NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F072999

Metagenome / Metatranscriptome Family F072999

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F072999
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 160 residues
Representative Sequence MRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Number of Associated Samples 90
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 57.50 %
% of genes near scaffold ends (potentially truncated) 44.17 %
% of genes from short scaffolds (< 2000 bps) 83.33 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(40.833 % of family members)
Environment Ontology (ENVO) Unclassified
(35.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(50.833 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 9.15%    β-sheet: 47.56%    Coil/Unstructured: 43.29%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF08922DUF1905 9.17
PF03073TspO_MBR 2.50
PF04299FMN_bind_2 1.67
PF03079ARD 1.67
PF14534DUF4440 1.67
PF13191AAA_16 0.83
PF00196GerE 0.83
PF01234NNMT_PNMT_TEMT 0.83
PF12680SnoaL_2 0.83
PF00491Arginase 0.83
PF07859Abhydrolase_3 0.83
PF00440TetR_N 0.83
PF03781FGE-sulfatase 0.83
PF00596Aldolase_II 0.83
PF04229GrpB 0.83
PF14279HNH_5 0.83
PF05638T6SS_HCP 0.83
PF01022HTH_5 0.83
PF13649Methyltransf_25 0.83
PF00753Lactamase_B 0.83
PF09851SHOCT 0.83
PF03928HbpS-like 0.83
PF13185GAF_2 0.83
PF00561Abhydrolase_1 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG3476Tryptophan-rich sensory protein TspO/CrtK (mitochondrial benzodiazepine receptor homolog)Signal transduction mechanisms [T] 2.50
COG1791Acireductone dioxygenase (methionine salvage), cupin superfamilyAmino acid transport and metabolism [E] 1.67
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.83
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.83
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.83
COG2320GrpB domain, predicted nucleotidyltransferase, UPF0157 familyGeneral function prediction only [R] 0.83
COG3157Type VI protein secretion system component Hcp (secreted cytotoxin)Intracellular trafficking, secretion, and vesicular transport [U] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_104247340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2730Open in IMG/M
3300000956|JGI10216J12902_121990754All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → Verrucomicrobium spinosum629Open in IMG/M
3300002568|C688J35102_120174630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides912Open in IMG/M
3300004114|Ga0062593_100074132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2268Open in IMG/M
3300004156|Ga0062589_102192956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides565Open in IMG/M
3300004643|Ga0062591_100868839All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300005329|Ga0070683_100343762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. AG2381421Open in IMG/M
3300005329|Ga0070683_100539342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides euryhalodurans1115Open in IMG/M
3300005331|Ga0070670_101061497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides738Open in IMG/M
3300005343|Ga0070687_100361270All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Cp5.3940Open in IMG/M
3300005356|Ga0070674_100502176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1010Open in IMG/M
3300005366|Ga0070659_100252029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1463Open in IMG/M
3300005441|Ga0070700_100439333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides990Open in IMG/M
3300005547|Ga0070693_100588991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides801Open in IMG/M
3300005615|Ga0070702_101322618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides586Open in IMG/M
3300009098|Ga0105245_10429974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. AG2381325Open in IMG/M
3300009098|Ga0105245_10901473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides926Open in IMG/M
3300009148|Ga0105243_10090213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides2522Open in IMG/M
3300009148|Ga0105243_10149964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae1999Open in IMG/M
3300009177|Ga0105248_11362005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides803Open in IMG/M
3300009551|Ga0105238_10556603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. AG2381152Open in IMG/M
3300010110|Ga0126316_1010700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides596Open in IMG/M
3300010375|Ga0105239_10932849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides997Open in IMG/M
3300012212|Ga0150985_118874097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides609Open in IMG/M
