Metagenome / Metatranscriptome Family F073093

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F073093
Family Type	Metagenome / Metatranscriptome
Number of Sequences	120
Average Sequence Length	40 residues
Representative Sequence	NADAEWRYQVLEVVRGRKPAHQRERQLIAEFEPTLNTF
Number of Associated Samples	87
Number of Associated Scaffolds	120

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.83 %
% of genes near scaffold ends (potentially truncated)	97.50 %
% of genes from short scaffolds (< 2000 bps)	94.17 %
Associated GOLD sequencing projects	81
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (70.833 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.000 % of family members)
Environment Ontology (ENVO)	Unclassified (74.167 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (70.833 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 15.15% β-sheet: 0.00% Coil/Unstructured: 84.85%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.31
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 120 Family Scaffolds
PF10902	WYL_2	1.67
PF06941	NT5C	0.83
PF05050	Methyltransf_21	0.83
PF03597	FixS	0.83
PF00768	Peptidase_S11	0.83
PF05433	Rick_17kDa_Anti	0.83

COG ID	Name	Functional Category	% Frequency in 120 Family Scaffolds
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.83
COG3197	Cytochrome oxidase maturation protein, CcoS/FixS family	Posttranslational modification, protein turnover, chaperones [O]	0.83
COG4502	5'(3')-deoxyribonucleotidase	Nucleotide transport and metabolism [F]	0.83

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.83 %
All Organisms	root	All Organisms	29.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.83 %
Viruses	superkingdom	All Organisms → Viruses	25.00 %
cellular organisms	root	All Organisms → cellular organisms	4.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.83 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	17.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.67 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	4.17 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.83 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	17.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.50 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.83 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	17.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.50 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	1.67 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.83 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	17.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.50 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.83 %
Chlorobi	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.83 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	15.00 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.50 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	0.83 %
unclassified Chlorobiota	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.83 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	15.00 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.50 %
Chlorobiota bacteirum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	0.83 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	70.83 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	15.00 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	6.67 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.50 %
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.83 %
Chlorobiota bacteirum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000929\|NpDRAFT_10057230	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1855	Open in IMG/M
3300003497\|JGI25925J51416_10150879	Not Available	528	Open in IMG/M
3300004461\|Ga0066223_1246610	All Organisms → cellular organisms → Bacteria → Proteobacteria	916	Open in IMG/M
3300005527\|Ga0068876_10527940	Not Available	646	Open in IMG/M
3300005527\|Ga0068876_10642176	Not Available	572	Open in IMG/M
3300005580\|Ga0049083_10323570	Not Available	514	Open in IMG/M
3300005581\|Ga0049081_10072035	Not Available	1300	Open in IMG/M
3300005581\|Ga0049081_10128840	Not Available	933	Open in IMG/M
3300005582\|Ga0049080_10029404	All Organisms → Viruses → Predicted Viral	1918	Open in IMG/M
3300005582\|Ga0049080_10076147	Not Available	1149	Open in IMG/M
3300005582\|Ga0049080_10193003	Not Available	674	Open in IMG/M
3300005582\|Ga0049080_10254499	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	572	Open in IMG/M
3300005805\|Ga0079957_1255289	Not Available	811	Open in IMG/M
3300007559\|Ga0102828_1155446	Not Available	575	Open in IMG/M
3300007559\|Ga0102828_1164740	Not Available	559	Open in IMG/M
3300007642\|Ga0102876_1147201	Not Available	631	Open in IMG/M
3300007973\|Ga0105746_1362417	Not Available	507	Open in IMG/M
3300008110\|Ga0114343_1148164	Not Available	751	Open in IMG/M
3300008953\|Ga0104241_1011510	Not Available	605	Open in IMG/M
3300009056\|Ga0102860_1111203	Not Available	764	Open in IMG/M
3300009155\|Ga0114968_10474664	Not Available	674	Open in IMG/M
3300009158\|Ga0114977_10712114	Not Available	534	Open in IMG/M
3300009159\|Ga0114978_10027381	Not Available	4110	Open in IMG/M
3300009159\|Ga0114978_10658991	Not Available	600	Open in IMG/M
3300009160\|Ga0114981_10543903	Not Available	619	Open in IMG/M
3300009161\|Ga0114966_10068507	Not Available	2458	Open in IMG/M
3300009161\|Ga0114966_10597257	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	616	Open in IMG/M
3300009163\|Ga0114970_10428234	Not Available	731	Open in IMG/M
3300009164\|Ga0114975_10241293	Not Available	1013	Open in IMG/M
3300009182\|Ga0114959_10070584	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1968	Open in IMG/M
3300009182\|Ga0114959_10380096	Not Available	693	Open in IMG/M
3300009182\|Ga0114959_10517908	Not Available	574	Open in IMG/M
3300009185\|Ga0114971_10729830	Not Available	540	Open in IMG/M
3300009426\|Ga0115547_1140094	Not Available	778	Open in IMG/M
3300010157\|Ga0114964_10460736	Not Available	599	Open in IMG/M
3300010160\|Ga0114967_10474361	Not Available	614	Open in IMG/M
3300011010\|Ga0139557_1038123	Not Available	836	Open in IMG/M
3300011011\|Ga0139556_1015028	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1112	Open in IMG/M
3300012665\|Ga0157210_1059595	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	579	Open in IMG/M
3300013004\|Ga0164293_10963479	Not Available	534	Open in IMG/M
3300013005\|Ga0164292_10560565	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	742	Open in IMG/M
3300013005\|Ga0164292_10948649	Not Available	538	Open in IMG/M
3300014819\|Ga0119954_1013504	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1774	Open in IMG/M
3300014962\|Ga0134315_1032930	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	802	Open in IMG/M
3300017701\|Ga0181364_1065501	Not Available	559	Open in IMG/M
3300017722\|Ga0181347_1040576	Not Available	1427	Open in IMG/M
3300017722\|Ga0181347_1050816	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	1252	Open in IMG/M
3300017722\|Ga0181347_1084077	Not Available	924	Open in IMG/M
3300017722\|Ga0181347_1120620	Not Available	733	Open in IMG/M
3300017736\|Ga0181365_1039164	Not Available	1192	Open in IMG/M
3300017747\|Ga0181352_1203988	Not Available	508	Open in IMG/M
3300017774\|Ga0181358_1154195	Not Available	782	Open in IMG/M
3300017774\|Ga0181358_1178379	Not Available	708	Open in IMG/M
3300017777\|Ga0181357_1147491	Not Available	869	Open in IMG/M
3300017784\|Ga0181348_1105754	All Organisms → cellular organisms → Bacteria → Proteobacteria	1095	Open in IMG/M
3300017784\|Ga0181348_1258592	Not Available	599	Open in IMG/M
3300020151\|Ga0211736_10890123	Not Available	781	Open in IMG/M
3300020161\|Ga0211726_10071627	Not Available	567	Open in IMG/M
3300020205\|Ga0211731_10649482	Not Available	953	Open in IMG/M
3300020205\|Ga0211731_10929374	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	687	Open in IMG/M
3300020222\|Ga0194125_10654075	Not Available	619	Open in IMG/M
3300020506\|Ga0208091_1028919	Not Available	624	Open in IMG/M
3300020527\|Ga0208232_1021232	Not Available	926	Open in IMG/M
3300020549\|Ga0207942_1043031	Not Available	559	Open in IMG/M
3300020571\|Ga0208723_1019533	Not Available	1062	Open in IMG/M
3300021962\|Ga0222713_10049793	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	3209	Open in IMG/M
3300021962\|Ga0222713_10175806	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1454	Open in IMG/M
3300022179\|Ga0181353_1025219	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1572	Open in IMG/M
3300022190\|Ga0181354_1072693	All Organisms → Viruses → Predicted Viral	1139	Open in IMG/M
3300022190\|Ga0181354_1112293	Not Available	881	Open in IMG/M
3300022190\|Ga0181354_1233865	Not Available	531	Open in IMG/M
3300023184\|Ga0214919_10242212	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum	1302	Open in IMG/M
3300024348\|Ga0244776_10753105	Not Available	595	Open in IMG/M
3300027193\|Ga0208800_1008155	All Organisms → Viruses → Predicted Viral	1324	Open in IMG/M
3300027393\|Ga0209867_1001869	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	3101	Open in IMG/M
3300027503\|Ga0255182_1021702	All Organisms → Viruses → Predicted Viral	1913	Open in IMG/M
3300027541\|Ga0255158_1106333	Not Available	610	Open in IMG/M
3300027608\|Ga0208974_1026115	All Organisms → Viruses → Predicted Viral	1787	Open in IMG/M
3300027608\|Ga0208974_1042706	Not Available	1326	Open in IMG/M
3300027608\|Ga0208974_1084947	Not Available	861	Open in IMG/M
3300027608\|Ga0208974_1146760	Not Available	601	Open in IMG/M
3300027659\|Ga0208975_1091604	Not Available	890	Open in IMG/M
3300027679\|Ga0209769_1275189	Not Available	508	Open in IMG/M
3300027732\|Ga0209442_1063196	All Organisms → Viruses → Predicted Viral	1565	Open in IMG/M
3300027736\|Ga0209190_1125425	Not Available	1146	Open in IMG/M
3300027760\|Ga0209598_10365430	Not Available	540	Open in IMG/M
3300027772\|Ga0209768_10121664	Not Available	1255	Open in IMG/M
3300027772\|Ga0209768_10310775	All Organisms → cellular organisms → Bacteria → Proteobacteria	659	Open in IMG/M
3300027772\|Ga0209768_10325707	Not Available	637	Open in IMG/M
3300027782\|Ga0209500_10280745	Not Available	713	Open in IMG/M
3300027785\|Ga0209246_10126545	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1003	Open in IMG/M
3300027785\|Ga0209246_10152683	Not Available	907	Open in IMG/M
3300027785\|Ga0209246_10188210	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	808	Open in IMG/M
3300027785\|Ga0209246_10384461	Not Available	529	Open in IMG/M
3300027808\|Ga0209354_10260352	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	695	Open in IMG/M
3300027808\|Ga0209354_10273368	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	675	Open in IMG/M
3300027963\|Ga0209400_1095833	All Organisms → Viruses → Predicted Viral	1394	Open in IMG/M
3300027971\|Ga0209401_1344173	Not Available	505	Open in IMG/M
3300028124\|Ga0228621_1056268	Not Available	579	Open in IMG/M
3300029930\|Ga0119944_1018648	All Organisms → Viruses	960	Open in IMG/M
3300031786\|Ga0315908_11554547	Not Available	514	Open in IMG/M
3300031787\|Ga0315900_10568141	Not Available	839	Open in IMG/M
3300031787\|Ga0315900_10973834	Not Available	561	Open in IMG/M
3300031857\|Ga0315909_10438818	Not Available	922	Open in IMG/M
3300031963\|Ga0315901_10904342	Not Available	628	Open in IMG/M
3300031963\|Ga0315901_10961899	Not Available	601	Open in IMG/M
3300032050\|Ga0315906_11132631	Not Available	574	Open in IMG/M
3300032092\|Ga0315905_10987914	Not Available	709	Open in IMG/M
3300032116\|Ga0315903_10972730	Not Available	597	Open in IMG/M
3300032116\|Ga0315903_11023415	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	576	Open in IMG/M
3300034060\|Ga0334983_0235749	Not Available	1119	Open in IMG/M
3300034062\|Ga0334995_0375055	Not Available	900	Open in IMG/M
3300034064\|Ga0335001_0016937	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	4305	Open in IMG/M
3300034066\|Ga0335019_0466965	Not Available	760	Open in IMG/M
3300034093\|Ga0335012_0341250	Not Available	748	Open in IMG/M
3300034103\|Ga0335030_0488404	Not Available	779	Open in IMG/M
3300034105\|Ga0335035_0038601	All Organisms → Viruses → Predicted Viral	3172	Open in IMG/M
3300034106\|Ga0335036_0846245	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	524	Open in IMG/M
3300034106\|Ga0335036_0877771	Not Available	511	Open in IMG/M
3300034117\|Ga0335033_0030888	Not Available	3407	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	99.17%
Terrestrial	Environmental → Terrestrial	0.83%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	88.33%
Marine	Environmental → Aquatic → Marine	10.83%
Soil	Environmental → Terrestrial → Soil	0.83%

Habitat	Taxonomy	Distribution
Lentic	Environmental → Aquatic → Freshwater → Lentic	38.33%
Lake	Environmental → Aquatic → Freshwater → Lake	36.67%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	8.33%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	5.00%
Coastal	Environmental → Aquatic → Marine → Coastal	2.50%
River	Environmental → Aquatic → Freshwater → River	1.67%
Unclassified	Environmental → Aquatic → Marine → Unclassified	1.67%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.83%
Drinking Water	Environmental → Aquatic → Freshwater → Drinking Water	0.83%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.83%
Ice	Environmental → Aquatic → Freshwater → Ice	0.83%
Pelagic	Environmental → Aquatic → Marine → Pelagic	0.83%
Neritic Zone	Environmental → Aquatic → Marine → Neritic Zone	0.83%
Sand	Environmental → Terrestrial → Soil → Sand	0.83%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	36.67%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	35.00%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	8.33%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	5.00%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	3.33%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	2.50%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	1.67%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	1.67%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Marine → Pelagic → Unclassified	0.83%
Unclassified	Environmental → Aquatic → Marine → Neritic Zone → Unclassified	0.83%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	0.83%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	25.00%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	16.67%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	11.67%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	10.00%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	8.33%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	5.83%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	5.00%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	3.33%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	1.67%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.67%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	0.83%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.83%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.83%
Freshwater	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater	0.83%
Aquatic	Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic	0.83%
Surface Water	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water	0.83%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater	0.83%
Seawater	Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater	0.83%
Marine	Environmental → Aquatic → Marine → Coastal → Unclassified → Marine	0.83%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.83%
Pelagic Marine	Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine	0.83%
Freshwater And Marine	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine	0.83%
Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Sand	0.83%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000929	Marine plume microbial communities from the Columbia River - 15 PSU	Environmental	Open in IMG/M
3300003497	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN	Environmental	Open in IMG/M
3300004461	Marine viral communities from Newfoundland, Canada BC-2	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005580	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300007559	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541	Environmental	Open in IMG/M
3300007642	Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3	Environmental	Open in IMG/M
3300007973	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008953	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4	Environmental	Open in IMG/M
3300009056	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009159	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG	Environmental	Open in IMG/M
3300009160	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009163	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009182	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG	Environmental	Open in IMG/M
3300009185	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG	Environmental	Open in IMG/M
3300009426	Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420	Environmental	Open in IMG/M
3300010157	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300011010	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice	Environmental	Open in IMG/M
3300011011	Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m	Environmental	Open in IMG/M
3300012665	Freshwater microbial communities from Talbot River, Ontario, Canada - S11	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300014819	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A	Environmental	Open in IMG/M
3300014962	Surface water microbial communities from Bangladesh - BaraHaldiaSW0309	Environmental	Open in IMG/M
3300017701	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017722	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017747	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N	Environmental	Open in IMG/M
3300017774	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020222	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m	Environmental	Open in IMG/M
3300020506	Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020527	Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020549	Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020571	Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300022179	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300024348	0.2um to 3um size fraction coassembly	Environmental	Open in IMG/M
3300027193	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 (SPAdes)	Environmental	Open in IMG/M
3300027393	Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes)	Environmental	Open in IMG/M
3300027503	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d	Environmental	Open in IMG/M
3300027541	Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027659	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)	Environmental	Open in IMG/M
3300027679	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)	Environmental	Open in IMG/M
3300027732	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes)	Environmental	Open in IMG/M
3300027736	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027760	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027772	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027782	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027785	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)	Environmental	Open in IMG/M
3300027808	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)	Environmental	Open in IMG/M
3300027963	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027971	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300028124	Seawater microbial communities from Monterey Bay, California, United States - 25D	Environmental	Open in IMG/M
3300029930	Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727	Environmental	Open in IMG/M
3300031786	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300032092	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121	Environmental	Open in IMG/M
3300032116	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119	Environmental	Open in IMG/M
3300034060	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034064	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034093	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072	Environmental	Open in IMG/M
3300034103	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119	Environmental	Open in IMG/M
3300034105	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127	Environmental	Open in IMG/M
3300034106	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131	Environmental	Open in IMG/M
3300034117	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
NpDRAFT_100572305	3300000929	Freshwater And Marine	LAGASWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF*
JGI25925J51416_101508792	3300003497	Freshwater Lake	LRDNADAEWRYQVLEVVRGRKPAHQRERQLIAEYSPNLNTF*
Ga0066223_12466103	3300004461	Marine	QWSFCNALRANADAEWRYEVLEVVRGRKPAHQVERQYIADFEPTLNTF*
Ga0068876_105279401	3300005527	Freshwater Lake	EWRYEVLDVVRGRKPAHQSERALIDLFEPTLNTF*
Ga0068876_106421762	3300005527	Freshwater Lake	IRNNADAEWRYQVLEVVRGRKPAHQRERQLIAEYSPNLNTF*
Ga0049083_103235701	3300005580	Freshwater Lentic	SDCTWTYEVIEVVRGRKPAHQRERQLISELNPSLNTF*
Ga0049081_100720355	3300005581	Freshwater Lentic	SFCAAIRNNADAEWRYQVLEVVRGRKPAHQRERQLIAEFEPTLNTF*
Ga0049081_101288401	3300005581	Freshwater Lentic	RNLAGASWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF*
Ga0049080_100294047	3300005582	Freshwater Lentic	YSFLRENPEVQLQYEVLEVVRGRKPAYQRERELIAEYEPNLNTF*
Ga0049080_100761471	3300005582	Freshwater Lentic	LRNLAGASWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF*
Ga0049080_101930034	3300005582	Freshwater Lentic	DEAVQYEVIEVVRGRKAAHSRERELIASLSPSLNTF*
Ga0049080_102544993	3300005582	Freshwater Lentic	VQIQYEVLEVVRGRKPAYQRERELIAQYQPNLNTF*
Ga0079957_12552893	3300005805	Lake	VQLQYEVLEVVRGRKPAYQRERELIAEYEPNLNTF*
Ga0102828_11554461	3300007559	Estuarine	LYSYLRDNPEVQIQYEVLEVVRGRKPAYARERELIAQYQPNLNTF*
Ga0102828_11647401	3300007559	Estuarine	SWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF*
Ga0102876_11472013	3300007642	Estuarine	ALRELSDCTWSYQVIEVVRGRKPAHQRERQLISELNPTLNTF*
Ga0105746_13624172	3300007973	Estuary Water	AAWQYEVLEVIRGRKPAHQRERELIAEFEPSLNTF*
Ga0114343_11481641	3300008110	Freshwater, Plankton	DCEWRYEVLDVVRGRKPAHQSERALIDLFEPTLNTF*
Ga0104241_10115101	3300008953	Freshwater	PELPLRYEVIEVVRGRKPAYQRERELIAALVPSLNTF*
Ga0102860_11112033	3300009056	Estuarine	EVQIQYEVLEVVRGRKPAYQRERELIAQYQPNLNTF*
Ga0114968_104746643	3300009155	Freshwater Lake	DAVWRYEVLEVVRGRKPAHQRERQLIAEFQPNLNTF*
Ga0114977_107121141	3300009158	Freshwater Lake	WSLYAFLSNNPEVTVQYEVLEVIRGRKPAYQRERELISEYQPTLNTF*
Ga0114978_100273811	3300009159	Freshwater Lake	NPELPLRYEVIEVVRGRKPAYQRERELIGELSPSLNTF*
Ga0114978_106589911	3300009159	Freshwater Lake	ENPEVVLRYEVLEVVRGRKAAHSRERELIAEWAPSLNTF*
Ga0114981_105439033	3300009160	Freshwater Lake	ALRNLAGASWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF*
Ga0114966_1006850710	3300009161	Freshwater Lake	DNPEVQIQYEVLEVVRGRKPAYQRERELIAQYQPNLNTF*
Ga0114966_105972573	3300009161	Freshwater Lake	LYSYLRDNPEVQIQYEVLEVVRGRKPAYQRERELIAQYQPNLNTF*
Ga0114970_104282343	3300009163	Freshwater Lake	FCAALRDNAECEWRYEVLEVVRGRKPAHQRERQLIAEFEPTLNTF*
Ga0114975_102412931	3300009164	Freshwater Lake	NTDADFRYEVLEIVRGRKPAHQRERELIAEFEPTLNTF*
Ga0114959_100705841	3300009182	Freshwater Lake	MCVAIRELAQCDWKYEVVEIVRGRKPAHQRERQLIAELAPSLNTF*
Ga0114959_103800961	3300009182	Freshwater Lake	MSDCTWTYDVIEVVSGRKPAHQRERQLISELNPTLNTF*
Ga0114959_105179081	3300009182	Freshwater Lake	AEWRYQVLEVVRGRKPAHQRERQLIAEYSPNLNTF*
Ga0114971_107298303	3300009185	Freshwater Lake	LRSNTDADFRYEVLEVVRGRKPAHQRERQLIAEYEPTLNTF*
Ga0115547_11400941	3300009426	Pelagic Marine	TIYYEILEVIRGRKNAYQRERELIRELEPSLNDF*
Ga0114964_104607363	3300010157	Freshwater Lake	ADFRYEVLEIVRGRKPAHQRERELIAEFEPTLNTF*
Ga0114967_104743612	3300010160	Freshwater Lake	MSDAEYQYEVLEVVRGRKPAHQRERQLISELAPTLNTF*
Ga0139557_10381233	3300011010	Freshwater	EWRYQVLEVVRGRKPAHQRERQLIAEFEPTLNTF*
Ga0139556_10150285	3300011011	Freshwater	DWRYQVLEVVRGRKNAHQRERELIRDLNPTLNTF*
Ga0157210_10595952	3300012665	Freshwater	LSYLSVTSWQYEVLEVIRGRKPAHQRERELIAEFEPSLNTF*
Ga0164293_109634793	3300013004	Freshwater	AEWRYEVLEVIRGRKPAHQREREFIAEFQPTLNTF*
Ga0164292_105605653	3300013005	Freshwater	IEAEYRYEVLEVIRGRKPAHQRERELIVELEPSLNTF*
Ga0164292_109486491	3300013005	Freshwater	PEVQIQYEVLEVVRGRKPAYQRERELIAEYEPNLNTF*
Ga0119954_10135047	3300014819	Freshwater	ALRVLDDCTWTYQVLEVVRGRKNAHQRERELIRDYEPSLNTF*
Ga0134315_10329301	3300014962	Surface Water	DIVEYEVLEVVRGRKPAHQRERELIRELEPSLNEF*
Ga0181364_10655011	3300017701	Freshwater Lake	AGAAWQYEVLEVIRGRKPAHQRERELIAKFEPSLNTF
Ga0181347_10405767	3300017722	Freshwater Lake	NADAEWRYQVLEVVRGRKPAHQRERQLIAEYSPNLNTF
Ga0181347_10508161	3300017722	Freshwater Lake	NPEVQIQYEVLEVVRGRKPAYQRERELIAQYQPDLNTF
Ga0181347_10840774	3300017722	Freshwater Lake	RNTALRELSDCTWTYQVIEVVRGRKPAHQRERQLISELNPSLNTF
Ga0181347_11206201	3300017722	Freshwater Lake	ALRDNADAEWRYQVLEVVRGRKPAHQRERQLIAEFEPTLNTF
Ga0181365_10391644	3300017736	Freshwater Lake	NALRELAGASWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF
Ga0181352_12039881	3300017747	Freshwater Lake	SDEVIQYEVLEVVRGRKAAHSRERELIASLSPSLNTF
Ga0181358_11541953	3300017774	Freshwater Lake	ALRELAGAAWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF
Ga0181358_11783793	3300017774	Freshwater Lake	DNPEVQIQYEVLEVVRGRKPAYARERELIAQYQPDLNTF
Ga0181357_11474911	3300017777	Freshwater Lake	NLAGAAWQYEVLEVIRGRKPAHQRERELIAEYQPSLNTF
Ga0181348_11057544	3300017784	Freshwater Lake	FLRDNIEAEYRYEVLEIVRGRKPAHQRERALIAELEPSLNTF
Ga0181348_12585922	3300017784	Freshwater Lake	DAEWRYQVLEVVRGRKPAHQRERQLIAEYSPNLNTF
Ga0211736_108901234	3300020151	Freshwater	ANPEVQIQYEVLEVVRGRKPAYQRERELIAEYQPNLNTF
Ga0211726_100716273	3300020161	Freshwater	WTLYSFLRENPEVQLQYEVLEVVRGRKPAYQRERELIAEYEPNLNTF
Ga0211731_106494824	3300020205	Freshwater	LAGAAWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF
Ga0211731_109293743	3300020205	Freshwater	MCNALRELAGAAWQYEVLEVIRGRKPAHQRERQLIAE
Ga0194125_106540753	3300020222	Freshwater Lake	AWAFCDFIRNNVNAEFRYEVIEIVRGRKNAYQRERQIIAEFEPSLNTF
Ga0208091_10289193	3300020506	Freshwater	LRENPEVQLQYEVLEVVRGRKPAYQRERELIAEYEPNLNTF
Ga0208232_10212321	3300020527	Freshwater	ALRDNAECEWRYEVLEIVRGRKPAHQRERQLIAEYEPTLNTF
Ga0207942_10430313	3300020549	Freshwater	FIRDNANASFTYEVLEIVRGRKPAHQRERELIAYLEPTLNTF
Ga0208723_10195331	3300020571	Freshwater	LYSYLRDNPEVQIQYEVLEVVRGRKPAYQRERELIAQYQPNLNTF
Ga0222713_100497931	3300021962	Estuarine Water	FLRAMPDAEYRYEVLEVVRGRKPAHQRERQLISELAPTLNTF
Ga0222713_101758061	3300021962	Estuarine Water	TDAEYRYEVLEIVRGRKPAHQRERELISELSPTLNTF
Ga0181353_10252196	3300022179	Freshwater Lake	SAFTYGVIEFVRGRRPAHARERELIREFNPALNTR
Ga0181354_10726931	3300022190	Freshwater Lake	SDCTWTYQVIEVVRGRKPAHQRERQLISELNPSLNTF
Ga0181354_11122931	3300022190	Freshwater Lake	SNTDADFRYEVLEVVRGRKPAHQRERQLIAEYEPTLNTF
Ga0181354_12338651	3300022190	Freshwater Lake	INAEWRYEVLEVVRGRKPAHQRERQYIADFEPTLNTF
Ga0214919_102422121	3300023184	Freshwater	SFCNALREHVDAEWRYEVLEVVRGRKPAHQVERQYIAEFEPTLNTF
Ga0244776_107531053	3300024348	Estuarine	CQFIRDNANASFTYEVLEIVRGRKPAHQRERELIAYLEPTLNTF
Ga0208800_10081551	3300027193	Estuarine	RELAGAAWQYEVLEVIRGRKPAHQRERELIAEFEPSLNTF
Ga0209867_10018691	3300027393	Sand	TALRNLAGASWQYEVLEVIRGRKPAHQRERELIAEFEPSLNTF
Ga0255182_10217026	3300027503	Freshwater	IRDLADCEWRYEVVEVVRGRKPAHQRERELIATYEPSLNTF
Ga0255158_11063333	3300027541	Freshwater	NKDWSLYAFLRDNPEVQLQYEVIEVVRGRKNAYQRERELIAEYEPNLNTF
Ga0208974_10261156	3300027608	Freshwater Lentic	NLAGASWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF
Ga0208974_10427061	3300027608	Freshwater Lentic	LRNLAGASWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF
Ga0208974_10849473	3300027608	Freshwater Lentic	DNADAEWRYQVLEVVRGRKPAHQRERQLIAEFEPTLNTF
Ga0208974_11467603	3300027608	Freshwater Lentic	VQLQYEVLEVVRGRKPAYQRERELIAEYEPNLNTF
Ga0208975_10916043	3300027659	Freshwater Lentic	AFCEALRTLADCEWRYEVLDVVRGRKPAHQSERALIDLFEPTLNTF
Ga0209769_12751892	3300027679	Freshwater Lake	RELAGAAWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF
Ga0209442_10631961	3300027732	Freshwater Lake	GAAWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF
Ga0209190_11254251	3300027736	Freshwater Lake	DADFRYEVLEIVRGRKPAHQRERELIAEFEPTLNTF
Ga0209598_103654301	3300027760	Freshwater Lake	LRSNTDADFRYEVLEIVRGRKPAHQRERELIAEFEPTLNTF
Ga0209768_101216644	3300027772	Freshwater Lake	TALRNLAGAAWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF
Ga0209768_103107751	3300027772	Freshwater Lake	EAEYRYEVLEIVRGRKPAHQRERALIAELEPSLNTF
Ga0209768_103257072	3300027772	Freshwater Lake	NTDADFRYEVLEVVRGRKPAHQRERQLIAEYEPTLNTF
Ga0209500_102807451	3300027782	Freshwater Lake	DNPELPLRYEVIEVVRGRKPAYQRERELIGELSPSLNTF
Ga0209246_101265451	3300027785	Freshwater Lake	FCAALRDNAECEWRYEVLEIVRGRKPAHQRERQLIAEFEPTLNTF
Ga0209246_101526834	3300027785	Freshwater Lake	NALRELAGAAWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF
Ga0209246_101882104	3300027785	Freshwater Lake	ALRDNPDAVWRYEVLEVVRGRKPAHQRERQLIAEFQPNLNTF
Ga0209246_103844612	3300027785	Freshwater Lake	PDAVWRYEVLEVVRGRKPAHQRERQLIAEFQPNLNTF
Ga0209354_102603523	3300027808	Freshwater Lake	LRDNPDAVWRYEVLEVVRGRKPAHQRERQLIAEFQPNLNTF
Ga0209354_102733681	3300027808	Freshwater Lake	ENPEVQLQYEVLEVVRGRKPAHQRERQYIAEYQPTLNTF
Ga0209400_10958331	3300027963	Freshwater Lake	AIRELAQCDWKYEVVEIVRGRKPAHQRERQLIAELEPSLNTF
Ga0209401_13441731	3300027971	Freshwater Lake	MCTFLRNNIEAEYRYEVIEVVRGRKAAHQRERELIGALSPSLNTF
Ga0228621_10562682	3300028124	Seawater	LRETTETVRCEVLEVVRGRKAAYIRERELIAELSPTLNDF
Ga0119944_10186484	3300029930	Aquatic	SNPTSSWTYQVLEIVRGRKNAHQRERQLIADMSPTLNTF
Ga0315908_115545471	3300031786	Freshwater	NFIRQNPEVELDYEVLEVVRGRKPAYQRERELISELQPSLNTF
Ga0315900_105681411	3300031787	Freshwater	SEVVQYEVLEVVRGRKAAHSRERELIEALSPSLNTF
Ga0315900_109738341	3300031787	Freshwater	ADAEWRYQVLEVVRGRKPAHQRERQLIAEFEPTLNTF
Ga0315909_104388181	3300031857	Freshwater	GASWQYEVLEVIRGRKPAHQRERQLIAEFEPSLNTF
Ga0315901_109043421	3300031963	Freshwater	CEWRYEVLDVVRGRKPAHQSERALIDLFEPTLNTF
Ga0315901_109618991	3300031963	Freshwater	NADAEWRYQVLEVVRGRKPAHQRERQLIAEFEPTLNTF
Ga0315906_111326313	3300032050	Freshwater	YSFLKENPETTIQYEVIEVVRGRKPAYQRERELIAEYEPTLNTF
Ga0315905_109879143	3300032092	Freshwater	CTAIRDNADAEWRYEVIEVVRGRKPAHQRERQLIAEFSPTLNTF
Ga0315903_109727301	3300032116	Freshwater	ANPETTIQYEVIEVVRGRKPAYQRERELIAEYEPTLNTF
Ga0315903_110234153	3300032116	Freshwater	YSFLRENPEVQIQYEVIEVVRGRKNAYQREREIIAEVAPSLNTF
Ga0334983_0235749_3_128	3300034060	Freshwater	LRNNVDAEWRYEVLEVVRGRKPAHQRERELIEVLTPTLNTF
Ga0334995_0375055_2_124	3300034062	Freshwater	RANPDGNWRYEVLEVVRGRKPAHQRERELTKQLKANLNEF
Ga0335001_0016937_1_126	3300034064	Freshwater	IRDNANASFTYEVLEIVRGRKPAHQRERELIAYLEPTLNTF
Ga0335019_0466965_642_758	3300034066	Freshwater	LADCEWRYEVLDVVRGRKPAHQSERALIDLFEPTLNTF
Ga0335012_0341250_636_746	3300034093	Freshwater	NASFTYEVLEIVRGRKPAHQRERELIAYLEPTLNTF
Ga0335030_0488404_637_777	3300034103	Freshwater	TLYSFLRENPEVQLQYEVLEVVRGRKPAYQRERELIAEYEPNLNTF
Ga0335035_0038601_2_121	3300034105	Freshwater	ELAGAAWQYEVLEVIRGRKPAHQRERELIAEFEPSLNTF
Ga0335036_0846245_14_151	3300034106	Freshwater	MCQFIRNNANASFTYEVLEIVRGRKPAHQRERELIAYLEPTLNTF
Ga0335036_0877771_382_510	3300034106	Freshwater	FIRDNADASFTYEVLEIVRGRKPAHQRERELITDLEPTLNTF
Ga0335033_0030888_2_124	3300034117	Freshwater	RANPEVQIQYEVLEVVRGRKPAYQRERELIAEYEPNLNTF

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F073093

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences