Basic Information | |
---|---|
Family ID | F072277 |
Family Type | Metagenome |
Number of Sequences | 121 |
Average Sequence Length | 45 residues |
Representative Sequence | MEKCVKCGVAIEKMEVFPKGVCLACYAVEFEKEFQSALKIARLK |
Number of Associated Samples | 83 |
Number of Associated Scaffolds | 121 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 59.50 % |
% of genes near scaffold ends (potentially truncated) | 38.84 % |
% of genes from short scaffolds (< 2000 bps) | 77.69 % |
Associated GOLD sequencing projects | 76 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (64.463 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.314 % of family members) |
Environment Ontology (ENVO) | Unclassified (64.463 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.769 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.50% β-sheet: 8.33% Coil/Unstructured: 54.17% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 121 Family Scaffolds |
---|---|---|
PF00850 | Hist_deacetyl | 4.96 |
PF00436 | SSB | 1.65 |
PF02140 | Gal_Lectin | 1.65 |
PF06074 | DUF935 | 0.83 |
PF08241 | Methyltransf_11 | 0.83 |
PF00145 | DNA_methylase | 0.83 |
PF14550 | Peptidase_S78_2 | 0.83 |
PF02467 | Whib | 0.83 |
PF02675 | AdoMet_dc | 0.83 |
COG ID | Name | Functional Category | % Frequency in 121 Family Scaffolds |
---|---|---|---|
COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 9.92 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 1.65 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 1.65 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.83 |
COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.83 |
COG4383 | Mu-like prophage protein gp29 | Mobilome: prophages, transposons [X] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.21 % |
Unclassified | root | N/A | 24.79 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_108820182 | Not Available | 517 | Open in IMG/M |
3300002408|B570J29032_109223724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300002835|B570J40625_100409117 | All Organisms → Viruses → Predicted Viral | 1314 | Open in IMG/M |
3300003393|JGI25909J50240_1084663 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 634 | Open in IMG/M |
3300004126|Ga0066179_10162038 | Not Available | 610 | Open in IMG/M |
3300004240|Ga0007787_10462356 | Not Available | 634 | Open in IMG/M |
3300005527|Ga0068876_10233859 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
3300005581|Ga0049081_10116670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300005581|Ga0049081_10182316 | Not Available | 758 | Open in IMG/M |
3300005581|Ga0049081_10190037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300005581|Ga0049081_10290446 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 565 | Open in IMG/M |
3300005582|Ga0049080_10052659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1405 | Open in IMG/M |
3300005582|Ga0049080_10222222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 621 | Open in IMG/M |
3300005662|Ga0078894_10255239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1590 | Open in IMG/M |
3300006030|Ga0075470_10092426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 909 | Open in IMG/M |
3300006641|Ga0075471_10011729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5356 | Open in IMG/M |
3300006641|Ga0075471_10334595 | Not Available | 766 | Open in IMG/M |
3300006641|Ga0075471_10437283 | Not Available | 653 | Open in IMG/M |
3300007165|Ga0079302_1084790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 677 | Open in IMG/M |
3300007734|Ga0104986_1954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 60849 | Open in IMG/M |
3300007974|Ga0105747_1097616 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 914 | Open in IMG/M |
3300008107|Ga0114340_1019597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 3201 | Open in IMG/M |
3300008107|Ga0114340_1038269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2158 | Open in IMG/M |
3300008107|Ga0114340_1051842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1792 | Open in IMG/M |
3300008110|Ga0114343_1039314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1904 | Open in IMG/M |
3300008116|Ga0114350_1180667 | Not Available | 542 | Open in IMG/M |
3300008120|Ga0114355_1042574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2138 | Open in IMG/M |
3300008448|Ga0114876_1181358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 733 | Open in IMG/M |
3300008450|Ga0114880_1045002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1894 | Open in IMG/M |
3300008450|Ga0114880_1056478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1638 | Open in IMG/M |
3300008450|Ga0114880_1059078 | All Organisms → Viruses → Predicted Viral | 1593 | Open in IMG/M |
3300009068|Ga0114973_10001585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 16831 | Open in IMG/M |
3300009155|Ga0114968_10001285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19207 | Open in IMG/M |
3300009158|Ga0114977_10238426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1054 | Open in IMG/M |
3300009164|Ga0114975_10425543 | Not Available | 722 | Open in IMG/M |
3300009181|Ga0114969_10124495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1641 | Open in IMG/M |
3300010160|Ga0114967_10113490 | All Organisms → Viruses → Predicted Viral | 1554 | Open in IMG/M |
3300010354|Ga0129333_10370698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1271 | Open in IMG/M |
3300010885|Ga0133913_10711591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2626 | Open in IMG/M |
3300011115|Ga0151514_11112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10348 | Open in IMG/M |
3300011116|Ga0151516_10056 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58158 | Open in IMG/M |
3300012013|Ga0153805_1016079 | Not Available | 1278 | Open in IMG/M |
3300012013|Ga0153805_1048807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 718 | Open in IMG/M |
3300012017|Ga0153801_1012476 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1535 | Open in IMG/M |
3300013004|Ga0164293_10717674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 639 | Open in IMG/M |
3300013004|Ga0164293_10998472 | Not Available | 523 | Open in IMG/M |
3300013005|Ga0164292_10300952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1097 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10158110 | All Organisms → Viruses → Predicted Viral | 1485 | Open in IMG/M |
3300014050|Ga0119952_1009243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 4047 | Open in IMG/M |
