NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072645

Metagenome / Metatranscriptome Family F072645

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072645
Family Type Metagenome / Metatranscriptome
Number of Sequences 121
Average Sequence Length 69 residues
Representative Sequence MNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKKHDCFWEPDEG
Number of Associated Samples 90
Number of Associated Scaffolds 121

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 40.00 %
% of genes near scaffold ends (potentially truncated) 38.84 %
% of genes from short scaffolds (< 2000 bps) 68.60 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.860 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(22.314 % of family members)
Environment Ontology (ENVO) Unclassified
(35.537 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(42.149 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 31.00%    β-sheet: 0.00%    Coil/Unstructured: 69.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 121 Family Scaffolds
PF00892EamA 33.88
PF00581Rhodanese 29.75
PF07883Cupin_2 7.44
PF13229Beta_helix 4.13
PF01750HycI 2.48
PF12708Pectate_lyase_3 1.65
PF04011LemA 0.83
PF00190Cupin_1 0.83
PF11028DUF2723 0.83
PF02470MlaD 0.83
PF01593Amino_oxidase 0.83
PF01588tRNA_bind 0.83
PF16363GDP_Man_Dehyd 0.83
PF13189Cytidylate_kin2 0.83
PF00005ABC_tran 0.83
PF02405MlaE 0.83
PF03484B5 0.83
PF14720NiFe_hyd_SSU_C 0.83
PF09723Zn-ribbon_8 0.83
PF02912Phe_tRNA-synt_N 0.83
PF01370Epimerase 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 121 Family Scaffolds
COG0680Ni,Fe-hydrogenase maturation factorEnergy production and conversion [C] 2.48
COG0016Phenylalanyl-tRNA synthetase alpha subunitTranslation, ribosomal structure and biogenesis [J] 0.83
COG0072Phenylalanyl-tRNA synthetase beta subunitTranslation, ribosomal structure and biogenesis [J] 0.83
COG0073tRNA-binding EMAP/Myf domainTranslation, ribosomal structure and biogenesis [J] 0.83
COG0767Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter MlaCell wall/membrane/envelope biogenesis [M] 0.83
COG1704Magnetosome formation protein MamQ, lipoprotein antigen LemA familyCell wall/membrane/envelope biogenesis [M] 0.83
COG2517Predicted RNA-binding protein, contains C-terminal EMAP domainGeneral function prediction only [R] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.26 %
UnclassifiedrootN/A10.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000553|TBL_comb47_HYPODRAFT_10115597All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales1265Open in IMG/M
3300001398|JGI20207J14881_1061256Not Available642Open in IMG/M
3300002933|G310J44882_10027880All Organisms → cellular organisms → Bacteria1381Open in IMG/M
3300003796|Ga0007865_1025105Not Available546Open in IMG/M
3300003797|Ga0007846_1009766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella945Open in IMG/M
3300004802|Ga0007801_10132769All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia714Open in IMG/M
3300004806|Ga0007854_10009423All Organisms → cellular organisms → Bacteria5584Open in IMG/M
3300004806|Ga0007854_10018559All Organisms → cellular organisms → Bacteria3798Open in IMG/M
3300004806|Ga0007854_10022447All Organisms → cellular organisms → Bacteria3390Open in IMG/M
3300004806|Ga0007854_10023234All Organisms → cellular organisms → Bacteria3325Open in IMG/M
3300005327|Ga0070658_10124229All Organisms → cellular organisms → Bacteria2147Open in IMG/M
3300005563|Ga0068855_100132771All Organisms → cellular organisms → Bacteria2842Open in IMG/M
3300005827|Ga0074478_1151584All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1281Open in IMG/M
3300005827|Ga0074478_1422543All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300006052|Ga0075029_100302666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1021Open in IMG/M
3300006104|Ga0007882_10001027All Organisms → cellular organisms → Bacteria16493Open in IMG/M
3300006104|Ga0007882_10019785All Organisms → cellular organisms → Bacteria3133Open in IMG/M
3300006104|Ga0007882_10051849All Organisms → cellular organisms → Bacteria1675Open in IMG/M
3300006120|Ga0007867_1090212All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia662Open in IMG/M
3300006126|Ga0007855_1125416All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia531Open in IMG/M
3300006174|Ga0075014_100036298All Organisms → cellular organisms → Bacteria2029Open in IMG/M
3300006174|Ga0075014_100684726Not Available595Open in IMG/M
3300006174|Ga0075014_100823330Not Available550Open in IMG/M
3300009502|Ga0114951_10034353All Organisms → cellular organisms → Bacteria3205Open in IMG/M
3300009502|Ga0114951_10106326All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1590Open in IMG/M
3300009548|Ga0116107_1061629All Organisms → cellular organisms → Bacteria1230Open in IMG/M
3300012411|Ga0153880_1053298All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia533Open in IMG/M
3300012411|Ga0153880_1053430All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia582Open in IMG/M
3300012411|Ga0153880_1175472All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia599Open in IMG/M
3300012686|Ga0157560_1065125All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia733Open in IMG/M
3300012691|Ga0157569_1052935All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia726Open in IMG/M
3300012692|Ga0157571_1044073All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia745Open in IMG/M
3300012924|Ga0137413_11458889Not Available555Open in IMG/M
3300013093|Ga0164296_1000143All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula89582Open in IMG/M
3300013094|Ga0164297_10000061All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula131613Open in IMG/M
3300014160|Ga0181517_10101034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1677Open in IMG/M
3300014168|Ga0181534_10010946All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales4801Open in IMG/M
3300014493|Ga0182016_10004458All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia15471Open in IMG/M
3300014499|Ga0182012_10000517All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula42777Open in IMG/M
3300014499|Ga0182012_10006124All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales12317Open in IMG/M
3300014499|Ga0182012_10987254All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia529Open in IMG/M
3300014501|Ga0182024_10009720All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula19804Open in IMG/M
3300014838|Ga0182030_10032008All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula9207Open in IMG/M
3300014838|Ga0182030_10675247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella975Open in IMG/M
3300014838|Ga0182030_10680346All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300015242|Ga0137412_10903027Not Available640Open in IMG/M
3300016688|Ga0180039_1126031All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia694Open in IMG/M
3300016692|Ga0180040_1064272All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia635Open in IMG/M
3300016728|Ga0181500_1015556All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia507Open in IMG/M
3300019270|Ga0181512_1455939All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia630Open in IMG/M
3300020695|Ga0214190_1000044All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula47870Open in IMG/M
3300020732|Ga0214201_1040401All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium719Open in IMG/M
3300021138|Ga0214164_1000032All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula101528Open in IMG/M
3300021474|Ga0210390_10508020All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales1015Open in IMG/M
3300021475|Ga0210392_10689647All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium760Open in IMG/M
3300022555|Ga0212088_10082974All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula3076Open in IMG/M
3300022863|Ga0224532_1004882All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales1619Open in IMG/M
3300023068|Ga0224554_1061799All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300023068|Ga0224554_1079566All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia787Open in IMG/M
3300023088|Ga0224555_1027819All Organisms → cellular organisms → Bacteria2475Open in IMG/M
3300025162|Ga0209083_1287502All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia588Open in IMG/M