3300012469|Ga0150984_105908960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides806Open in IMG/M
3300012897|Ga0157285_10012084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1710Open in IMG/M
3300012900|Ga0157292_10156186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides731Open in IMG/M
3300012908|Ga0157286_10011427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1749Open in IMG/M
3300012910|Ga0157308_10217341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides655Open in IMG/M
3300012912|Ga0157306_10227528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides644Open in IMG/M
3300012915|Ga0157302_10133690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides824Open in IMG/M
3300012943|Ga0164241_10927980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides637Open in IMG/M
3300012951|Ga0164300_10567133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides663Open in IMG/M
3300012955|Ga0164298_10134270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1365Open in IMG/M
3300012957|Ga0164303_10752337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides664Open in IMG/M
3300012961|Ga0164302_10769743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides722Open in IMG/M
3300012984|Ga0164309_10024431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales3226Open in IMG/M
3300012984|Ga0164309_11129033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides653Open in IMG/M
3300012985|Ga0164308_10005670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales6532Open in IMG/M
3300012987|Ga0164307_11267085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides614Open in IMG/M
3300012988|Ga0164306_10063146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2292Open in IMG/M
3300012988|Ga0164306_10070353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides2190Open in IMG/M
3300012989|Ga0164305_10076668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2064Open in IMG/M
3300013102|Ga0157371_10696353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides760Open in IMG/M
3300013104|Ga0157370_10135444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2296Open in IMG/M
3300013306|Ga0163162_10489440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1361Open in IMG/M
3300013308|Ga0157375_10297160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1778Open in IMG/M
3300014325|Ga0163163_11766361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides679Open in IMG/M
3300014325|Ga0163163_13279851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides505Open in IMG/M
3300014326|Ga0157380_10014002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales5859Open in IMG/M
3300014969|Ga0157376_10524500All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1168Open in IMG/M
3300015077|Ga0173483_10001724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales7020Open in IMG/M
3300015077|Ga0173483_10060280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1480Open in IMG/M
3300015200|Ga0173480_10082860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales1519Open in IMG/M
3300017789|Ga0136617_10103392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2465Open in IMG/M
3300017792|Ga0163161_10070193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae2561Open in IMG/M
3300017965|Ga0190266_10561977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides681Open in IMG/M
3300018422|Ga0190265_12574197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides607Open in IMG/M
3300018432|Ga0190275_10030433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4323Open in IMG/M
3300018432|Ga0190275_10132838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides2266Open in IMG/M
3300018432|Ga0190275_10204992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1869Open in IMG/M
3300018432|Ga0190275_10381342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1413Open in IMG/M
3300018432|Ga0190275_10525225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1221Open in IMG/M
3300018432|Ga0190275_10770791All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1024Open in IMG/M
3300018466|Ga0190268_10579838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides788Open in IMG/M
3300018469|Ga0190270_10206902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1665Open in IMG/M
3300018469|Ga0190270_10553696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1110Open in IMG/M
3300018469|Ga0190270_10663481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1028Open in IMG/M
3300018469|Ga0190270_10714193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides996Open in IMG/M
3300018469|Ga0190270_11305008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides768Open in IMG/M
3300018476|Ga0190274_10258705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides psychrotolerans1585Open in IMG/M
3300018476|Ga0190274_12039593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides670Open in IMG/M
3300018481|Ga0190271_10030726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4324Open in IMG/M
3300018481|Ga0190271_10082015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2896Open in IMG/M
3300018481|Ga0190271_10109141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides2572Open in IMG/M
3300018481|Ga0190271_10669659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1159Open in IMG/M
3300018481|Ga0190271_11523754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides785Open in IMG/M
3300018920|Ga0190273_10573336All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides845Open in IMG/M
3300018920|Ga0190273_11105515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides665Open in IMG/M
3300018920|Ga0190273_12396668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides502Open in IMG/M
3300019356|Ga0173481_10019433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2049Open in IMG/M
3300020081|Ga0206354_11033995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides608Open in IMG/M
3300022911|Ga0247783_1037576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1265Open in IMG/M
3300023264|Ga0247772_1102562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides617Open in IMG/M
3300023275|Ga0247776_10076757All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1301Open in IMG/M
3300025918|Ga0207662_10498387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides838Open in IMG/M
3300025924|Ga0207694_10260435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. AG2381421Open in IMG/M
3300025935|Ga0207709_10465596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides980Open in IMG/M
3300025944|Ga0207661_10325479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → unclassified Microbacterium → Microbacterium sp. AG2381383Open in IMG/M
3300025945|Ga0207679_10752192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides887Open in IMG/M
3300026067|Ga0207678_10792173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides836Open in IMG/M
3300026089|Ga0207648_11354518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides669Open in IMG/M
3300026121|Ga0207683_10542007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1075Open in IMG/M
3300026142|Ga0207698_10294011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1509Open in IMG/M
3300028589|Ga0247818_10300657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. zg-DK71691068Open in IMG/M
3300028589|Ga0247818_11089323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides567Open in IMG/M
3300028608|Ga0247819_10297629All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides903Open in IMG/M
3300028608|Ga0247819_10359999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides830Open in IMG/M
3300028802|Ga0307503_10010672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2698Open in IMG/M
3300030336|Ga0247826_10590288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides851Open in IMG/M
3300031824|Ga0307413_10703403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides840Open in IMG/M
3300031847|Ga0310907_10309647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides798Open in IMG/M
3300031938|Ga0308175_100595069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1190Open in IMG/M
3300031938|Ga0308175_102622495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides564Open in IMG/M
3300032002|Ga0307416_102589069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides605Open in IMG/M
3300032005|Ga0307411_12107108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides528Open in IMG/M
3300032013|Ga0310906_11442788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides506Open in IMG/M
3300032080|Ga0326721_10048378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides1831Open in IMG/M
3300032080|Ga0326721_10141580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas → Cellulomonas aerilata1209Open in IMG/M
3300034661|Ga0314782_078689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides711Open in IMG/M
3300034662|Ga0314783_172653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides513Open in IMG/M
3300034666|Ga0314788_206256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides509Open in IMG/M
3300034667|Ga0314792_183975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides578Open in IMG/M
3300034667|Ga0314792_232435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides531Open in IMG/M
3300034671|Ga0314796_080859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides674Open in IMG/M
3300034672|Ga0314797_058731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides715Open in IMG/M
3300034673|Ga0314798_072179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides687Open in IMG/M
3300034675|Ga0314800_057903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides566Open in IMG/M
3300034678|Ga0314803_057098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides688Open in IMG/M
3300034678|Ga0314803_116571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides539Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil40.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil16.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.50%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.50%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.50%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere2.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.67%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere1.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.67%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.83%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010110Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022911Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5EnvironmentalOpen in IMG/M
3300023264Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L151-409C-6EnvironmentalOpen in IMG/M
3300023275Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L199-509C-5EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034662Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034666Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034667Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034671Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034672Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034673Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034675Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034678Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10424734023300000956SoilMRRIAVLVVLLPLLMLVQAGQATAATSCHQINATGAGQGAAPQAGDPPGLIRTVAQISGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLDLATGDFRASGEVSGATGKLDGATGTLTLAGVQDLQDPAGSFIETVSGEVCLDLGGNGRK*
JGI10216J12902_12199075413300000956SoilMRRIAVLALLLPLLMLVQAGPATAVVSCHHINATGAGEGAPPRAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVIGFTPTGIAFAGDITFTTNRGTLSVDLDGTLDLTTGDFRASGDVSGATGKLDGATGTLTLAGVQNLLDPAGSFIETVSGEICVDLGENGKE*
C688J35102_12017463023300002568SoilMPLLMLVQAGPSTAAVSCHHINATGAGQGAPPRAGDLPGLIRTVAQIRGGGLLQGTTEAAFEVTGFTPTGIAFAGDITFTTSRGTLAVDLDGTLDLTTGDFGASGDVSGATGKLDGATGTLTLAGVQNLLDPAGSFIETVSGEICVDLGGNGQK*
Ga0062593_10007413213300004114SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0062589_10219295613300004156SoilATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFSASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0062591_10086883923300004643SoilMRRIAVLAVLLPLLVLVQAGPATAVVSCHQINATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTPTGIAFAGAITFTTNRGTLSVDLDGTLDLTTGGFQASGDVSGGTGKLDGATGTLTLAGVQNLLDP
Ga0070683_10034376213300005329Corn RhizosphereMTSLQCHKGRLQMRRATVLALMLPLLMLFVTGPATAAVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGKICVDLGGNGNQ*
Ga0070683_10053934213300005329Corn RhizosphereMRRVAVLALLLPMLTLVHAGPATAGVSCHPINAKGAGQGAPSQAGDPPGLIRTVAQIRGGGLLQGTTKAAFQVTRSTPTGIAFAGDITFTTNRATLTVDLDGTLDLTTGEFAASGDVSGATGKLDGATGALTLAGVQDLLDPAGSFTETVSGEICVDLGGNGRT*
Ga0070670_10106149713300005331Switchgrass RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQGGDPPGLIRTSAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDAREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGKGSQ*
Ga0070687_10036127013300005343Switchgrass RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQGGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0070674_10050217613300005356Miscanthus RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTITLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0070659_10025202913300005366Corn RhizosphereHCPYTCRQDHKRFRMCRAQGSAGSWQSDGMMPTRLPEPEPVLTPRASSLASNGELAMTGHQCHKGRLQVRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLELATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0070700_10043933313300005441Corn, Switchgrass And Miscanthus RhizosphereMRRATVLALMLPLLMLFGTGPAAAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLG
Ga0070693_10058899113300005547Corn, Switchgrass And Miscanthus RhizosphereMRRVAVLALLLPMLTLVHAGPATAGVSCHPINAKGAGQGAPSQAGDPPGLIRTVAQIRGGGLLQGTTKAAFQVTRSTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTENVSGEICVDLGGNGNQ*
Ga0070702_10132261813300005615Corn, Switchgrass And Miscanthus RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINANGSGSGAAPQDDDPPGLIRTSAQIHGGGLLQGTTQAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0105245_1042997423300009098Miscanthus RhizosphereMLPLLMLFGTGPAMAGVSCHRINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTQAAFQVTGPTPTGIGFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0105245_1090147313300009098Miscanthus RhizosphereMRRVAVLALLLPLLTLVHAGPATAGVSCHPINAKGAGRGAPSQAGDPPGLIRTVAQIRGGGLLQGTTKAAFQVTGSIPTGIAFAGDITFTTNRATLTVDLDGTLDLTTGEFAASGDVSGATGKLDGATGTLTLAGVQDLLVPAGSFTETVSGEICVDLGGNGRT*
Ga0105243_1009021323300009148Miscanthus RhizosphereMRRVAVLALLLPLLTLVHAGPATAGVSCHPINAKGAGRGAPSQAGDPPGLIRTVAQIRGGGLLQGTTKAAFQVTGSIPTGIAFAGDITFTTKRATLTVDLDGTLDLTTGEFAASGDVSGATGKLAGATGTLTLAGVQDLLDPAGSFTETVSGEICVDLGGNGRT*
Ga0105243_1014996433300009148Miscanthus RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDDDPPGLIRTSAQIQGGGLLQGTTQAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTENVSGEICVDLGGNGNQ*
Ga0105248_1136200513300009177Switchgrass RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDDDPPGLIRTSAQIHGGGLLQGTTGAAFQVTGLTPTGIAFAGDITFTTNRSTLTLDVEGTLDLATGEFAGSGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTENVSGEICVDLGGNGNQ*
Ga0105238_1055660333300009551Corn RhizosphereMLPLLMLFVTGPATAAVSCHQINAKGSGSGAAPQDDDPPGLIRTSAQIQGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQN
Ga0126316_101070013300010110SoilRQCNKGRLQMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0105239_1093284923300010375Corn RhizosphereMLPLLMLFVTGPATAAVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICADLGGNGNQ*
Ga0150985_11887409713300012212Avena Fatua RhizospherePLPPLDLMEEVTLATCVGVRRGRSLMRRAAVLALLLPFVLLVQPEPATAGVSCHPINAKGAGEGAPSQAGDPPGLIRTAAEIRGGGLLHGTTTAAFQVTGSTPTGIAFGGDITFTTNRATLTVDLVGTLDLRTGEFAASGDVSGATGKLDGATGSLTLAGVQNLLDPAGSFTETVSGEICIDLGGNGSR*
Ga0150984_10590896013300012469Avena Fatua RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQGGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGRLDGATGTLTLAGVQNLLDPAGSFTESVSGEICVDLGGNGNQ*
Ga0157285_1001208423300012897SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGSAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPTGSFTEKVSGEICVDLGGNGNQ*
Ga0157292_1015618613300012900SoilPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVIGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFSASGDVREATGKLDGATGTITLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0157286_1001142723300012908SoilMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVIGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFSASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0157308_1021734113300012910SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVIGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFSASGDVREATGKLDGATGTITLAGVQNLLDPAGSFTEKISGEIC
Ga0157306_1022752813300012912SoilSLEWVLAMTSRQCHKGRLQMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0157302_1013369013300012915SoilQCHKGRLQMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVIGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0164241_1092798013300012943SoilLLMLFGTGPATAGVSCHQINAKGSGSGAAPQGGDPPGLIRTVAQIRGGGPLQGTTQAAFQVTGSTSTGIAFAGDITFTTNRATLTVDLVGTLDLRTGEFAASGDVSGATGKLGGATGSLTLAGVQNLLDPAGSFTETVSGDICVDLGGNGRR*
Ga0164300_1056713313300012951SoilMLPLLMLFVTGPATAAVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPA
Ga0164298_1013427023300012955SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTENVSGEICVDLGGNGNQ*
Ga0164303_1075233713300012957SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQEGDPTGLIRTCAQIRGGGLFAGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLGGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTENVSGEICLDLGGNGNQ*
Ga0164302_1076974313300012961SoilMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQGGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTENVSGEICVDLGGNGNQ*
Ga0164309_1002443123300012984SoilMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLGGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICADLGGNGNQ*
Ga0164309_1112903313300012984SoilRRILVLAVLLPLLTLLQAGPAAAAVSCHQIKATGAGQGAAPQGGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLDLTTGAFRSSGDVSGATGKLDGATGTLTLAGVQNLQDPAGSFTETVSGEVCVDLGGNGRK*
Ga0164308_1000567043300012985SoilMRRAAVLALLLPFVLLVQPEPATAGVSCHPINAKGAGEGAPSQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTSAGIAFAGDITFTTNRATLTVDLVGTLDLRTGEFTASGDVSGATGKLGGATGSLTLAGVQNLLDPAGSFTETVSGEVCIDLGGNGSR*
Ga0164307_1126708513300012987SoilATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQGGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLGGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICADLGGNGNQ*
Ga0164306_1006314643300012988SoilMLPLLMLFVTGPATAAVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTENVSGEICVDLGGNGNR*
Ga0164306_1007035323300012988SoilMRRAAVLALLLPFVLLVQPEPATAGVSCHPINAKGAGEGAPSQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTSAGIAFAGDITFTTNRATLTVDLVGTLDLRTGEFAASGDVSGATGKLGGATGSLTLAGVQNLLDPAGSFTETVSGEVCIDLGGNGSR*
Ga0164305_1007666813300012989SoilTGRLQMRRATVLALMLPLSMLFGTGPATAGVSCHQINATGSGSGAAPQGGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLGGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICADLGGNGNQ*
Ga0157371_1069635313300013102Corn RhizosphereMLPLLMLFVTGPATAAVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICADLGGN
Ga0157370_1013544443300013104Corn RhizosphereMRRATVLALMLPLLMLFGTGPAMAGVSCHRINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIGFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICADLGGNGNQ*
Ga0163162_1048944013300013306Switchgrass RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0157375_1029716013300013308Miscanthus RhizosphereMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIGFAGDITFTTNRSTLTLDLNGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0163163_1176636113300014325Switchgrass RhizosphereMTGHQCHKGRLQVRRATVLALMLPPLMLFGTGPATAGVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0163163_1327985113300014325Switchgrass RhizosphereLALLLPLLMLVQAGPATAAVSCHPINATGAGQGAPPQAGDPPGLIRTVAQIRGGGLLHGTTEAAFQITGPTPTGIAFAGVITFTTSRGTLSVDLDGTLDVTTGDFGASGDVSGASGKLDGATGTLTLAGVQDLLDPAASFIETVSGEICVDLGGNGKT*
Ga0157380_1001400253300014326Switchgrass RhizosphereMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0157376_1052450033300014969Miscanthus RhizosphereMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTE
Ga0173483_1000172443300015077SoilMRRATVLALMLPLLMLFGTGPARAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0173483_1006028013300015077SoilMRRIAVLAVLLPLLVLVQAGPATAVVSCHQINATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTPTGIAFAGAITFTTNRGTLSVDLDGTLDLTTGGFQASGDVSVATGKLDGATGTLTLAGVQNL
Ga0173480_1008286033300015200SoilMLPLLMLFGTGPATAGVSCHQIHATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVIGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ*
Ga0136617_1010339223300017789Polar Desert SandMRRVAAVLALLLPLLMLVQAGPATAGVSCHQINATAVGQTAPPQAGDPPGLIRTVAHIRGGGLLQGTTEAAFQVTGFTPTGIAFAGDITFTTNRATLTVDLDGTLDLATGEFGASGDVSEATGKLDGATGTLTLAGVQNLLDPAGSFTETVSGEICVDLGGNGKK
Ga0163161_1007019333300017792Switchgrass RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINANGSGSGAAPQDDDPPGLIRTSAQIHGGGLLQGTTGAAFQVTGLTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0190266_1056197713300017965SoilMRRLAVLALLLPMLMLVQVGPATAVVSCHHINATGAGHGAPPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGVITFTTNRGTLSVDLDGTLDLTTGDFAASGDVSGATGKLGGATGTLTLAGVQNLLDPTGSFIEAVSGEICVDLGGNGKQ
Ga0190265_1257419713300018422SoilGPAAAAVSCHQTRATGAGQGAAPQPGDPPGLIRTVAQIRGGGLLHGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLNLTTGEFRSSGYVSGATGKLDGATGTLTLAGVQNLQDPAGSFVETVSGEVCVDLGGNGRNGRK
Ga0190275_1003043343300018432SoilMRRVAVLALLLPFLMLVQPRPATAGVSCPPINAKGAGQGAPSQAGDPPGLIRTVAQIRGGGLLQGTTKAAFQVTGATPTGIAFAGDITFTTNRATLTVDLVGTLDLTTGEFAASGDVSGATGKLDGATGSLTLAGVQNLLDPAGSFTETVSGEICVDLGGHGGR
Ga0190275_1013283813300018432SoilMRRIAVLVVLLPLLMLVQAGQATAATSCHQINATGAGQGAAPQAGDPPGLIRTVAQISGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLDLATGDFRASGEVSGATGKLDGATGTLTLAGVQDLQDPAGSFIETVSGEVCLDLGGNG
Ga0190275_1020499233300018432SoilMRRIAVLAVLLPLLIMVPAGRATAAASCHQINATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLNLTTGEFRSSGDVSGATGKLDGATGTLTLAGVQSLLDPAGSFTETVSGEICVDLGGNGKE
Ga0190275_1038134233300018432SoilCHHINATGAGEGAPPRAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVIGFTPTGIEFAGDITFTTNRGTLSVDLDGTLDLTTGDFRASGDVSGATGKLDGATGTLTLAGVQNLLDPAGSFIETVSGEICVDLGENGKE
Ga0190275_1052522513300018432SoilMLMLVQAGPATATVSCHQINARGEGRGAPPQAGDPPGLIRTVAQIRGGGLLQGTTEAVFQVTGSTPTGIAFAGDIDFTTNRATLTVDLDGTLDLTTGEFAASGDVTEATGKLDGATGTLTLAGRQNLLDPAGSFAETVSGQICVDLGGNGKK
Ga0190275_1077079113300018432SoilMRRATVLALMLPLLVLFGSRPATAGVSCHQINANGSGSGAAPQGGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTSPTLTGIAFTGDITFTTDRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0190268_1057983813300018466SoilLMLVQVGPATAGVSCHHINASGTGQGAPPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVAGPTPTGIAFAGVITFTTNRGTLSVDLDGTLDLTTGDFGASGAVSGASGKLDGATGTLTLAGVQDLLDPAGSFIETVSGEVCVDLGGNGMR
Ga0190270_1020690223300018469SoilMRRVAVLALLLPFLMLVQPGPATAGVSCHPIHAKGAGQGAPSQAGDPPGLIRTVAQIRGGGLLQGTTKAAFQVTGATPTGISFAGDITFTTNRATLTVDLDGTLDLTTGEFAASGDVIGATGKLDGATGSLTLAGVQNLLDPAGSFTETVSGEICVDLGGHASR
Ga0190270_1055369623300018469SoilMRRVAVLALLLPLLMLVQAGPATAGVSCHLINAQGAGQGAPSQGGDPPGLVRTVAQIRGGGLLQGTTEAAFQVTGFTPTGIAFAGHITFTTYRATLTVDLDGTLDLTTGEFGSSGHVSESTGKLEGATGTLTLTGMQNLLDPAG
Ga0190270_1066348113300018469SoilMRRIAVLALLLPLLTLGQAGPATAVVSCHLINATGAGQGAPPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTPTGIAFAGEITFTTNRGTLTVDLDGTLDLTTGDFAASGDVSGATGKLGGATGTLTLAGVQNLLDPAGSFIEAVSGEICVDLGGNAKE
Ga0190270_1071419323300018469SoilVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTAAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDTAGSFTEKVSGEICVDLGGNGNQ
Ga0190270_1130500813300018469SoilMRRLAVLALLLPLLMLVQAGPATAVVSCHHINATGAGEGAPPRAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVIGFTPTGIAFAGDITFTTNRGTLSVDLDGTLDLTTGDFRASGDVSGATGKLDGATGTLTLAGVQNLLDPAGSFIETVSGEICVDLGENGKE
Ga0190274_1025870523300018476SoilLPEPEPVLTPRASSLASNGYLAMTSRQCQKGRLQMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQGGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGDLAASGDVREATGKLDGATGTLTLAGVQNLLDPAGRFTEKVSGEICVDLGGNGNQ
Ga0190274_1203959313300018476SoilMRRLAVLALLLPMLMLVQVGPATAVVSCHHINATGAGHGAPPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVIGFTPTGIEFAGDITFTTNRGTLAVDLDGTLDLTTGDFRASGDVSGATGKLDGATGTLTLAGVQNLLDPAGSFI
Ga0190271_1003072663300018481SoilMRRVAVLALLLPFLMLVQPGPATAGVSCHPIHAKGAGQGAPSQAGDPPGLIRTVAQIRGGGLLQGTTKAAFQVTGATPTGIAFAGDITFTTNRAMLTVDLDGTLDLTTGEFAASGDVSGATGKLVGATGSLTLAGVQNLLDPAGSFTETVSGEVCVDLGGHGSR
Ga0190271_1008201523300018481SoilMRRIAVLAVLLPLLMLVQAVPATAVVSCHHINATGAGQGAPPQAGDPPGLIRTFAQIRGGGLLQGTTEAAFQVTGSTPTGIAFAGEITFTTNRGTLSVDLDGTLDLTTGDFRASGDVSGATGKLDGATGTLTLAGVQNLLDPAGSFTETVSGEICVDLGGNGEK
Ga0190271_1010914123300018481SoilMRRLAVLALLLPLLMLVQAGPATAVVSCHLINATGAGQGAPPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGEITFTTNRGTLTVDLDGTLDLTTGDFAASGDVSGATGKLDGATGTLTLAGVQDLLDPAGSFIETVSGEVCVDLGGNGMR
Ga0190271_1066965923300018481SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0190271_1152375413300018481SoilMRRIAVLAVLLPLLVLVQAGPATAVVSCHQINATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTPTGIAFAGALTFTTNRGTLSVDLDGTLDLTTGGFQASGDVSGATGKLDGATGTLTLAGVQNLLDPAGSFTETVSGEVCVDLAGNGKKK
Ga0190273_1057333623300018920SoilSCHRINARGVGQGAPPRAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGPTSTGIAFAGDITFTTNRGTLTVDLDGTLDLATGDFAASGEVRAATGRLEGATGTLTLVGVQDLLDPAGSFTETVSGEICVDLGGNGRT
Ga0190273_1110551513300018920SoilMRRIVVLAVLVPLLTVLQAGTAAAVVSCYQIHATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLNLTTGEFRSSGDVSGATGKLDGATGTLTL
Ga0190273_1239666813300018920SoilEPARSASPALDRGTLMRRAAVLALLMPVLMPLLMVVQAGPATAGVSCHRINARGVGQGAPPQAGDPPGLIRTVARIRGGGLLQGTTEAAFQVTGPTSTGIAFAGDITFTTNRATLTVDLVGTLDLTTGDFVSSGEVRAASGKLEGATGTLTLVGVQDLLDPAGTFTE
Ga0173481_1001943323300019356SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFSASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0206354_1103399513300020081Corn, Switchgrass And Miscanthus RhizosphereMMPARLPEPEPEPVLTPRASSLASNGELAMTGHQCHKGRLQVRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDDDPPGLIRTSAQIHGGGLLQGTTQAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGK
Ga0247783_103757613300022911Plant LitterMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0247772_110256213300023264Plant LitterMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVRGATGKLDGATGTLTLAGVQNLLDPA
Ga0247776_1007675713300023275Plant LitterMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFSASGDVREATGKLDGATGTITLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0207662_1049838713300025918Switchgrass RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQGGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0207694_1026043513300025924Corn RhizosphereMRRATVLALMLPLLMLFVTGPATAAVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICADLGGNGNQ
Ga0207709_1046559623300025935Miscanthus RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDDDPPGLIRTSAQIQGGGLLQGTTQAAFQVTGLTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTENVSGEICVDLGGNGNQ
Ga0207661_1032547923300025944Corn RhizosphereMRRATVLALMLPLLMLFVTGPATAAVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQDLLDPAGSFTETVSGEICVDLGGNGRT
Ga0207679_1075219213300025945Corn RhizosphereGPATAAVSCHQINATGWGSGAAPQDGDPPGLIRTSAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTENVSGEICVDLGGNGNQ
Ga0207678_1079217313300026067Corn RhizosphereMRRATVLALMLPLLMLFVTGPATAAVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIHGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRATLTVDLDGTLDLTTGEFAASGDVSGATGKLDGATGTLTLAGVQDLLDPAGSFTETVSGEICVDLGGNG
Ga0207648_1135451823300026089Miscanthus RhizosphereATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0207683_1054200723300026121Miscanthus RhizosphereMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTQAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDRATGEFVASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICADLGGNGNQ
Ga0207698_1029401113300026142Corn RhizosphereMRRATVLALMLPLLMLFVTGPATAAVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAG
Ga0247818_1030065723300028589SoilSKPMRRLVVLAVLLPLLTLLHAGQAAAAVSCHQINATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLHGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLNLTTGEFRSSGDVSEATGRLDGATGTLTLAGVQNLQDPAGRFMETVSGEVCVDLGGNGRK
Ga0247818_1108932313300028589SoilMRRIAVLAVLLPLLVLVQAGPATAVVSCHQINATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTPTGIAFAGAITFTTNRGTLSVDLDGTLDLTTGGFQASGDVSVATGKLDGATGTLTLA
Ga0247819_1029762913300028608SoilMRRIAVLAVLLPLLVLVQAGPATAVVSCHQINATGAGQGAASQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTPTGIAFAGAITFTTNRGTLSVDLDGTLDLTTGGFQASGDVSGGTGKLDGATGTLTLAGVQSLLDPAGSFTETVSGEVCVDLAGNGNKK
Ga0247819_1035999913300028608SoilMRRLVVLAVLLPLLTLLHAGQAAAAVSCHQINATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGVITFTTNRGTLSVDLDGTLDLTTGEFRSAGEVNGATGKLDGATGTLTLAGVQNLQDPAGSFLETLSGEVCVDLGGNGRK
Ga0307503_1001067213300028802SoilTALALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQGGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEEVSGEICVDLGGNGNQ
Ga0247826_1059028813300030336SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINAKGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLA
Ga0307413_1070340323300031824RhizosphereMRRIVVLAVLLPLLMLVQAGQATAATSCHQINATGAGQGAAPRPGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLDLTTGEFRASGDVSGATGKLDGATGALTLVGVQDLQDPAGSFVETVSGEVCLDLGGNGRT
Ga0310907_1030964713300031847SoilMRRATVLALVLPLLMLFGTGPATAGVSCHQINAKGSGIGAPPQGGDPPGLIRTVAQIRGGGLVQGTTEAAFRVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGN
Ga0308175_10059506913300031938SoilMRRAAVLALLLPFVLLVQPEPATAGVSCHPINAKGAGEGAPSQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTSAGIAFAGDITFTTNRATLTVDLVGTLDLRTGEFAASGDVSGATGKLGGATGSLTLAGVQNLLDPAGSFTETVSGEVCIDLGGNGSR
Ga0308175_10262249513300031938SoilEDKLASAGEARPVRRIVVLAVLLPLLPLLQAGPAAAAVSCHQIKATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDIAFTTNRGTLSVDLDGTLDLTTGAFRSSGDVSGATGKLDGATGTLTLAGVQNLQDPAGSFTETVSGEVCVDLGGNGRK
Ga0307416_10258906913300032002RhizosphereVQAGQATAATSCHQINATGAGQGAAPRPGDPPGLIRTVAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLDLTTGEFRASGDVSGATGKLDGATGALTLAGVQDLQDPAGSFIETVSGEVCLDLGGNGRK
Ga0307411_1210710813300032005RhizosphereLAVLLPLLMLVQAGQATAATSCHQINATGAGQGAAPRPGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLDLTTGEFRASGDVSGATGKLDGATGALTLVGVQDLQDPAGSFVETVSGEVCLDLGGNGRT
Ga0310906_1144278813300032013SoilVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFSASGDVREATGKLDGATGTITLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0326721_1004837813300032080SoilMRRIVVLAVLLPLLTILQAGPAAAAVSCHQIKATGAGQGASPQPGDPPGLIRTVAQIRGGGLLHGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLNLTTGEFRSSGYVSGATGKLDGATGTLTLAGVQDLQDPAGSFVETVSGEVCVDLGGN
Ga0326721_1014158023300032080SoilMRRIVVLAVLLPLLMLVQAGQATAATSCHQINATGAGQGAAPRPGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRGTLSVDLDGTLDLTTGEFRASGDVSGATGKLEGATGALTLAGVQNLQDPAGSFVETVSGEVCLDLGGNGRK
Ga0314782_078689_22_4893300034661SoilMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTITLAGVQNLLDPAGSFTEKVSGEICVDLGGDGNQ
Ga0314783_172653_80_5113300034662SoilMLFGTGPATAGVSCHQINAKGSGIGAPPQGGDPPGLIRTVAQIRGGGLVQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFSASGDVREATGKLDGATGTITLAGVQNLLDPAGSFTEKVSGEICVDL
Ga0314788_206256_2_4753300034666SoilMRRIAVLAVLLPLLVLVQAGPATAVVSCHQINATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTPTGIAFAGAITFTTNRGTLSVDLDGTLDLTTGGFQASGDVSGGTGKLDGATGTLTLAGVQNLLDPAGSFTETVSGEVCVDL
Ga0314792_183975_16_5103300034667SoilMRRATVLALMLPLLMLFGTGPARAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGDGNQ
Ga0314792_232435_1_4983300034667SoilMRRIAVLAVLLPLLVLVQAGPATAVVSCHQINATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTPTGIAFAGAITFTTNRGTLSVDLDGTLDLTTGGFQASGDVSVATGKLDGATGTLTLAGVQNLLDPAGSFTETVSGEVCVDLAGNGNKK
Ga0314796_080859_200_6673300034671SoilMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFSASGDVREATGKLDGATGTITLAGVQNLLDPAGSFTEKVSGEICVDLGGDGNQ
Ga0314797_058731_199_6933300034672SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTITLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0314798_072179_37_5373300034673SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGITFAGDITFTTNRSTLTLDLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0314800_057903_33_5273300034675SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGDGNQ
Ga0314803_057098_33_5273300034678SoilMRRATVLALMLPLLMLFGTGPATAGVSCHQINATGSGSGAAPQDGDPPGLIRTSAQIRGGGLLQGTTEAAFQVTGPTPTGIAFAGDITFTTNRSTLTLDLDGTLDLATGEFAASGDVREATGKLDGATGTLTLAGVQNLLDPAGSFTEKVSGEICVDLGGNGNQ
Ga0314803_116571_35_5323300034678SoilMRRIAVLAVLLPLLVLVQAGPATAVVSCHQINATGAGQGAAPQAGDPPGLIRTVAQIRGGGLLQGTTEAAFQVTGSTPTGIAFAGAITFTTNRGTLSVDLDGTLDLTTGGFQASGDVSGGTGKLDGATGTLTLAGVQNLLDPAGSFTETVSGEVCVDLAGYGNKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.