3300014050|Ga0119952_1025850 | All Organisms → Viruses → Predicted Viral | 1873 | Open in IMG/M |
3300017723|Ga0181362_1096351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 590 | Open in IMG/M |
3300017736|Ga0181365_1149969 | Not Available | 552 | Open in IMG/M |
3300017761|Ga0181356_1042301 | All Organisms → Viruses → Predicted Viral | 1595 | Open in IMG/M |
3300017774|Ga0181358_1086398 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1140 | Open in IMG/M |
3300017774|Ga0181358_1168681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300017774|Ga0181358_1212974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 626 | Open in IMG/M |
3300017777|Ga0181357_1112695 | Not Available | 1025 | Open in IMG/M |
3300017777|Ga0181357_1162603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 817 | Open in IMG/M |
3300017778|Ga0181349_1157763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 811 | Open in IMG/M |
3300017778|Ga0181349_1188531 | Not Available | 719 | Open in IMG/M |
3300017778|Ga0181349_1253844 | Not Available | 586 | Open in IMG/M |
3300017780|Ga0181346_1268873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 589 | Open in IMG/M |
3300017784|Ga0181348_1270576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300017785|Ga0181355_1260635 | Not Available | 662 | Open in IMG/M |
3300017785|Ga0181355_1356353 | Not Available | 537 | Open in IMG/M |
3300017788|Ga0169931_10732188 | Not Available | 646 | Open in IMG/M |
3300019784|Ga0181359_1235773 | Not Available | 565 | Open in IMG/M |
3300020159|Ga0211734_10448308 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1723 | Open in IMG/M |
3300020162|Ga0211735_10172421 | Not Available | 693 | Open in IMG/M |
3300020162|Ga0211735_10382130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 687 | Open in IMG/M |
3300022190|Ga0181354_1055252 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
3300022407|Ga0181351_1013180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 3402 | Open in IMG/M |
3300022752|Ga0214917_10003192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 19200 | Open in IMG/M |
3300022752|Ga0214917_10005166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14073 | Open in IMG/M |
3300022752|Ga0214917_10009061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9626 | Open in IMG/M |
3300022752|Ga0214917_10028601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 4259 | Open in IMG/M |
3300022752|Ga0214917_10367412 | Not Available | 608 | Open in IMG/M |
3300023179|Ga0214923_10045220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3433 | Open in IMG/M |
3300025585|Ga0208546_1135927 | Not Available | 531 | Open in IMG/M |
3300025635|Ga0208147_1134341 | Not Available | 584 | Open in IMG/M |
3300025732|Ga0208784_1042819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1410 | Open in IMG/M |
3300027114|Ga0208009_1084360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 525 | Open in IMG/M |
3300027608|Ga0208974_1078365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 907 | Open in IMG/M |
3300027659|Ga0208975_1050288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1282 | Open in IMG/M |
3300027679|Ga0209769_1208321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300027720|Ga0209617_10073353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1406 | Open in IMG/M |
3300027732|Ga0209442_1329022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300027754|Ga0209596_1000172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58725 | Open in IMG/M |
3300027785|Ga0209246_10042918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1736 | Open in IMG/M |
3300027797|Ga0209107_10436981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 591 | Open in IMG/M |
3300027798|Ga0209353_10177296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 942 | Open in IMG/M |
3300027971|Ga0209401_1000068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 70638 | Open in IMG/M |
3300027971|Ga0209401_1003157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 10437 | Open in IMG/M |
3300031758|Ga0315907_10296622 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
3300031857|Ga0315909_10437383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
3300031857|Ga0315909_10501697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 838 | Open in IMG/M |
3300031857|Ga0315909_10998988 | Not Available | 506 | Open in IMG/M |
3300031951|Ga0315904_10131230 | All Organisms → Viruses → Predicted Viral | 2574 | Open in IMG/M |
3300031951|Ga0315904_10269121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1618 | Open in IMG/M |
3300031951|Ga0315904_10517993 | All Organisms → Viruses → Predicted Viral | 1047 | Open in IMG/M |
3300031951|Ga0315904_10680300 | Not Available | 869 | Open in IMG/M |
3300031951|Ga0315904_10737774 | Not Available | 821 | Open in IMG/M |
3300031951|Ga0315904_11049295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300032050|Ga0315906_10783308 | Not Available | 751 | Open in IMG/M |
3300032050|Ga0315906_10796636 | Not Available | 742 | Open in IMG/M |
3300032093|Ga0315902_10197226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2026 | Open in IMG/M |
3300032093|Ga0315902_10899966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 681 | Open in IMG/M |
3300032116|Ga0315903_10255066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1513 | Open in IMG/M |
3300032116|Ga0315903_10363356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1194 | Open in IMG/M |
3300032116|Ga0315903_11026851 | Not Available | 574 | Open in IMG/M |
3300032116|Ga0315903_11122058 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 538 | Open in IMG/M |
3300033993|Ga0334994_0047892 | All Organisms → Viruses → Predicted Viral | 2684 | Open in IMG/M |
3300034012|Ga0334986_0571689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 543 | Open in IMG/M |
3300034018|Ga0334985_0400047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 823 | Open in IMG/M |
3300034062|Ga0334995_0484221 | Not Available | 749 | Open in IMG/M |
3300034068|Ga0334990_0010916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 4855 | Open in IMG/M |
3300034071|Ga0335028_0206126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 1215 | Open in IMG/M |
3300034101|Ga0335027_0015495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 6551 | Open in IMG/M |
3300034104|Ga0335031_0029132 | All Organisms → Viruses → Predicted Viral | 4025 | Open in IMG/M |
3300034118|Ga0335053_0059200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2715 | Open in IMG/M |
3300034120|Ga0335056_0485571 | Not Available | 653 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.31% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 17.36% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 14.88% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.26% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.44% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.61% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.79% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.96% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.31% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.65% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 1.65% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.65% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.83% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.83% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.83% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.83% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1088201821 | 3300002408 | Freshwater | VGCGAFMQEFEVFEKGICVKCYAEEFEKEFQSALKIARLK* |
B570J29032_1092237242 | 3300002408 | Freshwater | MVMEVCVKCGVSIGQFEVFPEQVCVKCYAVEFEKEFQSALKVGRFK* |
B570J40625_1004091171 | 3300002835 | Freshwater | MKKCVGCGAFMQEFEVFEKGICVKCYAEEFEKEFQSALKIARLK* |
JGI25909J50240_10846631 | 3300003393 | Freshwater Lake | MTKCVKCGVKIGKMEVFPRGVCLSCYAVEFEKEFQSALKIAR |
Ga0066179_101620382 | 3300004126 | Freshwater Lake | MKCVKCAVVIGRMEVFQGGVCLECFAVEFEKGFQSALKIAR |
Ga0007787_104623561 | 3300004240 | Freshwater Lake | MKCVKCGVAVGKMEVFPKGVCLACYAVEFEKEFQSALKIARFK* |
Ga0068876_102338591 | 3300005527 | Freshwater Lake | MEKCSKCGVVVGKLEMFPEQLCLACYAVVFEKQFQSALKIARLK* |
Ga0049081_101166702 | 3300005581 | Freshwater Lentic | VESERGTDMKCVKCGVAIEKIEVFQGGVCLECFAVEFEKGFQSALKIARLK* |
Ga0049081_101823162 | 3300005581 | Freshwater Lentic | MESERRTDMKCVKCAVVIGRMEVFQGGVCLKCFAVEFEKGFQSALKIARLK* |
Ga0049081_101900371 | 3300005581 | Freshwater Lentic | VESERRTDMKCVKCGVAVGKMEVFQGGVCLKCYAVEFEKEFQSALKIARLK* |
Ga0049081_102904462 | 3300005581 | Freshwater Lentic | MEKCVKCGVALEKMEVFPRGLCLSCYAVEFEQEFQSALKIARLK |
Ga0049080_100526593 | 3300005582 | Freshwater Lentic | MEKCVKCGVAVEKMEVFQGGVCLECFAVEFEKGFQSALKIARLK* |
Ga0049080_102222221 | 3300005582 | Freshwater Lentic | GVSIGQFEVFPEQVCVKCFAVEFEKEFQSALKIGRFK* |
Ga0078894_102552393 | 3300005662 | Freshwater Lake | MEKCVKCKVAIEKMEVFPKGVCLACYAVEFEKEFQSALKIARLK* |
Ga0075470_100924263 | 3300006030 | Aqueous | MEKCVKCGVAVEKMAMFPEGLCLSCYAVVFEKQFQSALKIARMK* |
Ga0075471_1001172912 | 3300006641 | Aqueous | MEKCVKCGVAIEKMEVFPKGVCLACYAVEFEKEFQSALKIARFK* |
Ga0075471_103345952 | 3300006641 | Aqueous | MEKCSKCGVVVGKYEMFPEQLCLACYAVVFEKQFQSALKIARLK* |
Ga0075471_104372832 | 3300006641 | Aqueous | MEKCVKCGVFMEKMEVFPKGVCLKCYAVEFEKEFQSALKVARLK* |
Ga0079302_10847902 | 3300007165 | Deep Subsurface | MKCVKCGVAVEKMEVFEGGVCLACYAVEFEKEFQSALKIARFK* |
Ga0104986_19543 | 3300007734 | Freshwater | MEVCVKCGVSIGQFEVFPEQVCVKCFAVEFEKEFQSALKIGRFK* |
Ga0105747_10976162 | 3300007974 | Estuary Water | MPVVVCAKCGVSIGQFEVFPEGVCVKCFAVEFEKEFQSALKIGRFK* |
Ga0114340_10195973 | 3300008107 | Freshwater, Plankton | MKCVKCGVVIGKFEVFPEEVCVKCYAVEFEKEFQSALKVGRFE* |
Ga0114340_10382692 | 3300008107 | Freshwater, Plankton | MEKCVKCAVVIEKMEVFEGGVCLACYAVEFEKEFQSALKIARFK* |
Ga0114340_10518423 | 3300008107 | Freshwater, Plankton | MKCVKCGVAIEKMEVFPKGVCLSCYAVEFEKEFQSALKIARLK* |
Ga0114343_10393143 | 3300008110 | Freshwater, Plankton | MKCVKCGVVIGKFEVFPEQVCVKCYAVEFEKEFQSALKVGRFK* |
Ga0114350_11806672 | 3300008116 | Freshwater, Plankton | PRGGHEMEKCVKCGVAIEKMEVFPKGVCLACYAVEFEKEFQSALKIARFK* |
Ga0114355_10425745 | 3300008120 | Freshwater, Plankton | MKKCVGCGAFMQEFEVFEKGICVKCYAEKFEKEFQSALKIARLK* |
Ga0114876_11813581 | 3300008448 | Freshwater Lake | MKCVKCGVAVGKMEVFPKGVCLACYAVEFEKEFQSA |
Ga0114880_10450021 | 3300008450 | Freshwater Lake | MKCVKCGVVIGKFEVFPEEVCVKCYAVEFEKEFQSALKVGRFK* |
Ga0114880_10564782 | 3300008450 | Freshwater Lake | VESERRTDMKCVKCGVVIGKMEVFQGGVCLKCYAVEFEKEFQSALKIARLK* |
Ga0114880_10590781 | 3300008450 | Freshwater Lake | MESERRTDMKCVKCAVVIGRMEVFQGGVCLECFAVEFEKGFQSALKIARLK* |
Ga0114973_100015853 | 3300009068 | Freshwater Lake | VESERRTDMKCVKCGVAVGKMEVFQSGVCLKCYAEEFEKEFQSALKIARLK* |
Ga0114968_1000128513 | 3300009155 | Freshwater Lake | VESERRTDMKCVKCGVAVGKMEVFQGGVCLQCYAVEFEKEFQSALKIARLK* |
Ga0114977_102384261 | 3300009158 | Freshwater Lake | MKCVKCGVAVGKMEVFQGGVCLQCYAMEFEKEFQSA |
Ga0114975_104255432 | 3300009164 | Freshwater Lake | MKCVKCAVVIGKMEVFEGGVCLACYAVEFEKEFQSALKIARLK* |
Ga0114969_101244952 | 3300009181 | Freshwater Lake | MPVVVCVKCGVSIGQFEVFPEGVCVKCFAVEFEKEFQSALKIGRLK* |
Ga0114967_101134901 | 3300010160 | Freshwater Lake | ERRTDMKCVKCGVAVGKMEVFQGGVCLKCYAVEFEKEFQSALKIARLK* |
Ga0129333_103706982 | 3300010354 | Freshwater To Marine Saline Gradient | MEKCVKCGVAVEKMAMFPEELCLSCYAVVFEKQFQSALKIARMK* |
Ga0133913_107115911 | 3300010885 | Freshwater Lake | MPVVVCVKCGVSIGQFEVFPEGVCVKCFAVEFEKEFQSALKIG |
Ga0151514_1111218 | 3300011115 | Freshwater | MEKCVKCGKEIGQYEVFPKVTCIECFAVVFEKEFQSAIKVGGSK* |
Ga0151516_1005677 | 3300011116 | Freshwater | MKKCVACGAFMQEFEVFEKGICVKCYAEEFEKEFQSALKVARLK* |
Ga0153805_10160792 | 3300012013 | Surface Ice | MKCVKCGVAVGKMEVFQGGVCLKCYAVEFEKEFQSALKIARLK* |
Ga0153805_10488071 | 3300012013 | Surface Ice | MEKCVKCGVAVEKMEVFEGGVCLACYAVEFEKEFQSALKIARFK* |
Ga0153801_10124763 | 3300012017 | Freshwater | MKCVKCGVAVGKMGVFQGGVCLQCFAVEFEKGFQSALKKARAK* |
Ga0164293_107176743 | 3300013004 | Freshwater | VKCGVSIGQFEVFPEQVCVKCYAVEFEKEFQSALKVGRFK* |
Ga0164293_109984722 | 3300013004 | Freshwater | VREEDGMKKCVGCGAFMQEFEVFEKGICVKCYAEEFEKEFQSALKIARLK* |
Ga0164292_103009522 | 3300013005 | Freshwater | MEKCVKCGVAIEKMEVFPKGVCLACYAVEFEKEFQSALKIARLK* |
(restricted) Ga0172367_101581101 | 3300013126 | Freshwater | MEKCSKCGVAVEKMAMFPEGLCLSCYAVVFEKQFQSALKIARLK* |
Ga0119952_10092432 | 3300014050 | Freshwater | MEKCVKCGVAVEKMEVFPKGVCLACYAVEFEKKFQSALKIARFK* |
Ga0119952_10258501 | 3300014050 | Freshwater | REEDKMEKCVKCGVAVEKMEVFQGGVCLACYAVEFEKEFQSALKIARFK* |
Ga0181362_10963511 | 3300017723 | Freshwater Lake | MKCVKCGVVIGKMEVFEGGVCLACYAVEFEKEFQSALKIARFK |
Ga0181365_11499691 | 3300017736 | Freshwater Lake | MKCVKCAVVIGRMEVFQGGVCLECFAVEFEKGFQSA |
Ga0181356_10423017 | 3300017761 | Freshwater Lake | AVVSGRIEVFQVGVCLECFAVEFEKGFQSALKIARLK |
Ga0181358_10863982 | 3300017774 | Freshwater Lake | MEVCAKCGVSIGQFEVFPEGVCVKCFAVEFEKEFQSALKIGRFKK |
Ga0181358_11686813 | 3300017774 | Freshwater Lake | MTKCVKCAVVIGRMEVFQGGVCLECFAVEFEKGFQSALKKARLK |
Ga0181358_12129742 | 3300017774 | Freshwater Lake | CVKCGVAVEKMEVFQGGVCLACYAVEFEKEFQSALKIARLK |
Ga0181357_11126951 | 3300017777 | Freshwater Lake | MKSERRTDMKCVKCGVAIEKLEVFQCGVCLECFAVEFEKGFQSALKIARLK |
Ga0181357_11626032 | 3300017777 | Freshwater Lake | MPVVVCAKCGVSIGQFEVFPEGVCVKCFAVEFEKEFQSALKIGRFKK |
Ga0181349_11577633 | 3300017778 | Freshwater Lake | EGDKMKKCVKCGVVIGKMEVFQGGVCLACYAVEFEKEFQSALKIARFKS |
Ga0181349_11885313 | 3300017778 | Freshwater Lake | RTDMKCVKCGVAIEKLEVVQGGVCLERFAVEFEKGFQSALKIARLK |
Ga0181349_12538441 | 3300017778 | Freshwater Lake | PQFDILMESERRTDMKCVKCAVVIGRMEVFQGGVCLECFAVEFEKGFQSALKIARLK |
Ga0181346_12688732 | 3300017780 | Freshwater Lake | MEVCAKCGVSIGQFEVFPEGVCVKCFAVEFEKEFQSALKIGRFK |
Ga0181348_12705763 | 3300017784 | Freshwater Lake | VKCAVVIGRMEVFQGGVCLECFAVEFEKGFQSALKIARLK |
Ga0181355_12606351 | 3300017785 | Freshwater Lake | KMEKCVKCAVVIEKMEVFEGGVCLACYAVEFEKEFQSALKIARFKS |
Ga0181355_13563532 | 3300017785 | Freshwater Lake | MKCVKCGVVIGKMEVFQGGVCLACYAVAFEKEFQSALKIARLK |
Ga0169931_107321881 | 3300017788 | Freshwater | MEKCSKCGVAVEKMAMFPEGLCLSCYAVVFEKQFQSALKIARLK |
Ga0181359_12357731 | 3300019784 | Freshwater Lake | AVVIGRMEVFQGGVCLECFAVEFEKGFQSALKIARLK |
Ga0211734_104483085 | 3300020159 | Freshwater | VESERRTDMKCVKCGVAVGKMEVFQGGVCLACYAVEFEKEFQSALKIARLK |
Ga0211735_101724211 | 3300020162 | Freshwater | VESERRTDMKCVKCGVVIGKMEVFPKGVCLSCYAVEFEKEFQSALKIARLK |
Ga0211735_103821303 | 3300020162 | Freshwater | MKKCVGCGAFMQEFEVFEKGICVKCYAEKFEKEFQSALKIARLK |
Ga0181354_10552525 | 3300022190 | Freshwater Lake | MKSERRTDMKCVKCAVVIGRMEVFQGGVCLECFAVEFEKGFQSALKIARLK |
Ga0181351_10131805 | 3300022407 | Freshwater Lake | MESERRTDMKCVKCAVVIGRMEVFQGGVCLECFAVEFEKEFQSALKIARLK |
Ga0214917_1000319214 | 3300022752 | Freshwater | MEKCVKCGVFMEKMEVFPKGVCLKCYAVEFEKEFQSALKVARLK |
Ga0214917_1000516617 | 3300022752 | Freshwater | MEKCSKCGVVVGKLEMFPEQLCLACYAVVFEKQFQSALKIARLK |
Ga0214917_1000906120 | 3300022752 | Freshwater | MEKCVKCGVAIEKMEVFPKGVCLACYAVEFEKEFQSALKIARLK |
Ga0214917_100286015 | 3300022752 | Freshwater | MKKCVGCGAFMQEFEVFEKGICVKCYAEEFEKEFQSALKIARLK |
Ga0214917_103674123 | 3300022752 | Freshwater | EDGMEKCVKCGVFMEKMEVFPKGVCLKCYAVEFEKEFQSALKVARLK |
Ga0214923_100452208 | 3300023179 | Freshwater | MEKCSKCGVVVGKLEMFPEQLCLSCYAVVFEKQFQSALKIARLK |
Ga0208546_11359271 | 3300025585 | Aqueous | RRRPMEKCSKCGVVVGKLEMFPEQLCLACYAVVFEKQFQSALKIARLK |
Ga0208147_11343412 | 3300025635 | Aqueous | FGILESRERRRPMEKCSKCGVVVGKLEMFPEQLCLACYAVVFEKQFQSALKIARLK |
Ga0208784_10428192 | 3300025732 | Aqueous | MEKCVKCGVAVEKMAMFPEGLCLSCYAVVFEKQFQSALKIARMK |
Ga0208009_10843602 | 3300027114 | Deep Subsurface | MKCVKCGVAVEKMEVFEGGVCLACYAVEFEKEFQSALKIARFK |
Ga0208974_10783651 | 3300027608 | Freshwater Lentic | MESERRTDMKCVKCAVVIGRMEVFQGGVCLECFAVEFEKGFQSALKIARLK |
Ga0208975_10502881 | 3300027659 | Freshwater Lentic | VESERGTDMKCVKCGVAIEKIEVFQGGVCLECFAVEFEKGFQSALKIARLK |
Ga0209769_12083212 | 3300027679 | Freshwater Lake | MTKCVKCGVKIGKMEVFPRGVCLSCYAVEFEKEFQSALK |
Ga0209617_100733531 | 3300027720 | Freshwater And Sediment | MVVCAKCGVSIGQFEVFPEGVCIKCYAVEFEKAFQSA |
Ga0209442_13290221 | 3300027732 | Freshwater Lake | MTKCVKCGVKIGKMEVFPRGVCLSCYAVEFEKEFQSALKIARMK |
Ga0209596_100017298 | 3300027754 | Freshwater Lake | VESERRTDMKCVKCGVAVGKMEVFQGGVCLQCYAVEFEKEFQSALKIARLK |
Ga0209246_100429181 | 3300027785 | Freshwater Lake | DILMESERRTDMKCVKCAVVIGRMEVFQGGVCLECFAVEFEKGFQSALKIARLK |
Ga0209107_104369811 | 3300027797 | Freshwater And Sediment | MEKCVKCGVALEKMEVFPYGLCLSCYAVKFEKEFQSALKIARFE |
Ga0209353_101772963 | 3300027798 | Freshwater Lake | VKCGVVIGKMEVFQGGVCLACYAVEFEKEFQSALKIARFK |
Ga0209401_100006886 | 3300027971 | Freshwater Lake | VESERRTDMKCVKCGVAVGKMEVFQSGVCLKCYAEEFEKEFQSALKIARLK |
Ga0209401_100315720 | 3300027971 | Freshwater Lake | MPVVVCAKCGVSIGQFEVFPEGVCVKCFAVEFEKEFQSALKIGRFK |
Ga0315907_102966225 | 3300031758 | Freshwater | EEDGMEKCVKCGVFMEKMEVFPEGVCLKCYAVEFEKEFQSALKIARLK |
Ga0315909_104373834 | 3300031857 | Freshwater | GMEKCVKCGVFMEKMEVFPKGVCLKCYAVEFEKEFQSALKVARLK |
Ga0315909_105016971 | 3300031857 | Freshwater | MKCVKCGVAVEKMEVFPKGVCLACYAVEFEKEFQSALKIARLK |
Ga0315909_109989883 | 3300031857 | Freshwater | PPFGILVESERRTDMKCVKCGVAVGKMEVFQGGVCLKCYAVEFEKEFQSALKIARLK |
Ga0315904_101312308 | 3300031951 | Freshwater | MEKCVKCAVVIEKMEVFQGGVCLACYAVEFEKEFQSALKIARLK |
Ga0315904_102691211 | 3300031951 | Freshwater | MKCVKCGVVIGKFEVFPEEVCVKCYAVEFEKEFQSALKVGRFE |
Ga0315904_105179934 | 3300031951 | Freshwater | TGTVREEDGMEKCVKCGVFMEKMEVFPEGVCLKCYAVEFEKEFQSALKIARLK |
Ga0315904_106803003 | 3300031951 | Freshwater | RGGQIMKCVKCGVAIEKMEVFPKGVCLSCYAVEFEKEFQSALKIARLK |
Ga0315904_107377741 | 3300031951 | Freshwater | MEKCVKCGVFMEKMEVFPEGVCLKCYAVEFEKEFQNALK |
Ga0315904_110492951 | 3300031951 | Freshwater | GTVREEDGMEKCVKCGVFMEKMEVFPKGVCLKCYAVEFEKEFQSALKVARLK |
Ga0315906_107833081 | 3300032050 | Freshwater | MKKCVGCGAFMQEFEVFEKGICVKCYAEEFEKEFQS |
Ga0315906_107966361 | 3300032050 | Freshwater | DGMKKCVGCGAFMQEFEVFEKGICVKCYAVEFEKEFQSALKVARLK |
Ga0315902_101972265 | 3300032093 | Freshwater | MKCVKCGVVIGKFEVFPEEVCVKCYAVEFEKEFQSALKVGRFK |
Ga0315902_108999662 | 3300032093 | Freshwater | MKCVKCGVAIEKMEVFPKGVCLSCYAVEFEKEFQSALKIARLK |
Ga0315903_102550662 | 3300032116 | Freshwater | MEKCVKCAVVIEKMEVFEGGVCLACYAVEFEKEFQSALKIARFK |
Ga0315903_103633561 | 3300032116 | Freshwater | VCVKCGVSIGQFEVFPQQVCVKCYAVEFEKEFQSAIKVGRFK |
Ga0315903_110268512 | 3300032116 | Freshwater | REEDGMEKCVKCGVFMEKMEVFPEGVCLKCYAVEFEKEFQSALKIARLK |
Ga0315903_111220582 | 3300032116 | Freshwater | MKCVKCGVAIEKMEVFPKGVCLACYAVEFEKEFQSALKIARLK |
Ga0334994_0047892_2420_2560 | 3300033993 | Freshwater | MVMEVCVKCGVSIGQFEVFPEQVCVKCYAVEFEKEFQSALKVGRFK |
Ga0334986_0571689_3_122 | 3300034012 | Freshwater | KCGVSIGQFEVFPEQVCVKCYAVEFEKEFQSALKVGRFK |
Ga0334985_0400047_129_260 | 3300034018 | Freshwater | MKCVKCGVVIGKFEVFPEEVCVKCYAVEFEKEFQSALKIGRFK |
Ga0334995_0484221_538_669 | 3300034062 | Freshwater | MKCVKCGVAVGKMEVFPKGVCLACYAVEFEKEFQSALKIARLK |
Ga0334990_0010916_616_750 | 3300034068 | Freshwater | MEKCVKCKVAVEKMEVFPKGVCLACYAVEFEKEFQSALKIARLK |
Ga0335028_0206126_3_110 | 3300034071 | Freshwater | AIEKMEVFPKGVCLSCYAVEFEKEFKSALKIARFK |
Ga0335027_0015495_2551_2685 | 3300034101 | Freshwater | MKKCVGCGAFMQEFEVFEKGICVKCYAEEFEKEFQSALKVARLK |
Ga0335031_0029132_2693_2830 | 3300034104 | Freshwater | MMEKCVKCGVAIEKMEVFPKGVCLACYAVEFEKEFQSALKIARFK |
Ga0335053_0059200_1363_1497 | 3300034118 | Freshwater | MEKCVKCKVAIEKMEVFPKGVCLACYAVEFEKEFQSALKIARLK |
Ga0335056_0485571_64_195 | 3300034120 | Freshwater | MKCVKCGVAVEKMEVFEGGVCLACYAVEFEKEFQSALKVARLK |
⦗Top⦘ |