NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F072899

Metagenome Family F072899

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072899
Family Type Metagenome
Number of Sequences 120
Average Sequence Length 40 residues
Representative Sequence MTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Number of Associated Samples 20
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 45.00 %
% of genes from short scaffolds (< 2000 bps) 57.50 %
Associated GOLD sequencing projects 20
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (62.500 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza
(80.833 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(80.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.03%    β-sheet: 0.00%    Coil/Unstructured: 46.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF07727RVT_2 2.50
PF13912zf-C2H2_6 1.67
PF14291DUF4371 1.67
PF13855LRR_8 1.67
PF04844Ovate 0.83
PF02892zf-BED 0.83
PF00385Chromo 0.83
PF00078RVT_1 0.83
PF00665rve 0.83
PF13952DUF4216 0.83
PF028262-Hacid_dh_C 0.83
PF04450BSP 0.83
PF04525LOR 0.83
PF12643MazG-like 0.83
PF00069Pkinase 0.83
PF14223Retrotran_gag_2 0.83
PF00125Histone 0.83
PF14476Chloroplast_duf 0.83
PF08615RNase_H2_suC 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.33
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.83
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.83
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.83
COG4584TransposaseMobilome: prophages, transposons [X] 0.83
COG4894Putative phospholipid scramblase YxjI, Tubby2 superfamilyLipid transport and metabolism [I] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.17 %
UnclassifiedrootN/A35.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300028786|Ga0307517_10011778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta12090Open in IMG/M
3300028786|Ga0307517_10012778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa11483Open in IMG/M
3300028786|Ga0307517_10028782Not Available6601Open in IMG/M
3300028786|Ga0307517_10048907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4339Open in IMG/M
3300028786|Ga0307517_10084502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2670Open in IMG/M
3300028786|Ga0307517_10231765Not Available1107Open in IMG/M
3300028786|Ga0307517_10344657Not Available812Open in IMG/M
3300028786|Ga0307517_10459309Not Available657Open in IMG/M
3300028786|Ga0307517_10623432All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa528Open in IMG/M
3300028794|Ga0307515_10013568All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta15205Open in IMG/M
3300028794|Ga0307515_10027189Not Available9795Open in IMG/M
3300028794|Ga0307515_10045891All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Salix6696Open in IMG/M
3300028794|Ga0307515_10078803All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4325Open in IMG/M
3300028794|Ga0307515_10082230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4169Open in IMG/M
3300028794|Ga0307515_10085092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa4051Open in IMG/M
3300028794|Ga0307515_10138823All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2621Open in IMG/M
3300028794|Ga0307515_10143802Not Available2540Open in IMG/M
3300028794|Ga0307515_10148087Not Available2472Open in IMG/M
3300028794|Ga0307515_10160747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2292Open in IMG/M
3300028794|Ga0307515_10218365Not Available1731Open in IMG/M
3300028794|Ga0307515_10319118All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1221Open in IMG/M
3300028794|Ga0307515_10364062Not Available1085Open in IMG/M
3300028794|Ga0307515_10496415Not Available831Open in IMG/M
3300028794|Ga0307515_10532390Not Available784Open in IMG/M
3300030521|Ga0307511_10013971All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae7823Open in IMG/M
3300030521|Ga0307511_10056838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3052Open in IMG/M
3300030521|Ga0307511_10074475All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus alba2446Open in IMG/M
3300030521|Ga0307511_10116836Not Available1670Open in IMG/M