3300025395|Ga0208109_1010204All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1479Open in IMG/M
3300025416|Ga0208877_1028609All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300025420|Ga0208111_1020526All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300025591|Ga0208496_1047459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1028Open in IMG/M
3300025648|Ga0208507_1002301All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula9952Open in IMG/M
3300025648|Ga0208507_1027721All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2056Open in IMG/M
3300025679|Ga0207933_1006704All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula6018Open in IMG/M
3300025788|Ga0208873_1044144All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia714Open in IMG/M
3300025788|Ga0208873_1059426All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia595Open in IMG/M
3300025838|Ga0208872_1007477All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula5531Open in IMG/M
3300025838|Ga0208872_1022161All Organisms → cellular organisms → Bacteria2928Open in IMG/M
3300025838|Ga0208872_1146042All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia828Open in IMG/M
3300025865|Ga0209226_10202357All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium870Open in IMG/M
3300025888|Ga0209540_10400271Not Available749Open in IMG/M
3300025909|Ga0207705_10267534All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300025949|Ga0207667_10146561All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2430Open in IMG/M
3300026502|Ga0255350_1128481Not Available533Open in IMG/M
3300028572|Ga0302152_10072147All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1077Open in IMG/M
3300028572|Ga0302152_10185432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella671Open in IMG/M
3300028745|Ga0302267_10002429All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula22585Open in IMG/M
3300028745|Ga0302267_10072042All Organisms → cellular organisms → Bacteria1800Open in IMG/M
3300028748|Ga0302156_10204137All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia926Open in IMG/M
3300028762|Ga0302202_10122234All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1448Open in IMG/M
3300028779|Ga0302266_10052040All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1822Open in IMG/M
3300028779|Ga0302266_10198278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella763Open in IMG/M
3300028785|Ga0302201_10001385All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia20886Open in IMG/M
3300028785|Ga0302201_10053717All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300028788|Ga0302189_10246672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella732Open in IMG/M
3300028854|Ga0302268_1062768All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia943Open in IMG/M
3300028866|Ga0302278_10047010All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2726Open in IMG/M
3300028882|Ga0302154_10516382Not Available567Open in IMG/M
3300029883|Ga0311327_10750213Not Available573Open in IMG/M
3300029954|Ga0311331_10316041All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1650Open in IMG/M
3300029955|Ga0311342_10308206All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300029957|Ga0265324_10000250All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula39869Open in IMG/M
3300029957|Ga0265324_10022204All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2270Open in IMG/M
3300029957|Ga0265324_10121853All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula886Open in IMG/M
3300029957|Ga0265324_10153729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella781Open in IMG/M
3300029957|Ga0265324_10229348Not Available630Open in IMG/M
3300029982|Ga0302277_1215157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella742Open in IMG/M
3300029986|Ga0302188_10356507Not Available600Open in IMG/M
3300029992|Ga0302276_10024596All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula4145Open in IMG/M
3300030011|Ga0302270_10415013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella715Open in IMG/M
3300030020|Ga0311344_10761966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella794Open in IMG/M
3300030041|Ga0302274_10085141All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1741Open in IMG/M
3300030044|Ga0302281_10238080All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia747Open in IMG/M
3300030519|Ga0302193_10135384All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300031231|Ga0170824_102617916All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1799Open in IMG/M
3300031258|Ga0302318_10296644All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia802Open in IMG/M
3300031261|Ga0302140_10475116All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia979Open in IMG/M
3300031344|Ga0265316_10154587All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1717Open in IMG/M
3300031813|Ga0316217_10039338All Organisms → cellular organisms → Bacteria2705Open in IMG/M
3300031813|Ga0316217_10066935All Organisms → cellular organisms → Bacteria1791Open in IMG/M
3300032562|Ga0316226_1003282All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula14037Open in IMG/M
3300032562|Ga0316226_1106146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella1304Open in IMG/M
3300032675|Ga0316225_1044305All Organisms → cellular organisms → Bacteria1704Open in IMG/M
3300034282|Ga0370492_0009577All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula3950Open in IMG/M
3300034282|Ga0370492_0194940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella826Open in IMG/M
3300034818|Ga0373950_0037564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella917Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog22.31%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater18.18%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater5.79%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.79%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog5.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere4.96%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil4.13%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.31%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.31%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.48%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.65%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.65%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.65%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.65%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.65%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.65%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater0.83%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.83%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.83%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.83%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000553Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem)EnvironmentalOpen in IMG/M
3300001398Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012EnvironmentalOpen in IMG/M
3300002933Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USAEnvironmentalOpen in IMG/M
3300003796Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul09EnvironmentalOpen in IMG/M
3300003797Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE19Jun07EnvironmentalOpen in IMG/M
3300004802Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2MEnvironmentalOpen in IMG/M
3300004806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005827Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBAEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006104Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1EnvironmentalOpen in IMG/M
3300006120Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08EnvironmentalOpen in IMG/M
3300006126Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300009502Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaGEnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300012411Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012686Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES055 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012691Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES070 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012692Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES073 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013093Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaGEnvironmentalOpen in IMG/M
3300013094Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016688Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES053 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016692Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES100 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016728Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019270Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020695Freshwater microbial communities from Trout Bog Lake, WI - 15JUL2008 epilimnionEnvironmentalOpen in IMG/M
3300020732Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 epilimnionEnvironmentalOpen in IMG/M
3300021138Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnionEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300022863Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 1-5EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300025162Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025395Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul08 (SPAdes)EnvironmentalOpen in IMG/M
3300025416Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29Jun09 (SPAdes)EnvironmentalOpen in IMG/M
3300025420Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300025591Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA2M (SPAdes)EnvironmentalOpen in IMG/M
3300025648Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 (SPAdes)EnvironmentalOpen in IMG/M
3300025679Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025788Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH01Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300025838Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 (SPAdes)EnvironmentalOpen in IMG/M
3300025865Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026502Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1EnvironmentalOpen in IMG/M
3300028572Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_1EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_2EnvironmentalOpen in IMG/M
3300028854Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_1EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029953II_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300029982Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1EnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300029992Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3EnvironmentalOpen in IMG/M
3300030011Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030041Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_1EnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030519Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300032562Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017EnvironmentalOpen in IMG/M
3300032675Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TBL_comb47_HYPODRAFT_1011559723300000553FreshwaterMNPFLQNMNGTTTGANAHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSFDEA*
JGI20207J14881_106125623300001398Arctic Peat SoilMNPFLQNLDGTTTGTLSHAHLLVAESGGIITLESPAAVMAEVEFRTTHISSLLAEMFEETARHDCFWSPDET*
G310J44882_1002788023300002933FreshwaterMDLFLQKMNSATLGTAAHAHLLVAESGGLVALESPEAVMKEVAFRANYVTSLLEGIFEESKKHDFFWKPDEG*
Ga0007865_102510523300003796FreshwaterMNGTTTGANAHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSFDEA*
Ga0007846_100976613300003797FreshwaterMNPFLQNMNGTTTGANAHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSPDEG*
Ga0007801_1013276913300004802FreshwaterTTTGANAHAHLLVAESDGMVTLESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSPDEG*
Ga0007854_1000942363300004806FreshwaterMSGMNPSLHKLGGSTTGYASHAHLLVAESGGLVTLESPEAVMEEVEFRATHVSALLAEMFEESKKHDNFWELNES*
Ga0007854_1001855953300004806FreshwaterMDPFRNNLSGTTTDTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHISSLLEAMFEETKKHDRFWEPDEG*
Ga0007854_1002244753300004806FreshwaterMSGMDPFLHNKMGGTTTGTPAHAHLLVAESGGLVTMESPTAVMEEVAFRATHVSSLLEKMFEEAKKHDNFWSPEEP*
Ga0007854_1002323433300004806FreshwaterMNPTLNRLGGTTTGTISHAHLLVAESGGLVTLENAEAVMEEVEFRATHVSSLLAEMFEEARKHDSFWEPEEN*
Ga0070658_1012422933300005327Corn RhizosphereMTPILNKIDVTRPDPGVHAHLLVTESGGLVALESPAAIMEEVEFRATHVSSLMEEMFKEAGKHDLWEIDEA*
Ga0068855_10013277123300005563Corn RhizosphereMSGMTPILNKIDVTRPDPGVHAHLLVTESGGLVALESPAAIMEEVEFRATHVSSLMEEMFKEAGKHDLWEIDEA*
Ga0074478_115158413300005827Sediment (Intertidal)MTPNLNKLGSTTTGTGSHAHLLVAESGGLMTLESPGAVMEEVEFRATHVSLLMEEMFAEARKHDFWEMDEA*
Ga0074478_142254323300005827Sediment (Intertidal)MTPRIDKPGGTTTGMCGHAHLLVAESGGLITLESPEAVMEEVEFRATHVSSLMEEMFAEAKKHDFWELDEA*
Ga0075029_10030266623300006052WatershedsMDPLLNKLSGTTTGRATRAHLLVAESGGLVTMESPKAVMEEVAFRATHVSSLLEEMFEELKKRDSFWEPDEG*
Ga0007882_1000102783300006104FreshwaterMDPFRNNLSGTTTDTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHISSLLEAMFEESKKHDRFWEPDEG*
Ga0007882_1001978533300006104FreshwaterMNPTRNRLGGTTTGATQHAHLMVAESGGLTTPTLENAEAVMEEVEFRATHVSLLLANMFEEARKHDSFREPEGN*
Ga0007882_1005184933300006104FreshwaterMNPFLQNMNGTTTGANAHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFW
Ga0007867_109021223300006120FreshwaterKTEQRSGMNPFLQNMNGTTTGANAHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSPDEG*
Ga0007855_112541613300006126FreshwaterNPTLNRLGGTTTGTISHAHLLVAESGGLVTLENAEAVMEEVEFRATHVSSLLAEMFEEARKHDSFWEPEEN*
Ga0075014_10003629833300006174WatershedsMDLFLQKMSSATLGTAAHAHLLVAESGGLVALESPEAVMKEVAFRANYITSLLEEIFAESKKHDFFWKPDEG*
Ga0075014_10068472623300006174WatershedsMDPFQHNTSGTSPVTSHHAHLLVGESGGLILMETPEAVMEEVEFRTTHISSLLEEMFEETKKHDRFWEPDVA*
Ga0075014_10082333013300006174WatershedsMDPFQNKLSGTTTGTGTHAHLLVAESGGLVLLESPEAVMEEVEFRTTHISSLLEEMFEESKKHDNFWQPDEG*
Ga0114951_1003435323300009502FreshwaterMNPFLQNLDGTNTGTLSHAHLLVAEGGGLVALESPAAVMAEVEFRTTHVSMLLTEMFEEAARHDSFWSFDEA*
Ga0114951_1010632613300009502FreshwaterRQLSGMDPFRNNLSGTTTGTGSHAHLLVAESGGLVLRETPEAVMEEVEFRTTHISSLLEEMFEEAKKHDNFWEPDEG*
Ga0116107_106162933300009548PeatlandMDPIRHELGGTATGTGPHAHLLVAESGGLVTLELPEAVMEEVEFRTTHISSLLEEMFEESKK
Ga0153880_105329823300012411Freshwater SedimentLHPFRNNLSGTTTGTGSHAHLLVAESGGLVLRETPEAVMEEVEFRTTHISSLLEEMFEEAKKHDNFWEPDEG*
Ga0153880_105343023300012411Freshwater SedimentHAHLLVAESGGLIALESPEAVMEEVAFRATHVSSLLAEMFEESKRHDCFWSPDEG*
Ga0153880_117547223300012411Freshwater SedimentLQNLDGTNTGTLSHAHLLVAEGGGLVALESPAAVMAEVEFRTTHVSMLLTEMFEEAARHDSFWSFDEA*
Ga0157560_106512523300012686FreshwaterQNMNGTTTGANTHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSPDEG*
Ga0157569_105293513300012691FreshwaterNMNGTTTGANTHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSPDEG*
Ga0157571_104407323300012692FreshwaterLQNMNGTTTGANTHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSPDEG*
Ga0137413_1145888923300012924Vadose Zone SoilMTPNLNKLGGTTTGTGDHAHLLVAESGGLITLESPEAVMEEVEFRATHVSSLMEEMFAEARKHDFWEMDEA*
Ga0164296_1000143533300013093FreshwaterMNPFLQNMNGTTTGANTHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKQHDCFWSPDEG*
Ga0164297_10000061193300013094FreshwaterMNPFLQNMNGTTTGANTHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSPDEG*
Ga0181517_1010103423300014160BogMDPIRHELGGTATGTGPHAHLLVAESGGLVTLELPEAVMEEVEFRTTHISSLLEEMFEESKKHDSFWEPDEE*
Ga0181534_1001094653300014168BogMDPFRNNLSGTITGTGSHAHLLVAESGGLVLMETPEAVMEEVEFRTTHVSSLLEEMFEEAKKHDNFWEPDEG*
Ga0182016_10004458173300014493BogMNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKKHDCFWEPDEG*
Ga0182012_1000051763300014499BogMNPSRQILQGTATGTIQHAHLLVTESGGLVAQESSEAVMAEVAFRTTHVGSLLEEMFKETKKHDCFWPPDNG*
Ga0182012_1000612423300014499BogMDPFRNNLSGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKNHDCFWEPDEG*
Ga0182012_1098725413300014499BogAHLLVAESGGLVLRETPEAVMEEVEFRTTHISSLLEEMFEEAKKHDNFWEPDEG*
Ga0182024_1000972053300014501PermafrostMDPFLQKMSVTTTGTTHHAHLLVAESGGLVAMESPEAVMEEVAFRATHISSLLEEMLEEAGKHDSFWPPDQA*
Ga0182030_1003200823300014838BogMNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEEAKKHDNFWEPDEG*
Ga0182030_1067524723300014838BogMDPFRNNLSGTTTGTGSHAHLLVAESGGLVLMETPEAVMEEVEFRTTHISSLLEEMFEESKKHDCFWEPDEG*
Ga0182030_1068034623300014838BogMDPIRHELGGTTTDTGSHAHLLVAESGGLVTLETPEAVMEEVEFRTTHISSLLEEILEESGKHDSFWEPDEE*
Ga0137412_1090302723300015242Vadose Zone SoilMTPNLNKLGGTTTGTGAHAHLLVAESGGLVTLESPEAVMEEVEFRATHVSSLMEEMFAEARKHDFWEMDEA*
Ga0180039_112603123300016688FreshwaterNGTTTGANTHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSPDEG
Ga0180040_106427213300016692FreshwaterQNMNGTTTGANTHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSPDEG
Ga0181500_101555613300016728PeatlandSGTITGTGSHAHLLVAESGGLVLMETPEAVMEEVEFRTTHVSSLLEEMFEEAKKHDNFWEPDEG
Ga0181512_145593913300019270PeatlandNNLSGTITGTGSHAHLLVAESGGLVLMETPEAVMEEVEFRTTHVSSLLEEMFEEAKKHDNFWEPDEG
Ga0214190_1000044173300020695FreshwaterMNPFLQNMNGTTTGANTHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSPDEG
Ga0214201_104040123300020732FreshwaterMNPFLQNMNGTTTGANAHAHLLVAGSGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSFDEA
Ga0214164_1000032733300021138FreshwaterMNPFLQNMNGTTTGANAHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSFDEA
Ga0210390_1050802023300021474SoilMSGMDPFRHELSGTTTGTGSHAHLLVAESSGVVLMETPEAVMEEVEFRTTHISSLLEEMFEESKKHDSFWEPDEG
Ga0210392_1068964723300021475SoilMNQFRHNLSGTNTGAGSHAHLLVAESGGVVLPETPEAVMEEVAFRATHVSSMLEKMFEESKKHDCFWRRDEV
Ga0212088_1008297443300022555Freshwater Lake HypolimnionMNPFLQNLDGTNTGTLSHAHLLVAEGGGLVALESPAAVMAEVEFRTTHVSMLLTEMFEEAARHDSFWSFDEA
Ga0224532_100488223300022863SoilMNPFPQKMLGPPTVGTASHAHLLVAESGGLVTLESPEAVMEEVEFRATYIGPLLEELFAEARQHDGFWSPDQG
Ga0224554_106179913300023068SoilMNPFLQKMDGTTTGVEGHAHLLVAESGGLVTLESPEAVMAEVGFRAEHISSLIREMFEEAGKH
Ga0224554_107956623300023068SoilGHAHLLVAESGGLVTLESPEAVMAEVGFRAEHISSLIREMFEEAGKHDCFWEPDNE
Ga0224555_102781933300023088SoilMDPIRHELGGTTTDTGSHAHLLVAESGGLVTLETPEAVMEEVEFRTTHISSLLEEILEESGKHDSFWEPDEE
Ga0209083_128750223300025162FreshwaterMNPTLNRLGGTTTGTISHAHLLVAESGGLVLRETPEAVMEEVEFRTTHISSLLEEMFEEAKKHDNFWEPDEG
Ga0208109_101020423300025395FreshwaterMSGMDPFLHNKMGGTTTGTPAHAHLLVAESGGLVTMESPTAVMEEVAFRATHVSSLLEKMFEEAKKHDNFWSPEEP
Ga0208877_102860923300025416FreshwaterMNPFLQNMNGTTTGANAHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSSLLAEMFEESKKHDCFWSPDEG
Ga0208111_102052633300025420FreshwaterMDPFRNNLSGTTTDTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHISSLLEAMFEETKKHDRFWEPDEG
Ga0208496_104745913300025591FreshwaterMNPFLQNMNGTTTGANAHAHLLVAESGGLVALESPEAVMAEVEFRTTHVSALMTEMFEESKKHDC
Ga0208507_100230183300025648FreshwaterMDPFRNNLSGTTTDTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHISSLLEAMFEESKKHDRFWEPDEG
Ga0208507_102772113300025648FreshwaterMNPTRNRLGGTTTGATQHAHLMVAESGGLTTPTLENAEAVMEEVEFRATHVSLLLANMFEEARKHDSFREPEGN
Ga0207933_100670423300025679Arctic Peat SoilMNPFLQNLDGTTTGTLSHAHLLVAESGGIITLESPAAVMAEVEFRTTHISSLLAEMFEETARHDCFWSPDET
Ga0208873_104414413300025788FreshwaterNPTLNRLGGTTTGTISHAHLLVAESGGLVTLENAEAVMEEVEFRATHVSSLLAEMFEEARKHDSFWEPEEN
Ga0208873_105942623300025788FreshwaterMDPFLHNKMGGTTTGTPAHAHLLVAESGGLVTMESPTAVMEEVAFRATHVSSLLEKMFEEAKKHDNFWSPEEP
Ga0208872_100747763300025838FreshwaterMSGMNPSLHKLGGSTTGYASHAHLLVAESGGLVTLESPEAVMEEVEFRATHVSALLAEMFEESKKHDNFWELNES
Ga0208872_102216163300025838FreshwaterTGTPAHAHLLVAESGGLVTMESPTAVMEEVAFRATHVSSLLEKMFEEAKKHDNFWSPEEP
Ga0208872_114604223300025838FreshwaterMNPTLNRLGGTTTGTISHAHLLVAESGGLVTLENAEAVMEEVEFRATHVSSLLAEMFEEARKHDSFWEPEEN
Ga0209226_1020235723300025865Arctic Peat SoilMDPFLHKISSPVTGTSSHAHLLVAESGGLIAMESPEAVMEEVEFRATHVSSLLEEIFEESKKHENFWEPDEP
Ga0209540_1040027143300025888Arctic Peat SoilAHLLVAESGGLIAMESPEAVMEEVEFRATHVSSLLEEIFEESKKHENFWEPDEP
Ga0207705_1026753423300025909Corn RhizosphereMTPILNKIDVTRPDPGVHAHLLVTESGGLVALESPAAIMEEVEFRATHVSSLMEEMFKEAGKHDLWEIDEA
Ga0207667_1014656133300025949Corn RhizosphereMSGMTPILNKIDVTRPDPGVHAHLLVTESGGLVALESPAAIMEEVEFRATHVSSLMEEMFKEAGKHDLWEIDEA
Ga0255350_112848113300026502SoilSGMNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEEAKKHDNFWEPDEG
Ga0302152_1007214723300028572BogMNPSRQILQGTATGTIQHAHLLVTESGGLVAQESSEAVMAEVAFRTTHVGSLLEEMFKETKKHDCFWPPDNG
Ga0302152_1018543213300028572BogMNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEEAKKHDNFW
Ga0302267_1000242973300028745BogMNPFPLKMPGPPTVGAASHAHLLVAESGGLVTLESPEAVMEEVEFRATYIGTLLEELFAEARQHDGFWSPDQG
Ga0302267_1007204233300028745BogMNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEEAKKHDNFWEPDEG
Ga0302156_1020413713300028748BogMNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKKHDCFWEPDEG
Ga0302202_1012223443300028762BogMNPFPLKMPGPPTVGAASHAHLLVAESGGLVTLESPEAVMEEVEFRATYIGTLLEELFAE
Ga0302266_1005204013300028779BogMNPFPQKMPRPPTVGVVSHAHLLVAESGGLVTLESPEAVMDEVEFRATYIGPLLEELFAEAKKHDGFWSPDEG
Ga0302266_1019827813300028779BogMDPFRNNLSGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEES
Ga0302201_1000138513300028785BogGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKKHDCFWEPDEG
Ga0302201_1005371733300028785BogMNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEEAKKH
Ga0302189_1024667213300028788BogMDPFRNNLSGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKKHDCF
Ga0302268_106276813300028854BogAQTGQLSGMNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKKHDCFWEPDEG
Ga0302278_1004701053300028866BogMPRPPTVGVVSHAHLLVAESGGLVTLESPEAVMDEVEFRATYIGPLLEELFAEAKKHDGFWSPDEG
Ga0302154_1051638213300028882BogCNFAQTRQLSGMDPFRNNLSGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKKHDCFWEPDEG
Ga0311327_1075021313300029883BogVSHAHLLVAESGGLVTLESPEAVMDEVEFRATYIGPLLEELFAEAKKHDGFWSPDEG
Ga0311343_1146963113300029953BogLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEEAKKHDNFWEPDEG
Ga0311331_1031604113300029954BogLKMPGPPTVGAASHAHLLVAESGGLVTLESPEAVMEEVEFRATYIGTLLEELFAEARQHDGFWSPDQG
Ga0311342_1030820613300029955BogMNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKKHDC
Ga0265324_10000250353300029957RhizosphereMSGMNPTLDKLGGTTMGTASHAHLLVAESGGLIARESPEAVMEEVEFRATHVSSVLAEMFEEIETGKHDSFWEPEAT
Ga0265324_1002220453300029957RhizosphereMDPLLNKMSGTTTGTGSHAHLLIAESGGLVTMESPEEVMEEVAFRATHVSSLLEEIFEELKKHDSFWGPDEG
Ga0265324_1012185323300029957RhizosphereMNPSLNKLGGPITGNTSHAHLLVAESGGLVTLESPEAVMEEVEFRATHVSSLLTEMFEESKKHDNFWEVNEV
Ga0265324_1015372913300029957RhizosphereMDPLLNKMSGTTTGTGSHAHLLVAESGGLVTMESPEAVMEEVAFRATHVGSLLEAMFEEMNKHDGFWEPDEG
Ga0265324_1022934823300029957RhizosphereGSHAHLLIAESGGLVTMESPEAVMEEVAFRATHVGSLLEEMFEELKKHDSFWEADEG
Ga0302277_121515723300029982BogMNPFPQKMPRPPTVGVVSHAHLLVAESGGLVTLESPEAVMDEVEFRATYIGPLLEELFAEAKKHDGF
Ga0302188_1035650713300029986BogMNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEE
Ga0302276_1002459613300029992BogSNTCIFTRTARWSGMNPSRQILQGTATGTIQHAHLLVTESGGLVAQESSEAVMAEVAFRTTHVGSLLEEMFKETKKHDCFWPPDNG
Ga0302270_1041501323300030011BogMNPFPQKMPRPPTVGVVSHAHLLVAESGGLVTLESPEAVMDEVEFRATYIGPLLEELFAEAKKH
Ga0311344_1076196613300030020BogMDPFRNNLSGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKKHDCFWEPDE
Ga0302274_1008514123300030041BogMDPFRNNLSGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKKHDCFWEPDEG
Ga0302281_1023808013300030044FenGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEEAKKHDNFWEPDEG
Ga0302193_1013538433300030519BogMNPFLQKMGGTTTGTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHVSSLLEEMFEESKKHDCFWEPDE
Ga0170824_10261791643300031231Forest SoilMNPFLQNMGGTATGASSHAHLLVAESGGIIALESPAAVMAEVEFRTTHVSSLLEEMFEDAKKHDCFRLPDET
Ga0302318_1029664413300031258BogFTRTARWSGMNPSRQILQGTATGTIQHAHLLVTESGGLVAQESSEAVMAEVAFRTTHVGSLLEEMFKETKKHDCFWPPDNG
Ga0302140_1047511623300031261BogGTIQHAHLLVTESGGLVAQESSEAVMAEVAFRTTHVGSLLEEMFKETKKHDCFWPPDNG
Ga0265316_1015458723300031344RhizosphereMNPTLDKLGGTTMGTASHAHLLVAESGGLIARESPEAVMEEVEFRATHVSSVLAEMFEEIETGKHDSFWEPEAT
Ga0316217_1003933833300031813FreshwaterMDPFRNNLSGTTTGTGSHAHLLVAESGGLVLMETPEAVMEEVEFRTTHISSLLEEMFEESKKHDCFWEPDEG
Ga0316217_1006693533300031813FreshwaterMEMFRPNLNGTTTGTVAHAHLLVAESGGLITLENPEAVMQEVDFRATHISSLLAEMFREAEKHDLLETDES
Ga0316226_1003282163300032562FreshwaterMDPFRHELSGLTTGTGSHAHLLVAESGGLVLMETPEAVMEEVEFRTTHVSSLLEEMFEEAKKHDNFWEPDEG
Ga0316226_110614613300032562FreshwaterMDSSLQKLNCLPVGTGTHAHLLVAESGGLVAMESPEAVMEEVAFRATHVSSLLEQMLEECKRRDSFWEPEEG
Ga0316225_104430513300032675FreshwaterMDPFRNNLSGTTTDTGSHAHLLVAESGGLVLLETPEAVMEEVEFRTTHISSLLEAMFEET
Ga0370492_0009577_2653_28713300034282Untreated Peat SoilMNPFLQKMDGTTTGVEGHAHLLVAESGGLVTLESPEAVMAEVGFRAEHISSLMREMFVEAGKHDCFWEPDNE
Ga0370492_0194940_594_8123300034282Untreated Peat SoilMDQFLKKMSGTSTGTTAHAHLLVAESGGLVTLESPEAVMEEVAFRATHVSSLLEEMFEEFKKHDCFWEPNKE
Ga0373950_0037564_516_7133300034818Rhizosphere SoilMSGGTSTGTGGHAHLLFTEPGGRVTLESPEAVMEEVEFRATHVSSLLEEMFEEARKHDFWKDVEG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.