllosphere	FRNVWVHLGTFRYVRAGVPNLSVSGDKFDLMEDGPHDPTTTSEPDAPMQWLNQLPVVTDLVDARSA*
Ga0182116_11351581	3300015335	Switchgrass Phyllosphere	VPDLSVSGDKFDLAEDDPRDPTTTSEPEAPMQSLNQLPVVTDLVDA
Ga0182133_10099072	3300015340	Switchgrass Phyllosphere	MQMPVDRAGVPDLSVSGDNFDLAEDDPHDPTTMSEPETPMQSLNQLPMVTDLVGARSA*
Ga0182133_10586922	3300015340	Switchgrass Phyllosphere	VPDLSVSGDKFDLVEDAPHYPTTTSEPEAPMQSLNQLPVVTDLVDA
Ga0182133_10600073	3300015340	Switchgrass Phyllosphere	VPDLSVSGDKFDLAKDDPHDPTTTSELEAPMQSLNQLPVVTDLVDVRS
Ga0182133_11901031	3300015340	Switchgrass Phyllosphere	DLVEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA*
Ga0182115_10837181	3300015348	Switchgrass Phyllosphere	VPDLSVSGDKFDLAEDDPHDPTTTSEPEVPMQSLNQ
Ga0182115_11168601	3300015348	Switchgrass Phyllosphere	VPDLSVSGDKFDLVEDGPHDPTTTSEPEAPMQSLNLLPVVTDLVDARSA*
Ga0182163_12444851	3300015350	Switchgrass Phyllosphere	MEDDPHDPTTTSEPEVPMQSLNQLPMVTDLVDARPA*
Ga0182169_11956261	3300015352	Switchgrass Phyllosphere	VPDLSVSGDKFDLVEDDPHDLTMTSEPEAPMQSLNQLP
Ga0182179_10438411	3300015353	Switchgrass Phyllosphere	MDRAGVPDLSVSRHKFDLAEDDPHDPTTTSEPEAPMQSLNQLPV
Ga0182179_12801931	3300015353	Switchgrass Phyllosphere	VPDLSVSRDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVD
Ga0182179_12984361	3300015353	Switchgrass Phyllosphere	VRSHQGIVCDRAGVPDVLVSGDKFDLAEDDPHDPTMMSGPEAPMQSLNQLPMVIDLV
Ga0182167_12696911	3300015354	Switchgrass Phyllosphere	VPDLSVSGDKFDLVEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA
Ga0182167_13417682	3300015354	Switchgrass Phyllosphere	MAEEGWTQGDRAGVPDLLVSGDKFDLAEDDPHDLTTTSEPEVPMQSLNQLLVVTDLVDARSA*
Ga0182199_10920972	3300017412	Switchgrass Phyllosphere	VPDLSVSGDKFDLAEDDPHDPTTTSEPEALMQSLNQL
Ga0182213_10803112	3300017421	Switchgrass Phyllosphere	MQMTLIDRAGVPNLSVSGDKFDLMEDGPHDPTTTSEPDAPMQWLNQLPVVTDLVDARSA
Ga0182213_11973381	3300017421	Switchgrass Phyllosphere	DRAGVPDLSVSGDEFDLVEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA
Ga0182200_10953492	3300017439	Switchgrass Phyllosphere	FDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVGARSA
Ga0182200_10968141	3300017439	Switchgrass Phyllosphere	VSCSDRTGVPDLSVSRDKFDLAEDDPHYPTTTSEPEAPMQSLNQLPVVTDLVDA
Ga0182198_11796331	3300017445	Switchgrass Phyllosphere	MRAKEEAEVDRAGVPDLSVSGDKFDLAEDDPHDLTTTSEPEAPMQSLNQLPVVTDRVDARSA
Ga0182231_10163332	3300017689	Miscanthus Phyllosphere	MGVPDLSVSGDNFDLVEVDPHDPTTTSEPEAPMQSLNQLPMVTNLASARSA
Ga0182212_10882571	3300017691	Switchgrass Phyllosphere	VEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA
Ga0182212_11003591	3300017691	Switchgrass Phyllosphere	LSVSGDKFDLVEDGPHDPTTTSEPEAPMQSLNLLPVVTDLVDARSA
Ga0182212_11468371	3300017691	Switchgrass Phyllosphere	FDLAEDDPHDLTTTSEPEAPMQSLNQLPVVTDLVGAR
Ga0182210_10700482	3300017692	Switchgrass Phyllosphere	LIPLDRAGVPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVGARSA
Ga0182216_11909602	3300017693	Switchgrass Phyllosphere	VPDLSVSGDKFDLAEYDPHDPTTTSEPEAPMQSLNQLLVVTD
Ga0163161_101029583	3300017792	Switchgrass Rhizosphere	AEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA
Ga0206351_101496021	3300020077	Corn, Switchgrass And Miscanthus Rhizosphere	MSTVYDRAGVPDLSVSGDNSDLVEVDPHDPSTTSDPEAPMQSLNQLPMVTDLADARSA
Ga0206351_104685452	3300020077	Corn, Switchgrass And Miscanthus Rhizosphere	MSTFKLDVAEVPDLSASRDNSDLAEDDPCDPTTTSKPEAPMQSLNQLPVVTDLADARSA
Ga0206350_115863211	3300020080	Corn, Switchgrass And Miscanthus Rhizosphere	MSTFKLDVAEVPDLSASRDNSDLAEDDPCDPTTTSKPEAPMQSLNQLPVGTDLADARSA
Ga0206354_116769023	3300020081	Corn, Switchgrass And Miscanthus Rhizosphere	MSTFKLDVAEVPDLSASRDNSDLAEDDPCDPTTTSKPEAPMQSLNQLPVVIDLADARSA
Ga0255814_104274763	3300023205	Food Waste	DNSDLAEDDPCDPTTTSKPEAPMQSLNQLPVVTDLADARSA
Ga0255814_108790251	3300023205	Food Waste	MEVVSCDRAGVPDLSMSGDNSNLVEVAPHDPTTTSDPEAPMQSLNQLPMVTDLADARSA
Ga0256702_110031542	3300023300	Food Waste	NSDLAEDDPCDPTTTSKPEAPMQSLNQLPVVTDLADARST
Ga0256702_121344232	3300023300	Food Waste	MRMEESDPSNKSDRAGVPDLSVSGDNFDLVEVDPHDLTTTSEPEAPMQSLNQLPMVTDLAAARSA
Ga0256702_122931821	3300023300	Food Waste	SLGGIRYDLLDTRADRAGVPDLSVSGDNSDLVEVDPHDPTTTSEPEAPMQSLNQLPMVTDLADARSA
Ga0207866_10440471	3300025530	Ionic Liquid And High Solid Enriched	PIGDRAGVPDLSVSRDKFDLAEYDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA
Ga0207694_117292661	3300025924	Corn Rhizosphere	DVAEVPDLSASRDNSDLAEDDPCDPTTTSKPEAPMQSLNQLPVVTDLADARSA
Ga0207670_119408251	3300025936	Switchgrass Rhizosphere	MEFYTSAHLDRAGVPDLSVSGDEFDLVEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA
Ga0207704_112607101	3300025938	Miscanthus Rhizosphere	TDSRGVPDLSVSGDNFDLVEVDPHDPTTTSEPEAPMQSLNQLPMVTNLAGARSA
Ga0207711_111708421	3300025941	Switchgrass Rhizosphere	RAGVPDLSVSRDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA
Ga0207661_116685082	3300025944	Corn Rhizosphere	DEAEVPDLSASRDNSDLSEDDPCDPTTTSKPEAPMQSLNQLPVVTDLADARSA
Ga0207632_1022801	3300026755	Soil	AEVPDLSASRDNSDLAEDDPCDPIRTSKPEAPMQSLNQLPVVTDLADARSA
Ga0209818_11716821	3300027637	Agricultural Soil	RDNSDLAEDDPCDPTTTSKPEAPMQSLNQLPVVTDLADARSA
Ga0209486_107742341	3300027886	Agricultural Soil	LDRVGVPDLSVSGDKFDLVEVDPHDPTTTSEPEAPMQSLNQLSMVTNLAGARSA
Ga0268332_10623101	3300028058	Phyllosphere	MQHHMEVTDRAGVPNLWVSGDKFDLVEDDPHDPTTMSEPKAPMQSLNQLPVVTDLVDARS
Ga0268348_10120682	3300028143	Phyllosphere	VPDLSVSGDKFDLAGDDPHDPTMTSEPEAPMQLLNQLPVVTDL
Ga0268316_10229931	3300028253	Phyllosphere	SVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVGARSA
Ga0268264_125635981	3300028381	Switchgrass Rhizosphere	DLVEDDPHDPTTTSEPEVPMQSLNQLPVVTDLVDARSA
Ga0268333_10023171	3300028467	Phyllosphere	VPDLSVSGDECDLVEDDPHDPTTTSEPEVLMQSLNQLPVVTDLVDARSA
Ga0268333_10131811	3300028467	Phyllosphere	QQVSCSYETDRAGVPNLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVGARSA
Ga0268329_10095391	3300028476	Phyllosphere	VPDLSVSGDEFDLVEDDPHDPTTMSEPEAPMQSLNQLPVVTDLVDARSA
Ga0311022_122466431	3300029799	Anaerobic Digester Digestate	SLGGIRYDLLDTRADRAGVPDLSVSGDNSDLVEVDPHDPTTTSDPEAPMQSLNQLPMVTDLADARSA
Ga0307435_11061461	3300031357	Salt Marsh	NHLAMSFALSDRTGVPDLSVSGDNFDLVEDDPHDPTTTSEPEAPMQSLNQLPVVTNLVDARSA
Ga0308176_106643842	3300031996	Soil	TSPDVAEVPDLSASRDNSDLAEDDPCDPTTTSKPEAPMQSLNQLPVVTDLADARSA
Ga0307414_121878581	3300032004	Rhizosphere	GNLIPIDEAEVPDLSASRDNSDLSEDDPCDPTTTSKPEAPMQSLNQLPVVTDLADARSA
Ga0214493_11284372	3300032465	Switchgrass Phyllosphere	MSGDKFDLAEDDPHDPTTTSEPEALMQSLNQLPVVTDLVDARSA
Ga0214502_10112711	3300032514	Switchgrass Phyllosphere	LSVSGDEFDLVEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA
Ga0214497_10565061	3300032689	Switchgrass Phyllosphere	MMMLLFPIYIVCDRAEVPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA
Ga0314744_10009022	3300032792	Switchgrass Phyllosphere	VPDLSVSGDKFDLAEDDPHDPTTTSEPEVPMQSLNQLPVVTDLVDARSA
Ga0314747_10325061	3300032890	Switchgrass Phyllosphere	MFIDRAGVPDLSVSGDKFDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA
Ga0314761_10007933	3300033526	Switchgrass Phyllosphere	FDLAEDDPHDPTTTSEPEAPMQSLNQLPVVTDLVDARSA

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign