Metagenome / Metatranscriptome Family F073002

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F073002
Family Type	Metagenome / Metatranscriptome
Number of Sequences	120
Average Sequence Length	46 residues
Representative Sequence	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS
Number of Associated Samples	91
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	40.00 %
% of genes near scaffold ends (potentially truncated)	90.00 %
% of genes from short scaffolds (< 2000 bps)	98.33 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (80.833 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (58.333 % of family members)
Environment Ontology (ENVO)	Unclassified (80.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (64.167 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 34.62% β-sheet: 0.00% Coil/Unstructured: 65.38%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.30
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF00098	zf-CCHC	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
All Organisms	root	All Organisms	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
cellular organisms	root	All Organisms → cellular organisms	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	19.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	18.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	18.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	18.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	18.33 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	9.17 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	9.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	9.17 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	9.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	9.17 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	4.17 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	2.50 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	2.50 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	80.83 %
Setaria viridis	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	9.17 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	4.17 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2.50 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	2.50 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005330\|Ga0070690_101223645	Not Available	599	Open in IMG/M
3300005331\|Ga0070670_100881767	Not Available	810	Open in IMG/M
3300005335\|Ga0070666_11181955	Not Available	569	Open in IMG/M
3300005355\|Ga0070671_101256606	Not Available	652	Open in IMG/M
3300005438\|Ga0070701_10238069	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1093	Open in IMG/M
3300005445\|Ga0070708_100654949	Not Available	989	Open in IMG/M
3300005445\|Ga0070708_101534093	Not Available	620	Open in IMG/M
3300005466\|Ga0070685_11241691	Not Available	567	Open in IMG/M
3300005467\|Ga0070706_101134003	Not Available	719	Open in IMG/M
3300005615\|Ga0070702_101595919	Not Available	539	Open in IMG/M
3300005719\|Ga0068861_100209117	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1642	Open in IMG/M
3300005841\|Ga0068863_100713140	Not Available	997	Open in IMG/M
3300005841\|Ga0068863_100938419	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	866	Open in IMG/M
3300005843\|Ga0068860_101326283	Not Available	740	Open in IMG/M
3300005843\|Ga0068860_102451389	Not Available	541	Open in IMG/M
3300005844\|Ga0068862_101277723	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	735	Open in IMG/M
3300009092\|Ga0105250_10406015	Not Available	605	Open in IMG/M
3300009101\|Ga0105247_11302198	Not Available	583	Open in IMG/M
3300009981\|Ga0105133_100363	Not Available	1693	Open in IMG/M
3300009990\|Ga0105132_128968	Not Available	585	Open in IMG/M
3300009990\|Ga0105132_133288	Not Available	560	Open in IMG/M
3300009992\|Ga0105120_1019895	Not Available	733	Open in IMG/M
3300009992\|Ga0105120_1022309	Not Available	707	Open in IMG/M
3300009994\|Ga0105126_1028958	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	643	Open in IMG/M
3300009995\|Ga0105139_1055077	Not Available	709	Open in IMG/M
3300009995\|Ga0105139_1078628	Not Available	619	Open in IMG/M
3300010396\|Ga0134126_13097256	Not Available	501	Open in IMG/M
3300010401\|Ga0134121_11203716	Not Available	757	Open in IMG/M
3300012949\|Ga0153798_10254406	Not Available	589	Open in IMG/M
3300014325\|Ga0163163_11565381	Not Available	720	Open in IMG/M
3300014325\|Ga0163163_13298009	Not Available	503	Open in IMG/M
3300014326\|Ga0157380_12776299	Not Available	556	Open in IMG/M
3300015270\|Ga0182183_1084767	Not Available	522	Open in IMG/M
3300015278\|Ga0182099_1064163	Not Available	524	Open in IMG/M
3300015301\|Ga0182184_1061631	Not Available	597	Open in IMG/M
3300015306\|Ga0182180_1042214	Not Available	672	Open in IMG/M
3300015310\|Ga0182162_1039344	Not Available	768	Open in IMG/M
3300015310\|Ga0182162_1072326	Not Available	625	Open in IMG/M
3300015310\|Ga0182162_1095880	Not Available	564	Open in IMG/M
3300015311\|Ga0182182_1012722	Not Available	1053	Open in IMG/M
3300015311\|Ga0182182_1013976	Not Available	1025	Open in IMG/M
3300015311\|Ga0182182_1014649	Not Available	1011	Open in IMG/M
3300015311\|Ga0182182_1100284	Not Available	541	Open in IMG/M
3300015312\|Ga0182168_1051116	Not Available	728	Open in IMG/M
3300015317\|Ga0182136_1035410	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	829	Open in IMG/M
3300015319\|Ga0182130_1108148	Not Available	551	Open in IMG/M
3300015320\|Ga0182165_1064293	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	694	Open in IMG/M
3300015326\|Ga0182166_1036197	Not Available	824	Open in IMG/M
3300015326\|Ga0182166_1132199	Not Available	522	Open in IMG/M
3300015329\|Ga0182135_1066726	Not Available	696	Open in IMG/M
3300015330\|Ga0182152_1082909	Not Available	644	Open in IMG/M
3300015330\|Ga0182152_1123568	Not Available	551	Open in IMG/M
3300015331\|Ga0182131_1119260	Not Available	561	Open in IMG/M
3300015332\|Ga0182117_1039328	Not Available	897	Open in IMG/M
3300015333\|Ga0182147_1073134	Not Available	706	Open in IMG/M
3300015334\|Ga0182132_1157460	Not Available	518	Open in IMG/M
3300015335\|Ga0182116_1097143	Not Available	655	Open in IMG/M
3300015335\|Ga0182116_1160909	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	529	Open in IMG/M
3300015335\|Ga0182116_1162649	Not Available	526	Open in IMG/M
3300015336\|Ga0182150_1157392	Not Available	514	Open in IMG/M
3300015337\|Ga0182151_1112692	Not Available	590	Open in IMG/M
3300015338\|Ga0182137_1076155	Not Available	721	Open in IMG/M
3300015339\|Ga0182149_1152997	Not Available	531	Open in IMG/M
3300015340\|Ga0182133_1149603	Not Available	562	Open in IMG/M
3300015349\|Ga0182185_1198545	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	606	Open in IMG/M
3300015349\|Ga0182185_1204823	Not Available	597	Open in IMG/M
3300015350\|Ga0182163_1045666	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	1220	Open in IMG/M
3300015352\|Ga0182169_1063476	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1136	Open in IMG/M
3300015352\|Ga0182169_1243368	Not Available	585	Open in IMG/M
3300015353\|Ga0182179_1122405	Not Available	794	Open in IMG/M
3300015353\|Ga0182179_1192171	Not Available	648	Open in IMG/M
3300015354\|Ga0182167_1043401	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1512	Open in IMG/M
3300015354\|Ga0182167_1311967	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	556	Open in IMG/M
3300015354\|Ga0182167_1314709	Not Available	553	Open in IMG/M
3300017408\|Ga0182197_1084632	Not Available	628	Open in IMG/M
3300017412\|Ga0182199_1101463	Not Available	662	Open in IMG/M
3300017412\|Ga0182199_1129061	Not Available	604	Open in IMG/M
3300017412\|Ga0182199_1155171	Not Available	562	Open in IMG/M
3300017414\|Ga0182195_1166138	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	567	Open in IMG/M
3300017435\|Ga0182194_1120749	Not Available	552	Open in IMG/M
3300017435\|Ga0182194_1134389	Not Available	530	Open in IMG/M
3300017440\|Ga0182214_1136570	Not Available	539	Open in IMG/M
3300017445\|Ga0182198_1049574	Not Available	850	Open in IMG/M
3300017694\|Ga0182211_1159671	Not Available	537	Open in IMG/M
3300020023\|Ga0182178_1013863	Not Available	598	Open in IMG/M
3300025530\|Ga0207866_1024636	Not Available	1038	Open in IMG/M
3300025961\|Ga0207712_10663670	Not Available	907	Open in IMG/M
3300028049\|Ga0268322_1057455	Not Available	500	Open in IMG/M
3300028050\|Ga0268328_1000209	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	2997	Open in IMG/M
3300028050\|Ga0268328_1069660	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	508	Open in IMG/M
3300028051\|Ga0268344_1005156	Not Available	816	Open in IMG/M
3300028056\|Ga0268330_1004713	Not Available	1161	Open in IMG/M
3300028064\|Ga0268340_1022573	Not Available	802	Open in IMG/M
3300028141\|Ga0268326_1013799	Not Available	510	Open in IMG/M
3300028144\|Ga0268345_1005270	Not Available	826	Open in IMG/M
3300028153\|Ga0268320_1019684	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria viridis	575	Open in IMG/M
3300028154\|Ga0268341_1022911	Not Available	559	Open in IMG/M
3300028253\|Ga0268316_1002496	Not Available	970	Open in IMG/M
3300028253\|Ga0268316_1025401	Not Available	501	Open in IMG/M
3300028473\|Ga0268319_1001869	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1080	Open in IMG/M
3300028474\|Ga0268331_1000040	Not Available	4419	Open in IMG/M
3300028474\|Ga0268331_1010405	Not Available	683	Open in IMG/M
3300028476\|Ga0268329_1002139	Not Available	1038	Open in IMG/M
3300032466\|Ga0214503_1201020	Not Available	620	Open in IMG/M
3300032468\|Ga0214482_1078358	Not Available	632	Open in IMG/M
3300032469\|Ga0214491_1012291	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	1776	Open in IMG/M
3300032490\|Ga0214495_1151889	Not Available	512	Open in IMG/M
3300032589\|Ga0214500_1053598	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	1115	Open in IMG/M
3300032761\|Ga0314733_1079681	Not Available	623	Open in IMG/M
3300032792\|Ga0314744_1098987	Not Available	551	Open in IMG/M
3300032914\|Ga0314750_1114676	Not Available	628	Open in IMG/M
3300032915\|Ga0314749_1011161	Not Available	1670	Open in IMG/M
3300032915\|Ga0314749_1013736	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1553	Open in IMG/M
3300032916\|Ga0314734_1107125	Not Available	546	Open in IMG/M
3300032934\|Ga0314741_1028810	Not Available	1232	Open in IMG/M
3300033523\|Ga0314768_1154328	Not Available	807	Open in IMG/M
3300033534\|Ga0314757_1025081	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	1358	Open in IMG/M
3300033534\|Ga0314757_1128852	Not Available	610	Open in IMG/M
3300033535\|Ga0314759_1071399	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1065	Open in IMG/M
3300033538\|Ga0314755_1105694	Not Available	715	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	90.83%
Environmental	Environmental	7.50%
Engineered	Engineered	1.67%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	90.83%
Terrestrial	Environmental → Terrestrial	7.50%
Lab Enrichment	Engineered → Lab Enrichment	0.83%
Bioreactor	Engineered → Bioreactor	0.83%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	71.67%
Soil	Environmental → Terrestrial → Soil	7.50%
Unclassified	Host-Associated → Plants → Unclassified	6.67%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.83%
Rhizoplane	Host-Associated → Plants → Rhizoplane	5.00%
Roots	Host-Associated → Plants → Roots	1.67%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.83%
Unclassified	Engineered → Bioreactor → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	71.67%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	6.67%
Loam	Environmental → Terrestrial → Soil → Loam	5.83%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	3.33%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.50%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.67%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.67%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified	0.83%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	71.67%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	6.67%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	5.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	3.33%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.50%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.67%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.67%
Unclassified	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified	0.83%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	58.33%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	13.33%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	6.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	5.00%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.17%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.50%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.50%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.67%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	1.67%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.83%
Ionic Liquid And High Solid Enriched	Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched	0.83%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009990	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG	Host-Associated	Open in IMG/M
3300009992	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300012949	Switchgrass enrichment cultures co-assembly	Engineered	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015270	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015319	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017694	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated	Open in IMG/M
3300025530	Ionic liquid and high solid enriched microbial communities from the Joint BioEnergy Institute, USA - AR20-3-D (SPAdes)	Engineered	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028064	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028141	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028144	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028154	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032468	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032490	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032589	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032914	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032915	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032916	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032934	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033523	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033538	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070690_1012236452	3300005330	Switchgrass Rhizosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVYSVS*
Ga0070670_1008817672	3300005331	Switchgrass Rhizosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVCSVS*
Ga0070666_111819551	3300005335	Switchgrass Rhizosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVCSV
Ga0070671_1012566061	3300005355	Switchgrass Rhizosphere	MVRILSQLRESDLPVRDASRTLPSSSGLLEVLPIYQLLVDYIGSKVCSVS*
Ga0070701_102380691	3300005438	Corn, Switchgrass And Miscanthus Rhizosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS*
Ga0070708_1006549492	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	TLKFCNDAPTQGKKVRILSQLRESDLSVGDASRTLPSSSDLLEVLPIYQLSVDYIGSKVYSVS*
Ga0070708_1015340931	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVCSVS*
Ga0070685_112416911	3300005466	Switchgrass Rhizosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLSVDYIGSKVYSVS*
Ga0070706_1011340031	3300005467	Corn, Switchgrass And Miscanthus Rhizosphere	ILSQLREFDLPVGDASRTLPSSSGLLEVLPIYQLLVGYIGSKVYSVN*
Ga0070702_1015959191	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	LRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVYSVS*
Ga0068861_1002091171	3300005719	Switchgrass Rhizosphere	KKVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLSVDYIGSKVYSVS*
Ga0068863_1007131401	3300005841	Switchgrass Rhizosphere	LSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVCSVS*
Ga0068863_1009384191	3300005841	Switchgrass Rhizosphere	GKKVRILSQLRESDLPVGDANRTLRSSSGLLELLPIY*
Ga0068860_1013262831	3300005843	Switchgrass Rhizosphere	MVRILSQLRESDLPVGDASRTLSSSSGLLEVLPIYQLLVDYIRSKVYSVS*
Ga0068860_1024513891	3300005843	Switchgrass Rhizosphere	LSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS*
Ga0068862_1012777231	3300005844	Switchgrass Rhizosphere	LRESDLPVGDVSRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVN*
Ga0105250_104060151	3300009092	Switchgrass Rhizosphere	AKVRILSQLRESDLPVGDASRTQPSSSGLLEVLPIYQLLVDYIGSKVYSVS*
Ga0105247_113021981	3300009101	Switchgrass Rhizosphere	MVRILSQLRELDLPVGDASRTLPSSSGLLEVLPIYHLL
Ga0105133_1003631	3300009981	Switchgrass Associated	VRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYHLLVGYIGSKVYSVN*
Ga0105132_1289681	3300009990	Switchgrass Associated	MMHLREGKKVRILCQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS
Ga0105132_1332881	3300009990	Switchgrass Associated	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDY
Ga0105120_10198951	3300009992	Switchgrass Associated	MHLREGKMVRILSQLRELDLPVGDANRTWPSSSGLLEVLPIYQLLVDYIGSNIYSVS*
Ga0105120_10223091	3300009992	Switchgrass Associated	SQLRESDLPVGDASRTLPSSNGILEVLPIYQLSVDYIGSKVYSVS*
Ga0105126_10289581	3300009994	Switchgrass Associated	HLRQGKMVGILSQLRELNLPVGDANRTLPSSSGLLEVLPIYQRLVDYIGSKMYSVN*
Ga0105139_10550771	3300009995	Switchgrass Associated	MLNQLREFDLSVGDANRTLSSSSGLLDVLPMYQLLVGYIGSKVTMNTISV*
Ga0105139_10786281	3300009995	Switchgrass Associated	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQRLVDY
Ga0134126_130972561	3300010396	Terrestrial Soil	MHLREGKKVRILSQLRESDLPVGDASRTLPSSSGLLDVLIIYQLLVDYIGSKVYSVS*GSLTFPS
Ga0134121_112037161	3300010401	Terrestrial Soil	GKKVWILSQLRESDLPVGNASRMLPSSSGLLEVLPIYQLLVDYIGSKVYSVS*
Ga0153798_102544061	3300012949	Switchgrass Degrading	MVRILNQLRESDLPVGDASRTLPSSSGLLEVLPIYQR
Ga0163163_115653811	3300014325	Switchgrass Rhizosphere	MVRILSQLRESDLPVGDASRTLPSSSDLLEVLPIYQLLVGYIG
Ga0163163_132980091	3300014325	Switchgrass Rhizosphere	SQLRESDLPVGDASQTLPSSSGLLEVLPIYQLLVDYIGSKLYSVS*
Ga0157380_127762991	3300014326	Switchgrass Rhizosphere	MGRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLL
Ga0182183_10847671	3300015270	Switchgrass Phyllosphere	MTHLREGKMVRILSQLRELDLPIGDASRTLPSSSGLLELLPIYQRLVDYIGSKVYSVS
Ga0182099_10641631	3300015278	Switchgrass Phyllosphere	MTHLREGKMVRILSQLRELDLPVGDASRMLPSSSGLLEVLPIYQLLVDYIGSKVYLVS*
Ga0182184_10616311	3300015301	Switchgrass Phyllosphere	MVRILSQLRELDLPVGDANRMLPSSSGLLEVLPIYQRFVDNIGSKMCS
Ga0182180_10422141	3300015306	Switchgrass Phyllosphere	MLSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSK
Ga0182162_10393441	3300015310	Switchgrass Phyllosphere	DLPVGDASRTLPSSSGLLEVLPIYQLLVGYIGSKVYSVS*
Ga0182162_10723261	3300015310	Switchgrass Phyllosphere	MVRIHSQLRELDLPVGDASRMLPSSSGLLEVLPIYQQLVDYIGSKVYSVS
Ga0182162_10958802	3300015310	Switchgrass Phyllosphere	VRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQRLVDYIGSKVYSVS*
Ga0182182_10127221	3300015311	Switchgrass Phyllosphere	DLPVGDASRTLPSSSGLLEVLPIYQLLVGYIGSKVYSVN*
Ga0182182_10139762	3300015311	Switchgrass Phyllosphere	VRILSQLRESDLPVGDASRTLPSSNDLLEVLPIYQLSVDYIGSKVYSVS*
Ga0182182_10146491	3300015311	Switchgrass Phyllosphere	DLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS*
Ga0182182_11002841	3300015311	Switchgrass Phyllosphere	MIRILSQLRELDLPVGDANRTLPSSSGLLEVLPIYQLLVDYIGSKV
Ga0182168_10511161	3300015312	Switchgrass Phyllosphere	SQLRESDLPVGDASRTLPSSNGLLEVLPIYQLLVDYIGSKVYSVS*
Ga0182136_10354101	3300015317	Switchgrass Phyllosphere	SQLRELDLLVGDANRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS*
Ga0182130_11081481	3300015319	Switchgrass Phyllosphere	RILSQLREFDLPVGDASRTLPSSSGLLEVLPIYHSHLRRL*
Ga0182165_10642931	3300015320	Switchgrass Phyllosphere	ILSQLRELDLLVGDANRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS*
Ga0182166_10361971	3300015326	Switchgrass Phyllosphere	ILSQLREFDLPVGDASRTLPSSSGLLEVLPIYQLLVGYIGSKVYSVS*
Ga0182166_11321991	3300015326	Switchgrass Phyllosphere	MVRILSQLRELDLPIGDASRTLPSSSGLLEVLPIYQLLVD
Ga0182135_10667261	3300015329	Switchgrass Phyllosphere	PVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVCSVR*
Ga0182152_10829091	3300015330	Switchgrass Phyllosphere	VRILSQLREFDLPVGDASRTLPSSSGLFEVLPIYQLLLDYIGSKVYSVS*
Ga0182152_11235681	3300015330	Switchgrass Phyllosphere	GDASRTVPSSSGLLEVLPIYQLSVDYIMSKVYSVS*
Ga0182131_11192601	3300015331	Switchgrass Phyllosphere	MVRILSQLRESDLPVVDASRTLSSSSGLFELLLIYKLSVDY
Ga0182117_10393282	3300015332	Switchgrass Phyllosphere	HNHLREGKKVRILSQLRESDLPVGDASRTLPSRSGLLKVLPIYQLFVDYIRSKVYSVS*
