NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F072333

Metagenome Family F072333

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072333
Family Type Metagenome
Number of Sequences 121
Average Sequence Length 69 residues
Representative Sequence MNIKTKRNLHHWDFPNIQKVEINNVLQDIPELTEENFWTLLDDYNKLIKCFNDSVEILNKEIKDLKSR
Number of Associated Samples 69
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Archaea
% of genes with valid RBS motifs 2.48 %
% of genes near scaffold ends (potentially truncated) 25.62 %
% of genes from short scaffolds (< 2000 bps) 68.60 %
Associated GOLD sequencing projects 53
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (66.116 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(30.578 % of family members)
Environment Ontology (ENVO) Unclassified
(57.851 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(95.868 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.54%    β-sheet: 12.50%    Coil/Unstructured: 48.96%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF00565SNase 7.44
PF10263SprT-like 4.96
PF03692CxxCxxCC 4.96
PF05496RuvB_N 4.13
PF13306LRR_5 3.31
PF00011HSP20 3.31
PF00149Metallophos 2.48
PF03567Sulfotransfer_2 2.48
PF04321RmlD_sub_bind 1.65
PF13589HATPase_c_3 0.83
PF05014Nuc_deoxyrib_tr 0.83
PF05711TylF 0.83
PF00268Ribonuc_red_sm 0.83
PF10504DUF2452 0.83
PF13385Laminin_G_3 0.83
PF01844HNH 0.83
PF137592OG-FeII_Oxy_5 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG2255Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvBReplication, recombination and repair [L] 4.13
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 3.31
COG0451Nucleoside-diphosphate-sugar epimeraseCell wall/membrane/envelope biogenesis [M] 3.31
COG0702Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domainsGeneral function prediction only [R] 3.31
COG1086NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsCCell wall/membrane/envelope biogenesis [M] 3.31
COG1087UDP-glucose 4-epimeraseCell wall/membrane/envelope biogenesis [M] 1.65
COG1088dTDP-D-glucose 4,6-dehydrataseCell wall/membrane/envelope biogenesis [M] 1.65
COG1089GDP-D-mannose dehydrataseCell wall/membrane/envelope biogenesis [M] 1.65
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 1.65
COG1091dTDP-4-dehydrorhamnose reductaseCell wall/membrane/envelope biogenesis [M] 1.65
COG0208Ribonucleotide reductase beta subunit, ferritin-like domainNucleotide transport and metabolism [F] 0.83
COG3613Nucleoside 2-deoxyribosyltransferaseNucleotide transport and metabolism [F] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.12 %
UnclassifiedrootN/A14.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10016584All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon3635Open in IMG/M
3300000115|DelMOSum2011_c10060183All Organisms → Viruses → Predicted Viral1434Open in IMG/M
3300000930|BpDRAFT_10304558All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon658Open in IMG/M
3300001948|GOS2228_1041843All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1545Open in IMG/M
3300004113|Ga0065183_10306886All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon725Open in IMG/M
3300005942|Ga0070742_10002475All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon4786Open in IMG/M
3300005942|Ga0070742_10014415All Organisms → Viruses → Predicted Viral2072Open in IMG/M
3300006029|Ga0075466_1000291All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon18160Open in IMG/M
3300006484|Ga0070744_10037300All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1434Open in IMG/M
3300006484|Ga0070744_10135108All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon709Open in IMG/M
3300006802|Ga0070749_10015259All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon4893Open in IMG/M
3300006803|Ga0075467_10003034All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon13041Open in IMG/M
3300006803|Ga0075467_10016995Not Available4726Open in IMG/M
3300006803|Ga0075467_10112579All Organisms → Viruses → Predicted Viral1606Open in IMG/M
3300006803|Ga0075467_10177952All Organisms → Viruses → Predicted Viral1199Open in IMG/M
3300006803|Ga0075467_10352606All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon773Open in IMG/M
3300006803|Ga0075467_10503524All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_6623Open in IMG/M
3300006919|Ga0070746_10157245All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1104Open in IMG/M
3300006919|Ga0070746_10454061All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon568Open in IMG/M
3300006920|Ga0070748_1006922All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon5026Open in IMG/M
3300006920|Ga0070748_1043572Not Available1800Open in IMG/M
3300006920|Ga0070748_1188711All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon756Open in IMG/M
3300006920|Ga0070748_1250711All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon637Open in IMG/M
3300006920|Ga0070748_1347341All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon523Open in IMG/M
3300007229|Ga0075468_10023990All Organisms → Viruses → Predicted Viral2222Open in IMG/M
3300007229|Ga0075468_10063780All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1223Open in IMG/M
3300007231|Ga0075469_10053024All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_61213Open in IMG/M
3300007231|Ga0075469_10165787All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon598Open in IMG/M
3300007276|Ga0070747_1027863All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon2262Open in IMG/M
3300007276|Ga0070747_1044496All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1716Open in IMG/M
3300007276|Ga0070747_1048819All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1626Open in IMG/M
3300007276|Ga0070747_1050497All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1595Open in IMG/M
3300007276|Ga0070747_1152123Not Available831Open in IMG/M
3300007276|Ga0070747_1311676All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon540Open in IMG/M
3300007552|Ga0102818_1103940All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon564Open in IMG/M
3300007558|Ga0102822_1064212All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon867Open in IMG/M
3300007692|Ga0102823_1060115All Organisms → Viruses → Predicted Viral1013Open in IMG/M
3300008999|Ga0102816_1075718All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1016Open in IMG/M
3300009002|Ga0102810_1043860All Organisms → Viruses → Predicted Viral1448Open in IMG/M
3300009002|Ga0102810_1043948All Organisms → Viruses → Predicted Viral1447Open in IMG/M
3300009002|Ga0102810_1108844All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon861Open in IMG/M
3300009024|Ga0102811_1198527Not Available749Open in IMG/M
3300009026|Ga0102829_1000348Not Available14221Open in IMG/M
3300009026|Ga0102829_1025080All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1719Open in IMG/M
3300009026|Ga0102829_1041144All Organisms → Viruses → Predicted Viral1371Open in IMG/M
3300009054|Ga0102826_1032684All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1293Open in IMG/M
3300009054|Ga0102826_1049898All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1020Open in IMG/M
3300009074|Ga0115549_1001071All Organisms → cellular organisms → Bacteria16884Open in IMG/M
3300009074|Ga0115549_1002974Not Available9301Open in IMG/M
3300009074|Ga0115549_1005884Not Available5955Open in IMG/M
3300009074|Ga0115549_1021971All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon2527Open in IMG/M
3300009076|Ga0115550_1000882All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon23999Open in IMG/M
3300009076|Ga0115550_1047238All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1785Open in IMG/M
3300009079|Ga0102814_10002564Not Available12251Open in IMG/M
3300009423|Ga0115548_1032016All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon2002Open in IMG/M
3300009423|Ga0115548_1041254All Organisms → Viruses → Predicted Viral1696Open in IMG/M
3300009443|Ga0115557_1316919All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon585Open in IMG/M
3300009447|Ga0115560_1073627All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1450Open in IMG/M
3300009447|Ga0115560_1362054All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon549Open in IMG/M
3300010368|Ga0129324_10192413All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon832Open in IMG/M
3300017752|Ga0181400_1108295All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp.811Open in IMG/M
3300018416|Ga0181553_10402473All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon743Open in IMG/M
3300019730|Ga0194001_1006340All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1087Open in IMG/M
3300020165|Ga0206125_10001265Not Available29771Open in IMG/M
3300020165|Ga0206125_10098036All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1250Open in IMG/M
3300021373|Ga0213865_10034571All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon2828Open in IMG/M
3300021373|Ga0213865_10297518All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon753Open in IMG/M
3300021375|Ga0213869_10005728Not Available7845Open in IMG/M
3300021375|Ga0213869_10015653All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon4389Open in IMG/M
3300021375|Ga0213869_10018164All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon4023Open in IMG/M
3300021375|Ga0213869_10102388All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1392Open in IMG/M
3300021378|Ga0213861_10017195All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon5159Open in IMG/M
3300021378|Ga0213861_10480692All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon593Open in IMG/M
3300021379|Ga0213864_10000649All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon15634Open in IMG/M
3300022061|Ga0212023_1003407All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1784Open in IMG/M
3300022072|Ga0196889_1025219All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1223Open in IMG/M
3300022164|Ga0212022_1011115All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1266Open in IMG/M
3300022178|Ga0196887_1086550All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_6723Open in IMG/M
(restricted) 3300023109|Ga0233432_10005470All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon11032Open in IMG/M
(restricted) 3300023109|Ga0233432_10005874All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon10574Open in IMG/M
(restricted) 3300023112|Ga0233411_10033060All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1578Open in IMG/M
3300024180|Ga0228668_1015721All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp.1775Open in IMG/M
3300024183|Ga0228603_1046337All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon659Open in IMG/M
3300024192|Ga0228637_1051154All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon834Open in IMG/M
3300024236|Ga0228655_1076809All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon732Open in IMG/M
3300024294|Ga0228664_1014716Not Available2448Open in IMG/M
3300024320|Ga0233398_1082982All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon775Open in IMG/M
3300024346|Ga0244775_10002644All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon19333Open in IMG/M
3300024346|Ga0244775_10004805Not Available13863Open in IMG/M
3300024346|Ga0244775_10008077Not Available10213Open in IMG/M
3300024346|Ga0244775_10009825Not Available9154Open in IMG/M
3300024346|Ga0244775_10254143All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1464Open in IMG/M
3300024346|Ga0244775_10327370Not Available1268Open in IMG/M
3300024346|Ga0244775_10777528All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon767Open in IMG/M
3300024346|Ga0244775_10858082All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon723Open in IMG/M
3300025570|Ga0208660_1064316All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon874Open in IMG/M
3300025577|Ga0209304_1011821Not Available3140Open in IMG/M
3300025577|Ga0209304_1012689Not Available2989Open in IMG/M
3300025577|Ga0209304_1028102All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1689Open in IMG/M
3300025577|Ga0209304_1028629All Organisms → Viruses → Predicted Viral1665Open in IMG/M
3300025594|Ga0209094_1027624All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1684Open in IMG/M
3300025621|Ga0209504_1000874All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon24641Open in IMG/M
3300025621|Ga0209504_1041260All Organisms → Viruses → Predicted Viral1488Open in IMG/M
3300025626|Ga0209716_1149073All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon607Open in IMG/M
3300025637|Ga0209197_1140566All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon662Open in IMG/M
3300025645|Ga0208643_1032246All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1724Open in IMG/M
3300025645|Ga0208643_1089893All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon859Open in IMG/M
3300025652|Ga0208134_1087212All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp.889Open in IMG/M
3300025652|Ga0208134_1164731All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon546Open in IMG/M
3300025769|Ga0208767_1213524All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon636Open in IMG/M
3300025806|Ga0208545_1054867All Organisms → Viruses → Predicted Viral1165Open in IMG/M
3300025876|Ga0209223_10282392All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon762Open in IMG/M
3300025889|Ga0208644_1056841All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon2131Open in IMG/M
3300026453|Ga0228644_1011149All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1980Open in IMG/M
3300027191|Ga0208021_1010184All Organisms → Viruses → Predicted Viral1441Open in IMG/M
3300027194|Ga0208799_1009287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium1454Open in IMG/M
3300027194|Ga0208799_1022638All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon888Open in IMG/M
3300027320|Ga0208923_1053133All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon720Open in IMG/M
3300028008|Ga0228674_1082183All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon1150Open in IMG/M
(restricted) 3300028045|Ga0233414_10009079All Organisms → cellular organisms → Bacteria3797Open in IMG/M
3300028414|Ga0228627_1019763Not Available2180Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous30.58%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine16.53%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater14.88%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine14.88%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine9.92%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.31%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.65%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.65%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.65%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.83%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.83%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.83%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.83%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.83%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300001948Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012EnvironmentalOpen in IMG/M
3300004113Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019730Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MGEnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300024180Seawater microbial communities from Monterey Bay, California, United States - 82DEnvironmentalOpen in IMG/M
3300024183Seawater microbial communities from Monterey Bay, California, United States - 3DEnvironmentalOpen in IMG/M
3300024192Seawater microbial communities from Monterey Bay, California, United States - 47DEnvironmentalOpen in IMG/M
3300024236Seawater microbial communities from Monterey Bay, California, United States - 67DEnvironmentalOpen in IMG/M
3300024294Seawater microbial communities from Monterey Bay, California, United States - 78DEnvironmentalOpen in IMG/M
3300024320Seawater microbial communities from Monterey Bay, California, United States - 38DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025577Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes)EnvironmentalOpen in IMG/M
3300025594Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430 (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025637Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025876Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026453Seawater microbial communities from Monterey Bay, California, United States - 56DEnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027194Estuarine microbial communities from the Columbia River estuary - metaG S.751 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028414Seawater microbial communities from Monterey Bay, California, United States - 33DEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1001658453300000115MarineMSLNIKTKKNLNLWDFPNVHEVEINDASQDIPQLTEENFWTLIDDYNKLIKCFNDAVESFSKEIKDLRSK*
DelMOSum2011_1006018333300000115MarineMPYCLGMNIKTKRNLHHWDFPDIQKVEINDVLQDIPELTEGNFWTLIDDYNKLIKCFNDSVETLNKEIKELKSR*
BpDRAFT_1030455823300000930Freshwater And MarineMVIKKKKNLGWWDFPNTQKVDINGVEQEVPELTEENFWTLVDDYNKLIKHYNDAVDSLTKEIKDLKDRK*
GOS2228_104184343300001948MarineMIIKKKKNLGWWDFPNTQKVDINGSEQEVPELSEENFWTLIDDYNKLIKHHNDAVDSLTKEIKDLKSR*
Ga0065183_1030688623300004113Pelagic MarineMPYYLGMNIKTKRNLHHWDFPNIQKVEINNVLQDIPELTEENFWTLLDDYNKLIKCFNDSVEILNKEIKDLKSR*
Ga0070742_1000247563300005942EstuarineMLIKNKDNLGWWDFPNTQKVDINGAEQEVPELTEENFWKLIDDYNKLIKHHNDAVHSLTKEIKDLKDRK*
Ga0070742_1001441543300005942EstuarineMIFNMVIKKKKNLGWWDFPNTQKLDINGSQQEVPELTEENFWTLIDDYNKLIKYHNDAVDSLTKEIKDLKSR*
Ga0075466_1000291343300006029AqueousMSINIKTKRNLHHWDFPDIQKVEIKNVLQDIPELTEENFWTLIDDYNKLIKCFNDAVETLSKEIKDLKSR*
Ga0070744_1003730023300006484EstuarineMDMESKDLLNHWDFPDVTKVEINDVLQDIPELTEENFWTLVDDYNKLIKCFNDAVYTFNKEIKELKSR*
Ga0070744_1013510823300006484EstuarineLWDFPNIQKVEINGTEQDIPELTEENLWTLVDDYNTLIKLFNDSIDAFTKEIKNLKNTK*
Ga0070749_10015259113300006802AqueousMNIKKKRNLGWWDFPNTQKVEINGVEQEVPELTEENFWTLVDDYNTLIKNFNDAIDTLTKEIKDLKSR*
Ga0075467_10003034173300006803AqueousMNIKKKKNLHLWDFPNSQKLEINGVEQEIPELTEENFWTLIDDYNTLIKLFNDAVDTLSKELKELKSR*
Ga0075467_1001699553300006803AqueousMDMESKDLLNHWDFPDVTKVEINDVLQDIPELTEENFWTLVDDYNKLIKCFNDTVYTLNKEIKELKSR*
Ga0075467_1011257943300006803AqueousMNIKTKRNLHHWDFPNIQKVEINNVLQDIPELTEENFWTLLDDYNKLIKCFNDSVEILNKEIKDLKSR*
Ga0075467_1017795223300006803AqueousMKKPKKKDNLHLWDFPNIQKVEINGAEQDIPELTEENLWTLVDDYNTLIKLFNDSIDTFTKEIENLKNKK*
Ga0075467_1035260613300006803AqueousMNIKTKRNLHMWDFPNIQKVEINGVEQDVPELTEENFWTLIDDYNKLIKNFNDTVETLNKEIKDLKSK*
Ga0075467_1050352423300006803AqueousMNIKTKRNLHHWDFPNVQKVSINNVSQDVPELTEENFWTLLDDYNKLIKCFNDAVETLNKEIKELKSR*
Ga0070746_1015724513300006919AqueousLNIEYHSVMNIKKKRNLGWWEFPKTQKIEINGAEQEVPELTEENFWTLVDDYNTLIKNFNDAIDVLTKEIKDLKSR*
Ga0070746_1045406113300006919AqueousKRNLGWWDFPNTQKVEINGVEQEVPELTEENFWTLVDDYNTLIKNFNDSVDMLTKEIKDLKSR*
Ga0070748_1006922123300006920AqueousMDMESKDLLNHWDFPDVTKVEINDVLQNIPELTEENFWTLVDDYNKLIKCFNDTVYTLNKEIKELKSR*
Ga0070748_104357223300006920AqueousMSLNIKTKKNLNLWDFPNVHEVEINDASQDIPQLTEENFWTLIDDYNKLIKCFNDAVESFSKEIKDLKSK*
Ga0070748_118871133300006920AqueousMNIKTKKNLNLWDFPNVHEVEINEASRDIPELTEENFWTLIDDYNKLIKCFNDAVEILNKEIKDLKSR*
Ga0070748_125071123300006920AqueousMNIKTKRNLNHWDFPNIQKVGVNDIVQDVPELTEENFWTLIDDYNKLIKCFNDAVETLNKEIKDLKSR*
Ga0070748_134734123300006920AqueousMDMESKDLLNHWDFPNVTKVEINNVLQDIPELTEENFWTLVDDYNKLIKCFNDAVYTLNREIKELKSR*
Ga0075468_1002399043300007229AqueousMWDFPNIQKVEINGVEQDVPELTEENFWTLIDDYNKLIKNFNDTVETLNKEIKDLKSK*
Ga0075468_1006378043300007229AqueousMPYYLGMNIKTKRNLHMWDFPNIQKVGINDIVQDVPELTEENFWTLIDDYNKLVKCFNDAVETL
Ga0075469_1005302423300007231AqueousMNIKTKRNLHHWDFPNVQKVSINNVSQDVPELTEENFWTLLDDYNKLIKCFNDAVETLNKEIKDLKSR*
Ga0075469_1016578713300007231AqueousYYLGMNIKTKRNLHMWDFPNIQKVGINDIVQDVPELTEENFWTLIDDYNKLVKCFNDAVETLSKEIKDLKSR*
Ga0070747_102786373300007276AqueousGMNIKTKRNLHHWDFPNIQKVEINNVLQDIPELTEENFWTLLDDYNKLIKCFNDSVEILNKEIKDLKSR*
Ga0070747_104449653300007276AqueousMNIKTKRNLHHWDFPNIQKVGVNDIVQDVPELTEENFWTLIDDYNKLIKCFNDAVETLNKEIKDLKSR*
Ga0070747_104881933300007276AqueousMPYYLGMNIKTKRNLHMWDFPNIQKVGINDIVQDVPELTEENFWTLIDDYNKLVKCFNDAVETLSKEIKDLKSR*
Ga0070747_105049713300007276AqueousKTMIIKKKKNLGWWDFPNTQKVDINGSEQEVPELSEENFWTLIDDYNKLIKHHNDAVDSLTKEIKDLKSR*
Ga0070747_115212333300007276AqueousMNIKTKRNLHHWDFPDIQKVEINDVLQDIPELTEGNFWTLIDDYNKLIKCFNDSVETLNKEIKELKSR*
Ga0070747_131167623300007276AqueousMNIKTKRNLHHWDFPSIQKVSINNVLQDVPELTEENFWTLLDDYNKLIKCFNDAVETLNKEIKELKS
Ga0102818_110394023300007552EstuarineWDFPNTQKVDINGAEQEVPELTEENFWTLVDDYNKLIKHHNDAVDSLTKEIKDLKDRK*
Ga0102822_106421233300007558EstuarineMVIKKKKNLGWWDFPNTQKLDINGSQQEVPELTEENFWTLIDDYNKLIKYHNDAVDSLTKEIKDLKDRK*
Ga0102823_106011533300007692EstuarineMVIKKKKNLGWWDFPNTQKLDINGSQQEVPELTEENFWTLIDDYNKLIKYHNDAVDSLTKEIKDLKSR*
Ga0102816_107571833300008999EstuarineMKKPKKKDNLHMWDFPNIQKVEINGTEQDIPELTEENLWTLVDDYNTLIKLFNDSIDAFTKEIKNLKNTK*
Ga0102810_104386043300009002EstuarineMNIKKKKSLNLWDFPNVQEVEIDSVKRDIPELTEENFWTLIDDYNTLIKLFNDSIDALTKEIKELKSR*
Ga0102810_104394843300009002EstuarineMVINKKKNLGWWDFPNTQKVDINGAEQEVPELTEENFWTLVDDYNKLIKHHNDAVDSL
Ga0102810_110884413300009002EstuarineMVIKKKKNLGWWDFPNTQKVDINGAEQEVPELTEENFWTLVDDYNKLIKHHNDAVDSLTKEIKDLKDRK*
Ga0102811_119852733300009024EstuarineYYLGMNIKTKRNLHHWDFPNIQKVEINNVLQDIPELTEENFWTLIDDYNKLIKCFNDAIETLNKEIKDLKSR*
Ga0102829_100034873300009026EstuarineMESKDLLNHWDFPDVTKVEINDVLQDIPELTEENFWTLVDDYNKLIKCFNDAVYTFNKEIKELKSR*
Ga0102829_102508043300009026EstuarineMRLKNKDNLNLWDFPNIQKVEINGITRDIPELTEENFWTLIDDYNTLIKVFNDSVTILSKEVADLKSKK*
Ga0102829_104114413300009026EstuarineLHMWDFPNIQKVEINGTEQDIPELTEENLWTLVDDYNTLIKLFNDSIDAFTKEIKNLKNTK*
Ga0102826_103268413300009054EstuarineMVIKKKKNLGWWDFPNTQKVDINGAEQEVPELTEENFWKLIDDYNKLIKHHNDAVHSLTKEIKDLKDRK*
Ga0102826_104989823300009054EstuarineMKKLKKKNPLHFSEFPNTQVVGVDGLEREIPELTEENFWTLVDDYNKLIKCFNDAVYSLNKEIKQLKSR*
Ga0115549_1001071363300009074Pelagic MarineMNIKTKRNLHHWDFPDIQKVEVKNVLQDIPELTEENFWTLIDDYNKLIKCFNDAVETLSKEIKELKSR*
Ga0115549_100297463300009074Pelagic MarineMKKPKKKDNLHLWDFPNIQKVEINGAEQDIPELTEENLWTLIDDYNKLIKLFNDSVDAFTKEIENLKNKK*
Ga0115549_1005884103300009074Pelagic MarineMDMESKDLLNHWDFPDVTKVKINDVLQDIPELTEENFWTLVDDYNKLIKCFNDTVYTLNKEIKELKSR*
Ga0115549_102197143300009074Pelagic MarineMSKKKKKNLGWWDFPDTQKLDINGNEQEVPELTEENFWTLVDDYNSLIKIFNDTVDALSKEIKDLKSR*
Ga0115550_1000882333300009076Pelagic MarineMSLNIKTKRNLHHWDFPDIQKVEVKNVLQDIPELTEENFWTLIDDYNKLIKCFNDAVETLSKEIKELKSR*
Ga0115550_104723853300009076Pelagic MarineTIMSLNIKTKKNLNLWDFPNVHEVEINDASQDIPQLTEENFWTLIDDYNKLIKCFNDAVESFSKEIKDLKSK*
Ga0102814_1000256473300009079EstuarineMLIKNKDNLGWWDFPNTQKVDINGAEQEVPELTEENFWKLIDDYNKLIKHHNDAVDSLTKEIKDLKDRK*
Ga0115548_103201633300009423Pelagic MarineMDMESKDLLNHWDFPHVTKVEINNVLQDIPELTEENFWTLVDDYNKLIKCFNDAVYTLNREIKELKSR*
Ga0115548_104125433300009423Pelagic MarineMNIKTKRNLHHWDFPSIQKVSINNVLQDVPELTEENFWTLLDDYNKLIKCFNDAVETLNKEIKELKSR*
Ga0115557_131691923300009443Pelagic MarineMCLNIKTKRNLHHWDFPDIQKVEVKNVLQDIPELTEENFWTLIDDYNKLIKCFNDAVETLSKEIKELKSR*
Ga0115560_107362713300009447Pelagic MarineRIIRFMSLNIKTKRNLHHWDFPDIQKVEVKNVLQDIPELTEENFWTLIDDYNKLIKCFNDAVETLSKEIKELKSR*
Ga0115560_136205413300009447Pelagic MarineIVFIGCYYTTIMSLNIKTKKNLNLWDFPNVHEVEINDASQDIPQLTEENFWTLIDDYNKLIKCFNDAVESFSKEIKDLRSK*
Ga0129324_1019241333300010368Freshwater To Marine Saline GradientMSINIKTKRNLHHWDFPDIQKVEIKNVLQDIPELTEENFWTLIDDYNKLIKCFNDAVETLSKEIKDLKS
Ga0181400_110829523300017752SeawaterMITNKKGDLGWWDFPDTQKVEINGVEQEFPELTEENFWTLVEDYNKLIKHYNDTVGSLMKEIEDLKDHK
Ga0181553_1040247313300018416Salt MarshMNIKKKRNLGWWEFPNTQKIDINGIEQEVPELTEENFWTLVDDYNTLIKNFNDAIDVLTKEIKDLKLK
Ga0194001_100634033300019730SedimentGRCKIILDSILNIEYHSVMNIKKKRNLGWWEFPKTQKIEINGAEQEVPELTEENFWKLVDDYNTLIKNFNDAIDMLTKEIKDLKSR
Ga0206125_10001265203300020165SeawaterMPYYLGMNIKTKRNLHHWDFPNIQKVEINNVLQDIPELTEENFWTLLDDYNKLIKCFNDSVEILNKEIKDLKSR
Ga0206125_1009803613300020165SeawaterMSKKKKKNLGWWDFPDTQKLDINGNEQEVPELTEENFWTLVDDYNSLIKIFNDTVDALSKEIKDLKSR
Ga0213865_1003457173300021373SeawaterLNIEYHSVMNIKKKRNLGWWEFPKTQKIEINGAEQEVPELTEENFWTLVDDYNTLIKNFNDAIDMLTKEIKDLKSR
Ga0213865_1029751813300021373SeawaterILNIKYHSSMNIKKKRNLGWWEFPNTQKVELNGIEKEIPELTEENFWTLVDDYNTLIKNFNDAIDVLTKEIKDLKSR
Ga0213869_1000572843300021375SeawaterMDMESKDLLNHWDFPDVTKVEINDVLQDIPELTEENFWTLVDDYNKLIKCFNDTVYTLNKEIKELKSR
Ga0213869_1001565363300021375SeawaterMWDFPNIQKVGINDIVQDVPELTEENFWTLIDDYNKLVKCFNDAVETLSKEIKDLKSR
Ga0213869_1001816473300021375SeawaterMPYCLGMNIKTKRNLHHWDFPDIQKVEINDVLQDIPELTEGNFWTLIDDYNKLIKCFNDSVETLNKEIKELKSR
Ga0213869_1010238843300021375SeawaterMNIKTKKNLNLWDFPNVHEVEINEASRDIPELTEENFWTLIDDYNKLIKCFNDAVEILNKEIKDLKSR
Ga0213861_1001719523300021378SeawaterMNIKTKRNLHHWDFPNIQKVEINNVLQDIPELTEENFWTLLDDYNKLIKCFNDSVEILNKEIKDLKSR
Ga0213861_1048069223300021378SeawaterMSINIKTKRNLHHWDFPDIQKVEIKNVLQDIPELTEENFWTLIDDYNKLIKCFNDAVETLSKEIKDLKSR
Ga0213864_10000649253300021379SeawaterMNIKKKRNLGWWEFPKTQKIDINGVEQEVPELTEENFWTLIDDYNTLIKNFNDAIDVLTKEIKDLKSR
Ga0212023_100340743300022061AqueousMSLNIKTKKNLNLWDFPNVHEVEINDASQDIPQLTEENFWTLIDDYNKLIKCFNDAVESFSKEIKDLRSK
Ga0196889_102521933300022072AqueousMDMESKDLLNHWDFPNVTKVEINNVLQDIPELTEENFWTLVDDYNKLIKCFNDAVYTLNREIKELKSR
Ga0212022_101111513300022164AqueousPYYLGMNIKTKRNLHHWDFPNIQKVEINNVLQDIPELTEENFWTLLDDYNKLIKCFNDSVEILNKEIKDLKSR
Ga0196887_108655023300022178AqueousMNIKTKRNLHHWDFPNIQKVGVNDIVQDVPELTEENFWTLIDDYNKLIKCFNDAVETLNKEIKDLKSR
(restricted) Ga0233432_1000547023300023109SeawaterMNIKKKRNLGWWEFPNTTKVEINGIEKEIPELTEDNFWTLVDDYNTLIKNFNDAIDVLTKEIKDLKSSR
(restricted) Ga0233432_1000587473300023109SeawaterMVIKKKKNLGWWDFPNTQKVDINGAEQEVPELTEENFWTLVDDYNKLIKIHNESVEELSKEIRDLKSR
(restricted) Ga0233411_1003306033300023112SeawaterMVIKKKKNLGWWDFPNTQKVDINGAEQEVPELTEENFWTLVDDYNKLIKHHNDAVDSLTKEIKDLKDRK
Ga0228668_101572163300024180SeawaterMIIKKKKNLGWWDFPNTQKVDINGSEQEVPELSEENFWTLIDDYNKLIKHYNDAVDLLTKEIKDLKSR
Ga0228603_104633723300024183SeawaterMIIKKKKSLGWWDFPNTQKIEINGVEQEVPELTEENFWTLVDDYNKLIKIHNEAVEELSKEIRNLKDRK
Ga0228637_105115433300024192SeawaterKKSLGWWDFPNTQKIEINGVEQEVPELTEENFWTLVDDYNKLIKIHNEAVEELSKEIRNLKDRK
Ga0228655_107680913300024236SeawaterMIIGMVIKKKKSLGWWDFPNTQKIEINGVEQEVPELTEENFWTLVDDYNKLIKIHNEAVEELSK
Ga0228664_101471653300024294SeawaterMIIGMVIKKKKSLGWWDFPNTQKIEINGVEQEVPELTEENFWTLVDDYNKLIKIHNEAVEELSKEIRNLKSR
Ga0233398_108298243300024320SeawaterMVIKKKKSLGWWDFPNTQKIEINGVEQEVPELTEENFWTLVDDYNKLIKIHNEAVEELSKEIRNLKSR
Ga0244775_1000264493300024346EstuarineMIFNMVIKKKKNLGWWDFPNTQKLDINGSQQEVPELTEENFWTLIDDYNKLIKYHNDAVDSLTKEIKDLKSR
Ga0244775_10004805223300024346EstuarineMKKPKKKDNLHMWDFPNIQKVEINGTEQDIPELTEENLWTLVDDYNTLIKLFNDSIDAFTKEIKNLKNTK
Ga0244775_10008077203300024346EstuarineMLIKNKDNLGWWDFPNTQKVDINGAEQEVPELTEENFWKLIDDYNKLIKHHNDAVDSLTKEIKDLKDRK
Ga0244775_10009825103300024346EstuarineMDMESKDLLNHWDFPDVTKVEINDVLQDIPELTEENFWTLVDDYNKLIKCFNDAVYTFNKEIKELKSR
Ga0244775_1025414343300024346EstuarineMKKLKKKNPLHFSEFPNTQVVGVDGLEREIPELTEENFWTLVDDYNKLIKCFNDAVYSLNKEIKQLKSR
Ga0244775_1032737033300024346EstuarineMPYYLGMNIKTKRNLHHWDFPNIQKVEINNVLQDIPELTEENFWTLIDDYNKLIKCFNDAIETLNKEIKDLKSR
Ga0244775_1077752833300024346EstuarineMVIKKKKNLGWWDFPNTQKVEINGAEQEVPELTEENFWTLVDDYNKLIKHHNDAVDSLTKEIKDLKDSK
Ga0244775_1085808223300024346EstuarineMNIKKKKSLNLWDFPNVQEVEIDSVKRDIPELTEENFWTLIDDYNTLIKLFNDSIDALTKEIKELKSR
Ga0208660_106431633300025570AqueousMNIKTKRNLHHWDFPNVQKVSINNVSQDVPELTEENFWTLLDDYNKLIKCFNDAVETLN
Ga0209304_101182163300025577Pelagic MarineMKKPKKKDNLHLWDFPNIQKVEINGAEQDIPELTEENLWTLIDDYNKLIKLFNDSVDAFTKEIENLKNKK
Ga0209304_101268913300025577Pelagic MarineMDMESKDLLNHWDFPDVTKVKINDVLQDIPELTEENFWTLVDDYNKLIKCFNDTVYTLNKEIKELKSR
Ga0209304_102810223300025577Pelagic MarineMDMESKDLLNHWDFPHVTKVEINNVLQDIPELTEENFWTLVDDYNKLIKCFNDAVYTLNREIKELKSR
Ga0209304_102862933300025577Pelagic MarineMNIKTKRNLHHWDFPSIQKVSINNVLQDVPELTEENFWTLLDDYNKLIKCFNDAVETLNKEIKELKSR
Ga0209094_102762413300025594Pelagic MarineNIKTKRNLHHWDFPDIQKVEVKNVLQDIPELTEENFWTLIDDYNKLIKCFNDAVETLSKEIKELKSR
Ga0209504_1000874333300025621Pelagic MarineMSLNIKTKRNLHHWDFPDIQKVEVKNVLQDIPELTEENFWTLIDDYNKLIKCFNDAVETLSKEIKELKSR
Ga0209504_104126043300025621Pelagic MarineMKKPKKKDNLHLWDFPNIQKVEINGAEQDIPELTEENLWTLVDDYNTLIKLFNDSIDTFTKEIENLKNKK
Ga0209716_114907313300025626Pelagic MarineMNIKTKRNLHMWDFPNIQKVEINGVEQDVPELTEENFWTLIDDYNKLIKNFNDTVETLNKEIKDLKSKXTGN
Ga0209197_114056623300025637Pelagic MarineMSLNIKTKRNLHHWDFPDIQKVEVKNVLQDIPELTEENFWTLIDDYNKLIKCFNDAVETLSKEIKELKSRXSQXKTIDK
Ga0208643_103224623300025645AqueousMNIKKKKNLHLWDFPNSQKLEINGVEQEIPELTEENFWTLIDDYNTLIKLFNDAVDTLSKELKELKSR
Ga0208643_108989323300025645AqueousMNIKTKRNLHHWDFPNVQKVSINNVSQDVPELTEENFWTLLDDYNKLIKCFNDAVETLNKEIKELKSR
Ga0208134_108721213300025652AqueousMDMESKDLLNHWDFPDVTKVEINDVLQDIPELTEENFWTLVDDYNKLIKCFNDTVYTLNKEIKE
Ga0208134_116473113300025652AqueousWDFPNIQKVEINGVEQDVPELTEENFWTLIDDYNKLIKNFNDTVETLNKEIKDLKSKXTG
Ga0208767_121352423300025769AqueousMNIKKKRNLGWWDFPNTQKVEINGVEQEVPELTEENFWTLVDDYNTLIKNFNDSVDMLTKEIKDLKSR
Ga0208545_105486723300025806AqueousMNIKTKRNLHMWDFPNIQKVEINGVEQDVPELTEENFWTLIDDYNKLIKNFNDTVETLNKEIKDLKSK
Ga0209223_1028239233300025876Pelagic MarineMNIKTKKNLNLWDFPNVHEVEINEASQDIPELTEENFWTLIDDYNKLIKCFNDTVEILNKEIKDLKSR
Ga0208644_105684153300025889AqueousMNIKKKRNLGWWDFPNTQKVEINGVEQEVPELTEENFWTLVDDYNTLIKNFNDAIDTLTKEIKDLKSR
Ga0228644_101114943300026453SeawaterMNIKTKKNLNLWDFPNVHEVEINDASRDIPELTEENFWTLIDDYNKLIKSFNDAVEILNKEIKDLKSR
Ga0208021_101018413300027191EstuarineMIFNMVIKKKKNLGWWDFPNTQKLDINGSQQEVPELTEENFWKLIDDYNKLIKHHNDAVHSLTKEIKDLKDRK
Ga0208799_100928713300027194EstuarineMLIKNKDNLGWWDFPNTQKVDINGAEQEVPELTEENFWKLIDDYNKLIKHHNDAVHSLTKEIKDLKDRK
Ga0208799_102263813300027194EstuarineMIFNMVIKKKKNLGWWDFPNTQKLDINGSQQEVPELTEENFWTLIDDYNKLIKYHNDAVDSLTKE
Ga0208923_105313313300027320EstuarineMRLKNKDNLNLWDFPNIQKVEINGITRDIPELTEENFWTLIDDYNTLIKVFNDSVTILSKEVADLKSKK
Ga0228674_108218323300028008SeawaterMVIKKKKNLGWWDFPNTQKVEINGVEQEVPELTEENFWTLVDDYGKLIKHHNDAVDSLTKEIKDLKDRK
(restricted) Ga0233414_1000907983300028045SeawaterMNIKTKKNLNLWDFPNVHEVEINDASQDIPELTEENFWTLIDDYNKLIKCFNDAVQTLNKEIKDLKSR
Ga0228627_101976363300028414SeawaterLGWWDFPNTQKIEINGVEQEVPELTEENFWTLVDDYNKLIKIHNEAVEELSKEIRNLKSR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.