3300030521|Ga0307511_10128610All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1535Open in IMG/M
3300030521|Ga0307511_10149725All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1343Open in IMG/M
3300030521|Ga0307511_10152688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1320Open in IMG/M
3300030521|Ga0307511_10171619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1190Open in IMG/M
3300030521|Ga0307511_10269171Not Available799Open in IMG/M
3300030521|Ga0307511_10368292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa607Open in IMG/M
3300030521|Ga0307511_10447211Not Available512Open in IMG/M
3300030522|Ga0307512_10273332Not Available816Open in IMG/M
3300030522|Ga0307512_10339002All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa671Open in IMG/M
3300030522|Ga0307512_10398123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa580Open in IMG/M
3300031456|Ga0307513_10025535All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta6840Open in IMG/M
3300031456|Ga0307513_10087688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae3184Open in IMG/M
3300031456|Ga0307513_10100986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae2908Open in IMG/M
3300031456|Ga0307513_10121626All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta2576Open in IMG/M
3300031456|Ga0307513_10179773All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1980Open in IMG/M
3300031456|Ga0307513_10197224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1858Open in IMG/M
3300031456|Ga0307513_10211817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1768Open in IMG/M
3300031456|Ga0307513_10220475All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1718Open in IMG/M
3300031456|Ga0307513_10345035All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1238Open in IMG/M
3300031456|Ga0307513_10447196All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1017Open in IMG/M
3300031456|Ga0307513_10508342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa921Open in IMG/M
3300031456|Ga0307513_10825230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa633Open in IMG/M
3300031507|Ga0307509_10028943All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa6153Open in IMG/M
3300031507|Ga0307509_10150345All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa2245Open in IMG/M
3300031507|Ga0307509_10202402All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta1820Open in IMG/M
3300031507|Ga0307509_10288410All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1397Open in IMG/M
3300031507|Ga0307509_10297530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1364Open in IMG/M
3300031507|Ga0307509_10300006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1355Open in IMG/M
3300031507|Ga0307509_10912828Not Available543Open in IMG/M
3300031507|Ga0307509_10945673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa527Open in IMG/M
3300031616|Ga0307508_10066184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3182Open in IMG/M
3300031616|Ga0307508_10119185Not Available2241Open in IMG/M
3300031616|Ga0307508_10245568Not Available1387Open in IMG/M
3300031616|Ga0307508_10260973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida1327Open in IMG/M
3300031616|Ga0307508_10279552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae1262Open in IMG/M
3300031616|Ga0307508_10308573Not Available1174Open in IMG/M
3300031616|Ga0307508_10508851All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa799Open in IMG/M
3300031649|Ga0307514_10055872All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3032Open in IMG/M
3300031649|Ga0307514_10113553All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1911Open in IMG/M
3300031649|Ga0307514_10201197Not Available1251Open in IMG/M
3300031649|Ga0307514_10235826Not Available1102Open in IMG/M
3300031649|Ga0307514_10253304All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1039Open in IMG/M
3300031649|Ga0307514_10253602Not Available1038Open in IMG/M
3300031649|Ga0307514_10282872Not Available947Open in IMG/M
3300031649|Ga0307514_10388161Not Available720Open in IMG/M
3300031649|Ga0307514_10429536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus tomentosa659Open in IMG/M
3300031649|Ga0307514_10443824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa641Open in IMG/M
3300031649|Ga0307514_10491897Not Available586Open in IMG/M
3300031649|Ga0307514_10523794Not Available555Open in IMG/M
3300031730|Ga0307516_10041489All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida4573Open in IMG/M
3300031730|Ga0307516_10172342Not Available1903Open in IMG/M
3300031730|Ga0307516_10247740Not Available1477Open in IMG/M
3300031730|Ga0307516_10380286All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1073Open in IMG/M
3300031730|Ga0307516_10437089Not Available965Open in IMG/M
3300031730|Ga0307516_10556124All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa801Open in IMG/M
3300031730|Ga0307516_10681177Not Available684Open in IMG/M
3300031730|Ga0307516_10813537Not Available596Open in IMG/M
3300031730|Ga0307516_10928349All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa538Open in IMG/M
3300031838|Ga0307518_10046263All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3164Open in IMG/M
3300031838|Ga0307518_10324191All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa917Open in IMG/M
3300032354|Ga0325403_1000656All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus25792Open in IMG/M
3300032354|Ga0325403_1015719All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida7043Open in IMG/M
3300032354|Ga0325403_1023144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5517Open in IMG/M
3300032354|Ga0325403_1023530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa5454Open in IMG/M
3300032354|Ga0325403_1036669All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa3892Open in IMG/M
3300032354|Ga0325403_1046853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus3129Open in IMG/M
3300032354|Ga0325403_1048199All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Crotonoideae → Micrandreae → Hevea → Hevea brasiliensis3041Open in IMG/M
3300032354|Ga0325403_1055117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Weissella → Weissella confusa2641Open in IMG/M
3300032354|Ga0325403_1061221Not Available2347Open in IMG/M
3300032355|Ga0325401_1064021Not Available2555Open in IMG/M
3300032374|Ga0325400_1276729All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa627Open in IMG/M
3300032389|Ga0325405_1000194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta57175Open in IMG/M
3300032389|Ga0325405_1001134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida26785Open in IMG/M
3300032389|Ga0325405_1007080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus deltoides11309Open in IMG/M
3300032389|Ga0325405_1020782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae5717Open in IMG/M
3300032389|Ga0325405_1033973Not Available3789Open in IMG/M
3300032389|Ga0325405_1064006All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa1817Open in IMG/M
3300032390|Ga0325404_1027486Not Available4614Open in IMG/M
3300032740|Ga0325411_1022165All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae5713Open in IMG/M
3300032741|Ga0325414_1030617Not Available4581Open in IMG/M
3300033179|Ga0307507_10250351Not Available1145Open in IMG/M
3300033179|Ga0307507_10258364Not Available1115Open in IMG/M
3300033179|Ga0307507_10352154Not Available865Open in IMG/M
3300033179|Ga0307507_10471881All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa685Open in IMG/M
3300033179|Ga0307507_10633990Not Available545Open in IMG/M
3300033180|Ga0307510_10153834Not Available1911Open in IMG/M
3300033180|Ga0307510_10183025Not Available1655Open in IMG/M
3300033180|Ga0307510_10556092All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa594Open in IMG/M
3300034389|Ga0325419_000368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus47486Open in IMG/M
3300034389|Ga0325419_009291All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta10402Open in IMG/M
3300034389|Ga0325419_009474All Organisms → cellular organisms → Bacteria10269Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza80.83%
XylemHost-Associated → Plants → Wood → Unclassified → Unclassified → Xylem15.83%
LeafHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Leaf3.33%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028794Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EMHost-AssociatedOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030522Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EMHost-AssociatedOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031649Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EMHost-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031838Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EMHost-AssociatedOpen in IMG/M
3300032354Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R4Host-AssociatedOpen in IMG/M
3300032355Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R2Host-AssociatedOpen in IMG/M
3300032374Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1Host-AssociatedOpen in IMG/M
3300032389Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R2Host-AssociatedOpen in IMG/M
3300032390Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-Control-R1Host-AssociatedOpen in IMG/M
3300032740Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdIQD-R4Host-AssociatedOpen in IMG/M
3300032741Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-PdKOR-R3Host-AssociatedOpen in IMG/M
3300033179Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EMHost-AssociatedOpen in IMG/M
3300033180Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EMHost-AssociatedOpen in IMG/M
3300034389Populus deltoides microbial communities from Bellville, Georgia, United States - Leaf-Control-R4Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0307517_1001177813300028786EctomycorrhizaMTFQSVGDFVCKEHQLTVQLGSEQFQSSLENTNGIFRW
Ga0307517_1001277843300028786EctomycorrhizaMTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307517_1002878253300028786EctomycorrhizaMTFQSVTDFVRKEQQLTMQLESEQFWSSLENTDGKFRR
Ga0307517_1004890713300028786EctomycorrhizaMTFQSVGDFIRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307517_1008450213300028786EctomycorrhizaMIFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRW
Ga0307517_1023176513300028786EctomycorrhizaMTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFCDDEQCS
Ga0307517_1034465713300028786EctomycorrhizaAPTTFQSVSDFIHKEQQLTVQLEGEQFWSSLENTDGKFCW
Ga0307517_1045930913300028786EctomycorrhizaLNFSENRQITPTTFQSVGDFVRKEQQLTAQLEGEQFWSSLENTDGKFRR
Ga0307517_1062343213300028786EctomycorrhizaNRQITPTTFQSVGDFVRKEQKLTVQLKSEQFWSSLENTDGNFRL
Ga0307515_1001356843300028794EctomycorrhizaMTFQSVGDFVRKEQQLTMQLESEQFWCSLENTDGKFRR
Ga0307515_10027189143300028794EctomycorrhizaMTFQSVTDFVRKEQQLTMQLESEQFWSSLENTDGKFRQ
Ga0307515_1004589133300028794EctomycorrhizaMTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFRR
Ga0307515_1007880343300028794EctomycorrhizaGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307515_1008223013300028794EctomycorrhizaDFSIRGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307515_1008509213300028794EctomycorrhizaTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDRNFRR
Ga0307515_1013882323300028794EctomycorrhizaMHFQSVGDFIRKEQQLTVQLESEQFWSSLKNTDGKFRR
Ga0307515_1014380213300028794EctomycorrhizaMTSQSVGDFVRKEQQLTVQLKSEQFWSSLENTNGFFRQ
Ga0307515_1014808713300028794EctomycorrhizaMTFQSVTDFVRKEQQLTMQLESEQFWSSLKNTDGKFRR
Ga0307515_1016074713300028794EctomycorrhizaMTFQSVGDFVRKEQKLTVQLEGEQFWSSLENTDRKFRS
Ga0307515_1021836513300028794EctomycorrhizaMTFQSVGDFVHKEQQLTVQLESEEFWSSLEKTDRKFFR
Ga0307515_1031911813300028794EctomycorrhizaENRQITPTTFQSVSDFVRKEQQLTVQLESEQFWSSLENTDGIFHRLFLL
Ga0307515_1036406213300028794EctomycorrhizaMNFQSVGDFVSKEQQLTVQLEGEQFWSSLENTDEKFRR
Ga0307515_1049641513300028794EctomycorrhizaCQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSMENTDGQFRR
Ga0307515_1053239013300028794EctomycorrhizaLNFLENRQITPTTFQSVGDFVRKEQQLTAQLEGEQFWSSLENTDGKFRR
Ga0307511_1001397113300030521EctomycorrhizaMNFQSVGDFVCKEQQLTVQLESEQFWSSLENIDGKFRR
Ga0307511_1005683843300030521EctomycorrhizaTPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307511_1007447533300030521EctomycorrhizaMTFQSVGDFVRKEQKLTVQLESEQFWSSLENTDGNFRR
Ga0307511_1011683613300030521EctomycorrhizaMHFQSVCDFVRKEQQLTVQLESKQFWSSLKNIDGKFRR
Ga0307511_1012861013300030521EctomycorrhizaTPTTFQSVGDFIRKEQQLTVQLESEQFWSSLENTDGKFCR
Ga0307511_1014972513300030521EctomycorrhizaMNFQSVSDFVRKEQQLTVQLEGEQFWSSLENTDGKFRR
Ga0307511_1015268823300030521EctomycorrhizaCQITPTTFQSVSDFVRKEQQLTVQLESEQFWSFLENTDGKFRQ
Ga0307511_1017161933300030521EctomycorrhizaWIFSENCQITPTTFQSVGDFIRKEQQLTVQLESEQFWSSLENADGIVRR
Ga0307511_1026917113300030521EctomycorrhizaSENRQITPMTFQSVGDFVRKEQQLTVQLESEQFWSSLDNTDGKFRW
Ga0307511_1036829213300030521EctomycorrhizaFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307511_1041417423300030521EctomycorrhizaSENIQITPTTFQSLGDFVRKEQQLTVQLESEQFWSPLENTDRNSVGDSLCN
Ga0307511_1044721123300030521EctomycorrhizaMTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307512_1027333223300030522EctomycorrhizaMTFQSVGDFVRKEQQLTVQLESEQFWSSLENSIGNY
Ga0307512_1033900213300030522EctomycorrhizaMTFQSVGNFVRKEQQLTVQLESKQFWSSLENTDGKFRR
Ga0307512_1039812313300030522EctomycorrhizaTPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFCR
Ga0307513_1002553513300031456EctomycorrhizaIFSENRQITPTTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307513_1008768813300031456EctomycorrhizaIFSENHQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307513_1010098613300031456EctomycorrhizaMTFQSVGDFVCKEKQLIVQLESEQFWSSLGNTDGQFRR
Ga0307513_1012162623300031456EctomycorrhizaMTFQSVGDFVCKEQQLTVQLESEQFWSSLKNTDGNFRR
Ga0307513_1017977313300031456EctomycorrhizaMIFQSVGDFVRKEQQLIVQLESEQFWSSLENTNRKFRR
Ga0307513_1019722423300031456EctomycorrhizaMTFQSVGDFVRKEQQLTVQLESEHFWSSLENTDRKFRR
Ga0307513_1021181713300031456EctomycorrhizaMTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFCR
Ga0307513_1022047523300031456EctomycorrhizaMTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGIFRR
Ga0307513_1034503513300031456EctomycorrhizaTTFQSVGDFVCKEQQLTVQLESEQFWSSLENTDGNFRR
Ga0307513_1044719613300031456EctomycorrhizaMTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDEKFRR
Ga0307513_1050834213300031456EctomycorrhizaMTFQSVGDFVRKEQKLTVQFESEQFWSSLENTDGNFRR
Ga0307513_1082523013300031456EctomycorrhizaNRQITPTTFQSVRDFVRKEQQFIVQLESEQFWSSLENTDGIFLR
Ga0307509_1002894333300031507EctomycorrhizaHQITPTTFQSVGDFIRKEQQLTVQLKSEQFWSSLENTDGKFPL
Ga0307509_1015034513300031507EctomycorrhizaQSVGDFVRKEQQLTVQLESEQFWSSLENTDRNFRR
Ga0307509_1020240213300031507EctomycorrhizaTPTTFQSVSDFVRKEQQLTVQLESEQFWSSLENTDGIFHRLFLL
Ga0307509_1028841013300031507EctomycorrhizaTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307509_1029753013300031507EctomycorrhizaIFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDKNFHR
Ga0307509_1030000623300031507EctomycorrhizaMKILNQLNFFRNRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307509_1091282813300031507EctomycorrhizaENRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDRKFRR
Ga0307509_1094567313300031507EctomycorrhizaLNFLENRQITPTTFQSVGDFVRKEQQLTAQLEGEQFWSSLENTDRKFRR
Ga0307508_1006618433300031616EctomycorrhizaITPMTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRRRFPL
Ga0307508_1011918513300031616EctomycorrhizaMTFQSVGDFVRKEQQLTVQLESKQFWSSLENTDGKFRW
Ga0307508_1024556823300031616EctomycorrhizaMNFQSVGGFVHKEQQLTVQLKSEQFWSSLENTDGIFRW
Ga0307508_1026097313300031616EctomycorrhizaKTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDRKFRR
Ga0307508_1027955233300031616EctomycorrhizaSENRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307508_1030857313300031616EctomycorrhizaITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGF
Ga0307508_1050885113300031616EctomycorrhizaMIFQSVGDFVRKEQQLIVQLESEQFWSSLENTDGKFRW
Ga0307514_1005587243300031649EctomycorrhizaRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKLRR
Ga0307514_1011355323300031649EctomycorrhizaMTFQSVGDFVRKEQQLTVQLESKQLWSSLENTDGKFRR
Ga0307514_1020119713300031649EctomycorrhizaENRQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGQFRR
Ga0307514_1023582613300031649EctomycorrhizaMTFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGIFRR
Ga0307514_1025330413300031649EctomycorrhizaRQITPTTFQSVGDFIRKEQQLTVQLESEQFWSSLENADGIVRR
Ga0307514_1025360213300031649EctomycorrhizaMTFQSVGDFVRKEQKLTVQLEGEQFWSSLENTDRKFRR
Ga0307514_1028287223300031649EctomycorrhizaTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307514_1038816113300031649EctomycorrhizaMKILNQLNFFRNCQITPTTFQSVGDFVRKEQQLTVQLESEQFWSSMENTDGQFR
Ga0307514_1042953613300031649EctomycorrhizaTFQSVGDFVRKEQQLIVQLESEQFWSSLENTDKKFRR
Ga0307514_1044382413300031649EctomycorrhizaTFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGNFRR
Ga0307514_1049189713300031649EctomycorrhizaTFQPVGDFVRKGQQLTMQLKSEQFLSSLKNTDGIFRR
Ga0307514_1052379413300031649EctomycorrhizaLNEKFKLIDFFSENRQITPMTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFRR
Ga0307516_1004148923300031730EctomycorrhizaMTFQSVGDFVRKEQKLTVQLEGEQFWSSLENTDRKFHR
Ga0307516_1017234223300031730EctomycorrhizaMTFQSVGDFVRKEQQLTVQLKSEQFLSSLENTDGIFCR
Ga0307516_1024774013300031730EctomycorrhizaMTFQSVGDFFRKEQQLTVQLESEQFWSSLENTDGKFRR
Ga0307516_1038028613300031730EctomycorrhizaSENRQITPTTFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGNFRR
Ga0307516_1043708913300031730EctomycorrhizaMSFQSVSDFVRKEKQLTVQLESEQFWSSLENTDGIFRR
Ga0307516_1055612413300031730EctomycorrhizaFKNRQQLPTIFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDKNFHR
Ga0307516_1068117713300031730EctomycorrhizaTFQSVGDFVRKEQKLTVQLKSEQFWSSLENTDGNFCL
Ga0307516_1081353713300031730EctomycorrhizaITPTTFQSVSDFVRKEQQLTVQLESEQFWSSLENTDRQFRR
Ga0307516_1092834913300031730EctomycorrhizaFFSENRQITPMTLQSAGDFVRKEQQLTLQLKSEQFWSSLENTDEQFRR
Ga0307518_1004626333300031838EctomycorrhizaMTFQSVGDFVCKEQQLIVQLESEQFWSSLENTDRNFRR
Ga0307518_1032419113300031838EctomycorrhizaMIFQSVGDFVRKEQQLIVQLESELFWSSLENTDGKFRW
Ga0325403_100065683300032354XylemMTFQSVSIFIRKEQQLTMQLESEQFWSSLENTGGKFRW
Ga0325403_101571943300032354XylemMTFQPIGDFIRKEQQLIVQLESEQFWSSLENTDGIFRR
Ga0325403_102314453300032354XylemMTFQSVGDFFRKEQQLTVQLESEQFWSSLENIDGKFRR
Ga0325403_102353043300032354XylemMTFQSVGDFVCKEQQLTVQLKSEQFWSSLENTDGKFRR
Ga0325403_103666943300032354XylemMTFQSVGDFVRKEQQLTVQLESKQFWSSLENTDRKFRR
Ga0325403_104685313300032354XylemMTFQSVGDFVRKEQQLTLQLESEQFWSSLKNTDEKFHR
Ga0325403_104819933300032354XylemMTFQSVGDFVRKEQQLTVQLEGEQFWSSLENTDGKFRR
Ga0325403_105511713300032354XylemMNFQSVGDFVRKEQQLTVQLESEQFWSSLENTDGF
Ga0325403_106122133300032354XylemMTFQFVGDFVHKEQQLTVQLKSKQFWSSLEKTDGIFHR
Ga0325401_106402113300032355XylemMTFQSVGDFVRKEQQLTMQLESEQFWSSLENIDGKFCR
Ga0325400_127672913300032374XylemMTFQSVDDFVRQEQQLTVQLENEQFWSSLENTDGKFRR
Ga0325405_1000194463300032389XylemMAFQSVGDFFRKEQQLIVQLESEQFWSSLENIDGKFRR
Ga0325405_1001134213300032389XylemMTFQSVGDFVRKEQQLTLQLESEQFWSSLKNTDGKFHR
Ga0325405_100708063300032389XylemMIFQSVGDFVRKEQQLTVQLESEQFWSSLENIERKFRQ
Ga0325405_102078243300032389XylemMTFQSVGDFVCKEQQLIVQLKSKQFWSSLENTDGKFRR
Ga0325405_103397333300032389XylemMTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDGKFRK
Ga0325405_106400623300032389XylemMTFQSVSDFIRKEQQLTLQVESEQFWSSLENTDRKFRRCFPL
Ga0325404_102748613300032390XylemMTFQSVGDFVRKEQQLTMQLESEQFWSSLENIDGKFCL
Ga0325411_102216543300032740XylemMTFQSVGDFVRKEQQLTVQLKSKQFWSSLENTDGKFRR
Ga0325414_103061743300032741LeafMTFQSVDDFVHQEQQLTVQLENEQFWSSLENTDGKFRR
Ga0307507_1025035113300033179EctomycorrhizaRRLFNPSIFFRKEQQLTVQLESEQFWISLENTSGKFRR
Ga0307507_1025836423300033179EctomycorrhizaMTPTAFQSVGDFVRKEQQLTVQLEGEQFWSSLENTDGNFRR
Ga0307507_1035215413300033179EctomycorrhizaTTFQSVGDFVRKEQQLTVQLESEQFWSSLKNSDGKFRQIYRRTLPTE
Ga0307507_1047188113300033179EctomycorrhizaITPTTVKSVGDFVHKEQQLIVQLESERFWSSLKNTDGKFRR
Ga0307507_1063399013300033179EctomycorrhizaMFSENRQITPTTFQSVGDFVRKEQQLTVQLKSEQFWSSLENTDGQFRR
Ga0307510_1015383423300033180EctomycorrhizaMTFQSVGDFVRKEQQLTVQLESEQLWSSMENIYGKFRR
Ga0307510_1018302523300033180EctomycorrhizaMTFQSVGDFVCKEQKLTVQLESEQFWSSLENTDGNF
Ga0307510_1055609213300033180EctomycorrhizaSENRQITSTTFQSVGDFVRKEQQLTVQLESEQFWSSLENTDRNFHR
Ga0325419_000368_23004_231203300034389LeafMTFQSVSDFVRKEQELTVQLKSEQFWSSLENTDGKFRR
Ga0325419_009291_1267_13833300034389LeafMTFQSIGDFVRKEQQLTVQLESEQFWSSLENTNGIFHR
Ga0325419_009474_8312_84283300034389LeafMTFQSVGDFVHKEQQLTVQLESEQFWSSLENTDGKFHQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.