Ga0182147_10731341	3300015333	Switchgrass Phyllosphere	SQLRESDLPVGDASRTLPSSSGLLEVLPIYKLLVDYIRSKVYSVS*
Ga0182132_11574601	3300015334	Switchgrass Phyllosphere	MVRIHNQLRELDLPISDASRMLPSSSGLLEVLPIYQLLVDYIGSKVYS
Ga0182116_10971431	3300015335	Switchgrass Phyllosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQRLV
Ga0182116_11609091	3300015335	Switchgrass Phyllosphere	GKMVRILSQLRELDLPVGDANRTLPSSSGLIEVLPIYQRLVDYIGSKINSVN*
Ga0182116_11626491	3300015335	Switchgrass Phyllosphere	LLSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVD
Ga0182150_11573921	3300015336	Switchgrass Phyllosphere	MVRILSQLRESDLPIGDASRTLPSSSGLLEVLPIYRLLVDYI
Ga0182151_11126921	3300015337	Switchgrass Phyllosphere	MVRILSQLRDSDLLVCDANRTLSSSSGLLELLPIYQPS
Ga0182137_10761551	3300015338	Switchgrass Phyllosphere	LLSQLRESDLPISDASRTLGSSSSLLELLPIFQLSVDYMW
Ga0182149_11529971	3300015339	Switchgrass Phyllosphere	SDLPVGDASRTLPSSSGLLEVLPIYQLIVDYIGSKVYSVS*
Ga0182133_11496032	3300015340	Switchgrass Phyllosphere	MVRILSQLRGSDLPVGDASRTLPSSSGLLEVLSIYQLLVGYIGS
Ga0182185_11985451	3300015349	Switchgrass Phyllosphere	GKKVRILSQLRESNLPVGDASRTLPSSSGLLEVLSIYQLLVDYIRSKVYSVI*
Ga0182185_12048231	3300015349	Switchgrass Phyllosphere	MVRILSQLREFDLPVDDASRTLPSSSGLLEVLPIYQLLVGYIG
Ga0182163_10456661	3300015350	Switchgrass Phyllosphere	LRELELPVGDANRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS*
Ga0182169_10634762	3300015352	Switchgrass Phyllosphere	MVRILSQLRELGLPVGDASRTLPSNSGLLEVLPIYQRIVDYIG
Ga0182169_12433681	3300015352	Switchgrass Phyllosphere	MVRILSQLRELDLSVGDASRMLPSSSGLLEVLPIYQLLVDYIGSKVY
Ga0182179_11224051	3300015353	Switchgrass Phyllosphere	LHLNIVSTRRREGMMLSQLREPDLPVGDASRTLRSSSGLLELLPIYQPSVDYMGS
Ga0182179_11921711	3300015353	Switchgrass Phyllosphere	REFDLPVGDANRTLYSSSGLLDVLPMYQLLVGYIGSKVTMNTISV*
Ga0182167_10434011	3300015354	Switchgrass Phyllosphere	TVRILSQLREFDLPVGDANQTLPLSSGLLEVLPIYQLLFDYIGSKIYSVN*
Ga0182167_13119671	3300015354	Switchgrass Phyllosphere	SQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS*
Ga0182167_13147091	3300015354	Switchgrass Phyllosphere	MVRILSQLRELDLSVGDASRMLPSSSGLLEVLPIYQLLVDYIGSK
Ga0182197_10846321	3300017408	Switchgrass Phyllosphere	MTHLREGKMVRILGQLREIDLPIGDASRMLPSSSVLFEMLPIYQLLVDYIGSKVY
Ga0182199_11014631	3300017412	Switchgrass Phyllosphere	MVRILSQLREFDLPVDDASRTLPSSSGLLEVLPIYQLLVGYI
Ga0182199_11290611	3300017412	Switchgrass Phyllosphere	MVRIHNQLRELDLPISDASRTLPSSSGLLEVLPIYQLLVDYIGSKST
Ga0182199_11551711	3300017412	Switchgrass Phyllosphere	DLPVGDASRTLPSSSGLLEVLPIYQLLVGYIGSKVYSVS
Ga0182195_11661381	3300017414	Switchgrass Phyllosphere	QPRLIILGVNILSQLREIDLPVGDANRTLPSSSGLLEVLAIYQCVVDYIGSKIYSVN
Ga0182194_11207491	3300017435	Switchgrass Phyllosphere	MVRILSQLRELDLPVGDASQTLPSSSGLLEVLPIYQLLVDYIGSKVYSV
Ga0182194_11343892	3300017435	Switchgrass Phyllosphere	GKMVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVYSVN
Ga0182214_11365701	3300017440	Switchgrass Phyllosphere	KMVRIVSQLRESDLPVGDASRTLPSSSGLLEVLPIY
Ga0182198_10495741	3300017445	Switchgrass Phyllosphere	MVRILSQLRDSDLPVGDANRTLSSSSGLLELLPIYEPSVDYIGSNGF
Ga0182211_11596711	3300017694	Switchgrass Phyllosphere	MLSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYTVS
Ga0182178_10138631	3300020023	Switchgrass Phyllosphere	GKKVRILSQLRESDFPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVCSVR
Ga0207866_10246361	3300025530	Ionic Liquid And High Solid Enriched	KVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVCSVS
Ga0207712_106636701	3300025961	Switchgrass Rhizosphere	KVRILSQLRESDLPVGDASRTLPSSSDLLEVLPIYQLSVDYIGSKVYSVS
Ga0268322_10574551	3300028049	Phyllosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIY
Ga0268328_10002093	3300028050	Phyllosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVCSVS
Ga0268328_10696601	3300028050	Phyllosphere	SDASRTLPSSSVLLEVLPIYQLLVDYIGSKVYSVS
Ga0268344_10051561	3300028051	Phyllosphere	MVRILSQLREFDLPVDDASRTLPSSSGLLEVLPIYQ
Ga0268330_10047132	3300028056	Phyllosphere	QLRESDLPVGDASRTLSSSNGLLEVLPIYQLSVDYIGSKEYSVS
Ga0268340_10225731	3300028064	Phyllosphere	MHLRLGKKVRILNQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVY
Ga0268326_10137991	3300028141	Phyllosphere	MVRILSQLREFDLPVDDASRTLPSSSGLLEVLPIY
Ga0268345_10052701	3300028144	Phyllosphere	MVRILSQLSESDLPVGDASRTISSSSGLLELLPIYQPSVDYI
Ga0268320_10196841	3300028153	Phyllosphere	QLREFDLPVGDASRTLPSSNGILEVLPIYQLSVAYIGSKVYSVS
Ga0268341_10229112	3300028154	Phyllosphere	GDANRTLPSSSDLLEVLPIYQLSVDYIGSKVYSVS
Ga0268316_10024962	3300028253	Phyllosphere	ISQLRESNLPVGDASRMLPSSSGLLEVLPIYQRLVDYIGSKVYSVS
Ga0268316_10254011	3300028253	Phyllosphere	MVRILSQLRELDLPIGDASRTLPSSSGFLEVLPIYQLLV
Ga0268319_10018691	3300028473	Phyllosphere	MILSQLRESDLPVGDASRTVPSSSGLLEVLPIYQLS
Ga0268331_10000406	3300028474	Phyllosphere	QLRESDLPIGDASRTLPSSSDLLEVLPIYQLSVDYIGSKVYSVS
Ga0268331_10104051	3300028474	Phyllosphere	MVRILSQLREFDLSVGDASRTLPSSSGLLEVLPIYQLLVGYIGSK
Ga0268329_10021392	3300028476	Phyllosphere	KKVRILSQLRESDLPVGDASRTLPSSNDLLEVLPIYQLSVDYIGSKVYSVS
Ga0214503_12010201	3300032466	Switchgrass Phyllosphere	MHLREGKMVRILSQLRELDLPVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS
Ga0214482_10783581	3300032468	Switchgrass Phyllosphere	SDLPVGDASRTLPSSSGLLEVLPIYQLSVDYIGSKVYSVS
Ga0214491_10122914	3300032469	Switchgrass Phyllosphere	LSQLRESDLTVGDANRTLHSSSGLLELLLIYRPSVDYIGSKSTP
Ga0214495_11518891	3300032490	Switchgrass Phyllosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYR
Ga0214500_10535981	3300032589	Switchgrass Phyllosphere	ILSQLRESDLLVGDASRTLPSSSGLLEVLPIYQLLVDYIGSKVYSVS
Ga0314733_10796811	3300032761	Switchgrass Phyllosphere	MHLREGKMVRILSQLRELDIPVGDASRTLPSSSGLLEVLPIY
Ga0314744_10989871	3300032792	Switchgrass Phyllosphere	MHLREGKMVRILSQLRELDLPVGDASRTLPSSSGLLEVL
Ga0314750_11146763	3300032914	Switchgrass Phyllosphere	KVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLSVDYIGSKVYSVS
Ga0314749_10111611	3300032915	Switchgrass Phyllosphere	ESDLPVGDASRTLPSSSGLLEVLPIYRLLVDYIGSKVYSVS
Ga0314749_10137363	3300032915	Switchgrass Phyllosphere	VRILSQLRESDLPVGDASRTLPSSSDLLEVLPIYQLLVGYIGSKVYSVN
Ga0314734_11071251	3300032916	Switchgrass Phyllosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQLLV
Ga0314741_10288101	3300032934	Switchgrass Phyllosphere	SQLRESDLPVGDASRTLPSSSGLLEVLPIYQLSVDYIGSKVYSVS
Ga0314768_11543281	3300033523	Switchgrass Phyllosphere	LRESDLPVGDASRTLPSSSGLLEVLPIYQLSVGYNGSKVYSVS
Ga0314757_10250811	3300033534	Switchgrass Phyllosphere	LPVGDASRTLPSSSVLLEVLPIYQLLVDYIGSKVYSVS
Ga0314757_11288521	3300033534	Switchgrass Phyllosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQRLVDYIGSKV
Ga0314759_10713991	3300033535	Switchgrass Phyllosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYQ
Ga0314755_11056941	3300033538	Switchgrass Phyllosphere	MVRILSQLRESDLPVGDASRTLPSSSGLLEVLPIYRLFVDYVGSKVYSVSCGSLTFLSVM

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F073002

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences