NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073159

Metagenome / Metatranscriptome Family F073159

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073159
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 95 residues
Representative Sequence MARVKKGAVRTGHGVMCNICGLNCGKGGALKKHVEGAHDVNYDQYKRCFYGEVKTIIADSWDDSVSTANGRTVVTHVLVRRFVGDPGPRGATRSARRAV
Number of Associated Samples 109
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.67 %
% of genes near scaffold ends (potentially truncated) 35.00 %
% of genes from short scaffolds (< 2000 bps) 75.83 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(12.500 % of family members)
Environment Ontology (ENVO) Unclassified
(22.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(25.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.96%    β-sheet: 21.26%    Coil/Unstructured: 63.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF01850PIN 2.50
PF05016ParE_toxin 1.67
PF00856SET 1.67
PF13589HATPase_c_3 1.67
PF00589Phage_integrase 1.67
PF08849BrxA 1.67
PF01844HNH 1.67
PF13847Methyltransf_31 0.83
PF13635DUF4143 0.83
PF12695Abhydrolase_5 0.83
PF03781FGE-sulfatase 0.83
PF11215DUF3010 0.83
PF00118Cpn60_TCP1 0.83
PF16653Sacchrp_dh_C 0.83
PF01609DDE_Tnp_1 0.83
PF13749HATPase_c_4 0.83
PF14903WG_beta_rep 0.83
PF13643DUF4145 0.83
PF02661Fic 0.83
PF00005ABC_tran 0.83
PF00580UvrD-helicase 0.83
PF10137TIR-like 0.83
PF03989DNA_gyraseA_C 0.83
PF01916DS 0.83
PF01972SDH_sah 0.83
PF13676TIR_2 0.83
PF05973Gp49 0.83
PF01930Cas_Cas4 0.83
PF01797Y1_Tnp 0.83
PF03009GDPD 0.83
PF00950ABC-3 0.83
PF04255DUF433 0.83
PF04471Mrr_cat 0.83
PF01555N6_N4_Mtase 0.83
PF13561adh_short_C2 0.83
PF00201UDPGT 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.67
COG1819UDP:flavonoid glycosyltransferase YjiC, YdhE familyCarbohydrate transport and metabolism [G] 1.67
COG0188DNA gyrase/topoisomerase IV, subunit AReplication, recombination and repair [L] 0.83
COG0210Superfamily I DNA or RNA helicaseReplication, recombination and repair [L] 0.83
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.83
COG0584Glycerophosphoryl diester phosphodiesteraseLipid transport and metabolism [I] 0.83
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 0.83
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.83
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.83
COG10743’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V)Replication, recombination and repair [L] 0.83
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 0.83
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.83
COG1468CRISPR/Cas system-associated exonuclease Cas4, RecB familyDefense mechanisms [V] 0.83
COG1899Deoxyhypusine synthaseTranslation, ribosomal structure and biogenesis [J] 0.83
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.83
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.83
COG2442Predicted antitoxin component of a toxin-antitoxin system, DUF433 familyDefense mechanisms [V] 0.83
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.83
COG3293TransposaseMobilome: prophages, transposons [X] 0.83
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.83
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.83
COG3973DNA helicase IVReplication, recombination and repair [L] 0.83
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 0.83
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.83
COG5421TransposaseMobilome: prophages, transposons [X] 0.83
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.83
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.83

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.67 %
UnclassifiedrootN/A3.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2038011000|ACOD_FV90NF401DY7DUAll Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium502Open in IMG/M
2038011002|Coalbed1143_GAIGPUK01CK4BNAll Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium533Open in IMG/M
3300001213|JGIcombinedJ13530_100594684Not Available1179Open in IMG/M
3300001213|JGIcombinedJ13530_102752270All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300001213|JGIcombinedJ13530_102941644All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium503Open in IMG/M
3300002096|C687J26661_1004993All Organisms → cellular organisms → Bacteria2231Open in IMG/M
3300002703|draft_11071527All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3524Open in IMG/M
3300004007|Ga0055476_10222278All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria656Open in IMG/M
3300004139|Ga0058897_10142600Not Available506Open in IMG/M
3300005235|Ga0066637_10020480All Organisms → cellular organisms → Bacteria4128Open in IMG/M
3300005329|Ga0070683_100360563All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1384Open in IMG/M
3300005657|Ga0073903_10009424All Organisms → cellular organisms → Bacteria4896Open in IMG/M
3300005989|Ga0075154_10183383All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1204Open in IMG/M
3300006918|Ga0079216_11231672All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium604Open in IMG/M
3300007072|Ga0073932_1027321All Organisms → cellular organisms → Bacteria3568Open in IMG/M
3300007511|Ga0105000_1109159All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1879Open in IMG/M
3300008001|Ga0100389_1281264All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium742Open in IMG/M
3300008010|Ga0100397_1175297All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium766Open in IMG/M
3300009078|Ga0105106_10285950All Organisms → cellular organisms → Bacteria1195Open in IMG/M
3300009082|Ga0105099_10010328All Organisms → cellular organisms → Bacteria4752Open in IMG/M
3300009102|Ga0114948_11463977All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium542Open in IMG/M
3300009146|Ga0105091_10086959All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1420Open in IMG/M
3300009146|Ga0105091_10277694All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium813Open in IMG/M
3300009157|Ga0105092_10051458All Organisms → cellular organisms → Bacteria2211Open in IMG/M
3300009175|Ga0073936_10758914All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium531Open in IMG/M
3300009540|Ga0073899_10031346All Organisms → cellular organisms → Bacteria → Proteobacteria4308Open in IMG/M
3300009702|Ga0114931_10144648All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1932Open in IMG/M
3300010046|Ga0126384_11111222All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium725Open in IMG/M
3300010343|Ga0074044_10034121Not Available3563Open in IMG/M
3300010379|Ga0136449_104449739All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium516Open in IMG/M
3300010399|Ga0134127_10226533All Organisms → cellular organisms → Bacteria1755Open in IMG/M
3300012931|Ga0153915_13452779All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium512Open in IMG/M
3300013092|Ga0163199_1113373All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1128Open in IMG/M
(restricted) 3300013130|Ga0172363_10580311All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium711Open in IMG/M
(restricted) 3300013133|Ga0172362_10680809All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium692Open in IMG/M
3300014167|Ga0181528_10001119All Organisms → cellular organisms → Bacteria16915Open in IMG/M
3300014203|Ga0172378_10035137All Organisms → cellular organisms → Bacteria4400Open in IMG/M
3300014491|Ga0182014_10096580All Organisms → cellular organisms → Bacteria1793Open in IMG/M
3300014492|Ga0182013_10233891All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1077Open in IMG/M
3300014496|Ga0182011_10830223All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium578Open in IMG/M
3300014882|Ga0180069_1033027All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1127Open in IMG/M
3300016371|Ga0182034_10438131All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1079Open in IMG/M
3300016387|Ga0182040_11026467All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium688Open in IMG/M
3300017960|Ga0180429_10476866All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium834Open in IMG/M
3300017966|Ga0187776_10970765All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium622Open in IMG/M
3300018005|Ga0187878_1020226All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium3520Open in IMG/M
3300018015|Ga0187866_1310663All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium551Open in IMG/M
3300018034|Ga0187863_10747449All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium553Open in IMG/M
3300018043|Ga0187887_10166896All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1315Open in IMG/M
3300018046|Ga0187851_10482288All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium705Open in IMG/M
3300018059|Ga0184615_10514738All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium642Open in IMG/M
3300018062|Ga0187784_10006917All Organisms → cellular organisms → Bacteria9161Open in IMG/M
3300018079|Ga0184627_10034030All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2584Open in IMG/M
3300018088|Ga0187771_11303349All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium616Open in IMG/M
3300019458|Ga0187892_10134447All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia1411Open in IMG/M
3300020198|Ga0194120_10015298All Organisms → cellular organisms → Bacteria8500Open in IMG/M
3300020200|Ga0194121_10377563All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium705Open in IMG/M
3300020814|Ga0214088_1605023All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium594Open in IMG/M
3300021137|Ga0214165_1021386All Organisms → cellular organisms → Bacteria1662Open in IMG/M
3300021520|Ga0194053_10222069All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium747Open in IMG/M
3300022177|Ga0228536_1048086All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium732Open in IMG/M
3300022181|Ga0228535_1007299All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium4759Open in IMG/M
3300022553|Ga0212124_10186729All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1128Open in IMG/M
3300022553|Ga0212124_10596176All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium573Open in IMG/M
3300022554|Ga0212093_1044926All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2592Open in IMG/M
3300022555|Ga0212088_10815233All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium536Open in IMG/M
3300022556|Ga0212121_10163975All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1608Open in IMG/M
3300025017|Ga0210022_1188386All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium524Open in IMG/M
3300025081|Ga0208953_1001072All Organisms → cellular organisms → Bacteria18292Open in IMG/M
3300025152|Ga0208373_1185467All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300025313|Ga0209431_10990797All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium595Open in IMG/M
3300025319|Ga0209520_10496500All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium717Open in IMG/M
3300025322|Ga0209641_10461409All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium907Open in IMG/M
3300025326|Ga0209342_10823312All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium728Open in IMG/M
3300025327|Ga0209751_10905535All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium677Open in IMG/M
3300025715|Ga0209310_1138677All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium720Open in IMG/M
3300025944|Ga0207661_10084766All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2625Open in IMG/M
3300027675|Ga0209077_1035744All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1351Open in IMG/M
3300027722|Ga0209819_10042880All Organisms → cellular organisms → Bacteria1547Open in IMG/M
3300027724|Ga0209582_1069431All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla1231Open in IMG/M
3300027792|Ga0209287_10043183All Organisms → cellular organisms → Bacteria1646Open in IMG/M
3300027896|Ga0209777_10216333All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1529Open in IMG/M
3300029799|Ga0311022_12283652All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium691Open in IMG/M
3300029959|Ga0272380_10165757All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1642Open in IMG/M
3300030007|Ga0311338_10225203All Organisms → cellular organisms → Bacteria2133Open in IMG/M
3300030503|Ga0311370_11041931All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium907Open in IMG/M
3300030520|Ga0311372_10411777All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2041Open in IMG/M
3300030618|Ga0311354_11016690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea763Open in IMG/M
3300031234|Ga0302325_10602931All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1617Open in IMG/M
3300031234|Ga0302325_10658529Not Available1522Open in IMG/M
3300031234|Ga0302325_12639751All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium594Open in IMG/M
3300031707|Ga0315291_10170703All Organisms → cellular organisms → Bacteria2250Open in IMG/M
3300031708|Ga0310686_117445587All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1431Open in IMG/M
3300031719|Ga0306917_11065268All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium630Open in IMG/M
3300031744|Ga0306918_10553579All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium901Open in IMG/M
3300031746|Ga0315293_10244545All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1459Open in IMG/M
3300031772|Ga0315288_10115818All Organisms → cellular organisms → Bacteria3035Open in IMG/M
3300031772|Ga0315288_11012439All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium738Open in IMG/M
3300031813|Ga0316217_10320639All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium595Open in IMG/M
(restricted) 3300031825|Ga0255338_1000014All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira771895Open in IMG/M
3300031885|Ga0315285_10122508All Organisms → cellular organisms → Bacteria2217Open in IMG/M
3300031890|Ga0306925_10371537All Organisms → cellular organisms → Bacteria → Proteobacteria1535Open in IMG/M
3300031910|Ga0306923_10255489All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2005Open in IMG/M
3300031912|Ga0306921_11699698All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium682Open in IMG/M
3300031946|Ga0310910_11161583All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium600Open in IMG/M
3300031949|Ga0214473_12161617All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium538Open in IMG/M
3300032053|Ga0315284_11560084All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium697Open in IMG/M
3300032053|Ga0315284_11599088All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium685Open in IMG/M
3300032070|Ga0315279_10434257All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium887Open in IMG/M
3300032163|Ga0315281_10014209All Organisms → cellular organisms → Bacteria10745Open in IMG/M
3300032163|Ga0315281_11105461All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium797Open in IMG/M
3300032173|Ga0315268_10132888All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium2356Open in IMG/M
3300032173|Ga0315268_10871768All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium903Open in IMG/M
3300032261|Ga0306920_101609701All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium923Open in IMG/M
3300032516|Ga0315273_10416455All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1809Open in IMG/M
3300032676|Ga0316229_1216556All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium738Open in IMG/M
3300033402|Ga0326728_10001435All Organisms → cellular organisms → Bacteria83936Open in IMG/M
3300033402|Ga0326728_10860818All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium649Open in IMG/M
3300034091|Ga0326724_0474609All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium646Open in IMG/M
3300034165|Ga0364942_0197235All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium657Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment12.50%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.67%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.17%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil4.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater2.50%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.50%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater2.50%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer2.50%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland2.50%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.50%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.50%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge2.50%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.67%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion1.67%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment1.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.67%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.67%
Defined MediumEngineered → Modeled → Simulated Communities (Microbial Mixture) → Unclassified → Unclassified → Defined Medium1.67%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.83%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.83%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water0.83%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.83%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.83%
Coalbed WaterEnvironmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water0.83%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.83%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.83%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.83%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.83%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.83%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment0.83%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.83%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.83%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.83%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.83%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.83%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.83%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.83%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.83%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.83%
Fungus GardenHost-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden0.83%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.83%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments0.83%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.83%
Anaerobic Digester DigestateEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate0.83%
Granular SludgeEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge0.83%
Bioremediated Contaminated GroundwaterEngineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater0.83%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2038011000Fungus garden microbial communities from Atta colombica in Panama - from dump topHost-AssociatedOpen in IMG/M
2038011002Coalbed microbial communities from New Mexico, USA - 343EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002096Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B2EnvironmentalOpen in IMG/M
3300002703Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5EngineeredOpen in IMG/M
3300004007Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2EnvironmentalOpen in IMG/M
3300004139Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005235Groundwater microbial communities from aquifer - Crystal Geyser CG08_land_8/20/14_0.20EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005657Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulkEngineeredOpen in IMG/M
3300005989Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNAEngineeredOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007072Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaGEnvironmentalOpen in IMG/M
3300007511Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300008001Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-13EnvironmentalOpen in IMG/M
3300008010Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-21EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009082Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009102Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaGEnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009175Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaGEnvironmentalOpen in IMG/M
3300009540Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-PhEngineeredOpen in IMG/M
3300009702Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300013092Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150mEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014203Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017960Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_1 metaGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300020198Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65mEnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300020814Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahitEngineeredOpen in IMG/M
3300021137Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnionEnvironmentalOpen in IMG/M
3300021520Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L227-8mEnvironmentalOpen in IMG/M
3300022177Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1.SEngineeredOpen in IMG/M
3300022181Enriched culture of PCE-dechlorinating microbial communities from Ithaca, New York, USA - SJ1EngineeredOpen in IMG/M
3300022553Powell_combined assemblyEnvironmentalOpen in IMG/M
3300022554Dewar_combined assemblyEnvironmentalOpen in IMG/M
3300022555Alinen_combined assemblyEnvironmentalOpen in IMG/M
3300022556Kivu_combined assemblyEnvironmentalOpen in IMG/M
3300025017Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-20 (SPAdes)EnvironmentalOpen in IMG/M
3300025081Groundwater microbial communities from Rifle, Colorado - Rifle Oxygen_injection B2 (SPAdes)EnvironmentalOpen in IMG/M
3300025152Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection C2 (SPAdes)EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025715Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027675Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027724Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit (SPAdes)EngineeredOpen in IMG/M
3300027792Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300029799Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119EngineeredOpen in IMG/M
3300029959EPA Superfund site combined assemblyEngineeredOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031813Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoAEnvironmentalOpen in IMG/M
3300031825 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - MeOH1_35cm_T4_195EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300032676Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ACODT_90911302038011000Fungus GardenMAARKKGAVRPGQGVMCNICGLNCGKGGALKKHVEGAHSVDYDAYKKCFYGTVKTILADSWDDTVSTSNGDTVVVHVLVRRFIQDPGPRGATRAVRKQSA
Coalbed5_102345002038011002Coalbed WaterMARRRKNAVRQGQGTMCNICGVNCGRGGPLKKHLKGAHDIDYDDYKKCFYDFDGKVKTILADKWDDSVSTSAGKTVITHVLVRRFIGDPGPRGVRRSG
JGIcombinedJ13530_10059468423300001213WetlandMFILVFLEGGVMAERAKGAVRAGHGVMCNICGKNCGKGGALKKHVEMAHAPVTYEAYKICFYQEAKTVLADAWDDTVSTNRGSTVVTHIFVRRFIQDPGPRGATRAVRKQIV*
JGIcombinedJ13530_10275227023300001213WetlandMAGRRKGAVRPGHGVMCNICGKNCGKGGALKTHVEGAHPPVTYETYKICFYGEAKNILADSWDDSVSTKSGDTVVTHVLARRFVQEPGLRGVTRAVRKQKA*
JGIcombinedJ13530_10294164423300001213WetlandMATRQKGAVRVGHGVMCNICGINCGKGGALKKHIEGAHAPVSYEVYKICFYGKAKTILADGWDDSVSTKNGDTVVTHVLVRRFIQEPGPRGATRAVRKQTSK*
C687J26661_100499323300002096GroundwaterMARRKKHAVRSGAGSMCNICGRNCGKGGALRTHIEGAHKVSYDAYKTCFYGDVKTQIADTWDDSVKTHGGQTVITHVLVRRFIGNPGERGVRRKVP*
draft_1107152723300002703Hydrocarbon Resource EnvironmentsMAARPKGAVRRGHGVMCNICGINCGKGGALKTHIEGAHPPVTYEAYKICFYGEPKHILADAWDDSVSTKNGDTVVTHVIARRFVQEPGPRGATRAVRKQKA*
Ga0055476_1022227813300004007Natural And Restored WetlandsMASRPKGAVGPGHGVMCNICGKNCGKGGALKTHIEGAHPPVTYEAYKICYYGEPKNIRADAWDDSVSTKNGDTVVTRVLARRFVQEPGPRGATRAVRKQKA*
Ga0058897_1014260013300004139Forest SoilMCKICGKNCGKGGPLKTHVEGAHAPVTYDAYKICFDDAKILTSAWDDSGSTKNGKIVVIHVLARRFLLEPGGRRATRSERILK*
Ga0066637_1002048033300005235GroundwaterMPRKKKGAVRKGRGVMCNICGLNCGKGGALKKHVEGTHEVDYEIYKKCFYGIAKNTIADSWDDSVSTAKGKTVITHVLVRRFVGEPGHRGANRAARIKK*
Ga0070683_10036056323300005329Corn RhizosphereMSRRRKGAVRTGHGAMCNICGRNCGKGGALKKHVEGAHDVAYDAYRKCFDGDAKTFIADAWDGSVSTSSGDPVITHVLVRRFIGDPSWREVTRSARPPVL*
Ga0073903_1000942423300005657Activated SludgeMAGRAKGAVRVGHGVMCNICGKNCGKGGALKRHVEGAHQPVTYEAYKVCFYGVAKNVLADTWDDSVSTKNGDTVVTHVFARRFIQEPGPRGATRTARKQPA*
Ga0075154_1018338323300005989Wastewater EffluentMCNICGLNCGKGGALKKHVEGAHQVDYDAYKKCFYGTVKTILADSWDDTVSTSNGDTVVVHVLVRRFIQDPGPRGATRAVRKQRA*
Ga0079216_1123167223300006918Agricultural SoilMPKRNRSAVRVGQGVMCNICGKNCGKGGALSTHIAGAHRVEYDQYKRCFYGEAKTIIADGWDDSVATTSGKSVVTHVLVCRFVNEPGRRGATRTPRSLK*
Ga0073932_102732133300007072Hot Spring SedimentMPQRKKGAVRKGAGSMCNICGINGGKGGSLRKHIEGAHGVDYDSYKKCFYGDVRTVIADTWDDSVNTSKGDTVMTHVLVRRFVGYPGPRGVSKINKK*
Ga0105000_110915913300007511MarineMVLLVRIEGGEPMARRAKYAVSPGAGVMCNICGLNCGKGGALKKHVEGAHGIAYEDYKKCFYGEVKTILADGWDDSVKTSSGKTVITHVLVRRFVGDPGPRGATRAVNKQK*
Ga0100389_128126413300008001AquiferMPRKKKGAVRKGRGVMCNICGLNCGKGGALKKHVEGTHEVDYEIYKKCFYGIAKNTIADSWDDSVSTAKGKTVITHVLVRRFVGEPGHRVANRAARIKK*
Ga0100397_117529723300008010AquiferNICGLNCGKGGALKKHVEGTHEVDYEIYKKCFYGIAKNTIADSWDDSVSTAKGKTVITHVLVRRFVGEPGHRGANRAARIKK*
Ga0105106_1028595013300009078Freshwater SedimentAVRTGHGVMCNICGKNCGKGGALKTHIEGAHSPVTYDTYKICFYGEQKTILADSWDDSVSTKNGDTVVTHVLARRFIQEPGPRGATRAVRKQKA*
Ga0105099_1001032833300009082Freshwater SedimentMAARPKGAVRTGHGVMCNICGKNCGKGGALKTHIEGAHPPVTYEVYKICFYGEQKNILADSWDDSVSTKNGDTVVTHVLARRFVQEPGPRGATRAVRKQKA*
Ga0114948_1146397723300009102Deep SubsurfaceGKGAMCNVCGLNCGKGGALKKHIEESHGVSYDSYKICFYDRMKTKIADAWDDSVSTSKGQTVITHVLVRRFVRDPGHRGATRSVPKSS*
Ga0105091_1008695933300009146Freshwater SedimentMLTMARKPKGTVRVGHGVMCNICGINCGKGGALKKHVEGAHAPVTYEVYKICFYGKPKTVLADAWDDSVTTKNGDAVVTHVLARRFIQN
Ga0105091_1027769413300009146Freshwater SedimentMARRKKGTVRKGRGAMCNICGRNCGKGGALKRHIEDTHEVDYGQYKRCFYGGVETSVAYEWDASACTNNGKTVIIHVLVRRFIGDPGPRGVCR*
Ga0105092_1005145833300009157Freshwater SedimentMLTMARKPKGTVRVGHGVMCNICGINCGKGGALKKHVEGAHAPVTYEVYKICFYGKPKTVLADAWDDSVTTKNGDAVVTHVLARRFIQNPGPRGATRAVRKQKA*
Ga0073936_1075891423300009175Freshwater Lake HypolimnionKGAVRTGHGAMCNICGRNCGKGGALKRHVEGAHEVTYEAYKKCFYGDARTFIANAWDDSVTTHDGRPVVTHVLVRRFIVDPGPRGATRAARP*
Ga0073899_1003134673300009540Activated SludgeMAGRAKGAVRVGHSVMCNICGKNCGKGGALKRHVEGAHQPVTYEAYKVCFYGVAKNVLADTWDDSVSTKNGDTVVTHVFARRFIQEPGPRGATRTARKQPA*
Ga0114931_1014464813300009702Deep SubsurfaceKKRKKGAVRPGKGVMCNICGLNCGKGGALKKHVEAVHHVNYEAYKTCFYGDVKTVIADAWDDSVSTSAQNTVITHVLVRRFIGDPGPRGATRSARRTS*
Ga0126384_1111122213300010046Tropical Forest SoilMARRKKGAVRLGHGAMCNICGLNCGKGGPLKKHIEGAHNIKYADYKKCFYGQVVHTYADTWDSRVSTSNGNQVIVHTLVRRFVGQTGRRGATRTVPVRE*
Ga0074044_1003412153300010343Bog Forest SoilMAGRKKGAVRPGHGVMCKICGKNCGKGGALKTHIEGAHAPVTYDAYKICFYGKVQTILADSWDDSVSTSSGKVVVTHVLARRFFQAPGLRRVTRAERKQSI*
Ga0136449_10444973913300010379Peatlands SoilMAGRKKGAVRPGHGVMCNICGKNCGKGGPLKTHIEGAHPPVTYEAYKICFYGVASNVLADAWDDTVSTSSGKTVVTHVLARRFVQDPGPRGATRAVRKQPV*
Ga0134127_1022653343300010399Terrestrial SoilMCNICGKNCGKGGALKMHVERAHDVSYEHYRICFYGGAVKTVIADAWDDSVSTSGGRTVVTHVLVRRFVADPGPRGATRSVPQAV*
Ga0153915_1345277913300012931Freshwater WetlandsMVARSKGAVRLGHGVMCNICGRNCGKGGALKTHIEGAHPPVTYEAYKICFYGEPKNILADAWDDSVSTKNGDTVVTHVLARRFVQEPGPR
Ga0163199_111337333300013092FreshwaterAEKPKGTVRVGHGVMCNICGINCGKGGALKKHVEGAHAPVTYEAYKICFYSKQKTILADAWDDSVSTSKGNTVVTHIFVRRFIQEPGPRGATRAVRKQKV*
(restricted) Ga0172363_1058031113300013130SedimentMARRQKSAVRQGQGVMCNVCGINCGKGGALKKHVEGAHSISYDDYKKAFYGTTKTIISDSWDASVKTSSGNTVITHVLVRRFVGDPGPRGVTRSARVNK*
(restricted) Ga0172362_1068080923300013133SedimentMCNVCGRNCGKGGALKKHVEGAHNVAYDVYKRCFYAEAKTVLADAWDDTVKTHAGDTVITHVLVRRFVGDPGPRGVPRAARPIR*
Ga0181528_1000111953300014167BogVEATLARKKKGAVRSGHGVMCNICGRNCGKGGALKTHVEGAHSVDYEEYKRCFYGAVSTVLADAWDDSVATTSGKIVITHVLVRRFIGEPGWRKVTRSARPVV*
Ga0172378_1003513743300014203GroundwaterMSRRQKGAVRVGHGVMCNICGINCGKGGALKKHIEEAHDVAYEDYKKCFYGSAKTILADGWDDSVSTTNGKTVVTHILVRRFIQEPGPRGATRAARKPE*
Ga0182014_1009658013300014491BogMCNICGLNCGKGGALKKHVEGAHDVNYDQYKRCFYGEVKTIIADSWDDSVSTANGRTVVTHVLVRRFVGDPGPRGATRSARRAV*
Ga0182013_1023389123300014492BogMARVKKGAVRTGHGVMCNICGLNCGKGGALKKHVEGAHDVNYDQYKRCFYGEVKTIIADSWDDSVSTANGRTVVTHVLVRRFVGDPGPRGATRSARRAV*
Ga0182011_1083022323300014496FenMCNVCGLNCGKGGALKKHIEGAHGVQYDDYKKCFEGEVRTLIADQWDDSVKTSGGDTVITHVLVRRFIGDPGRRGVSWRN
Ga0180069_103302733300014882SoilMPTRRKGAVRKGRGVMCNICGLNCGKGGALKKHIEDGHKVKYESYKTCFYGKAKTILADSWDDKVRTKSGSTVITHIFVRRFIGDPGHRGATRAARIIQ*
Ga0182034_1043813113300016371SoilMAQRRKAGAVRAGHGVMCNMCGKNCGKGAPLKKHVESAHGIGYGDYKKCYYTGVKTILADSWDDSVFTSKGNTVLTHILVR
Ga0182040_1102646723300016387SoilMAQRRKAGAVRAGHGVMCNMCGKNCGKGAPLKKHVESAHGIGYGDYKKCYYTGVKTILADSWDDSVFTSKGNTVLPHSLVRRFVGNPGPRGATRSVRPN
Ga0180429_1047686623300017960Hypersaline Lake SedimentYAVSKGKGVMCNICGKNCGKGGALKKHVEATHKVAYDAYKTCFYGEVKTTIADGWDDSVKTSNGQRAITHVLVRRFVGDPGPRGANRAVRPQK
Ga0187776_1097076513300017966Tropical PeatlandMPRRKKGAVRPGKGVMCNICGKNCGKGGALRKHVEQGHHLPYKHYKLCFYGKVETLIADGWDHSVSTSDGKTVVTHVIVRRFVGDPGPRGATRSANPA
Ga0187878_102022653300018005PeatlandMAGRMKHAVRPGQGVMCNVCGVNCGKGGALKKHIEGAHSVSYDDYKTCFYGTPKTIIADGGDDSVSTTSGQTVVTHVLVRRFIQDPGPRGATRAVRPQSI
Ga0187866_131066323300018015PeatlandMAGRMKHAVRPGQGVMCNVCGVNCGKGGALKKHIEGAHSVSYDDYKTCFYGTPKTIIADGGGDSVSTTSGQTVVTHVLVRRFIQDPGP
Ga0187863_1074744913300018034PeatlandLARKKKGAVRSGHGVMCNICGRNCGKGGALKTHVEGAHSVDYEEYKRCFYGAVSTVLADAWDDSVATTSGKIVITHVLVRRFIGEPGWRKVTRSARPVV
Ga0187887_1016689613300018043PeatlandVRSGHGVMCNICGRNCGKGGALKTHVEGAHSVDYEEYKRCFYGAVSTVLADAWDDSVATTSGKIVITHVLVRRFIGEPGWRKVTRSARPVV
Ga0187851_1048228813300018046PeatlandMSRIRKGAVRLGQGVMCNICGRNCGKGGALKKHVEGSHGVGYEQYKRCFYGDVRTIIADGWDDSVSTPGGDTVITHVLVRRFIGDPGPRGATRSARLAV
Ga0184615_1051473813300018059Groundwater SedimentHVAKRKEAIMKRKRKYAVKKGMGTMCNICGKNCGKGGPLSKHIKGAHKISYEHYKRAFYDGVKTLIVDAWDDSVSTSDSKTVLTHVLVRRFIGDPGKRGARETAR
Ga0187784_1000691763300018062Tropical PeatlandMAGRKKGAVRPGHGVMCNICGKNCGKGGPLKTHVEGAHAPVTYEAYKMCFYGVASNVLADAWDDSVSTSTGKTVVTHVLARRFVQDPGPRGATRAVPRQPV
Ga0184627_1003403023300018079Groundwater SedimentMGRRRKGAVRRGHGAMCNVCGLNCGKGGALKKHVEGAHEVEYDAYVKCFYQSAATIIANSWDDSVSTSNGKTVVTHVLVRRFVGDPGPRGVARAARPSP
Ga0187771_1130334913300018088Tropical PeatlandMPGRRKKGAVRPGHGVMCNVCGLNCGKGGPLKKHVEGAHSISYDDYKTCFYGTARTVIADGWDDSVSTSNGQTVVTHVLVRRFIQDPGRRGATRAVRPQSV
Ga0187892_1013444723300019458Bio-OozeMGRRKRGAVRSGHGAMCNICGLNCGKGGALKKHVEGSHDVNYEEYKRCFYDGVSTIIANAWDDSVATKVGKTVITHVLVRRFVGNPGRRGVARSAKPSP
Ga0194120_1001529843300020198Freshwater LakeMGRRKKGAVRRGHGAMCNVCGRNCGKGGALKKHVEGAHDVTYDTYMKCFYQGVATIIANSWDDSVSTSNSKTVVTHVLVRRFVGDPGPRGVPRAARPAR
Ga0194121_1037756313300020200Freshwater LakeRGRGSMCNICGLNCGKGGPLKKHIQGAHKIDYAHYKECFYGQVKTLITDGWDDSVRTAGGKTVITHVLVRRFIGDPGPRGATRAAGVY
Ga0214088_160502313300020814Granular SludgeMPYRKKGAVRKGKGSMCNICGLNCGKGGALKAHVEGSHGVDYNAYKKCFYEEVKTVIADSWDDSVQTKSGRTVVTHVLVRRFIGSPGPRG
Ga0214165_102138633300021137FreshwaterMSRRKKGAVRPGHGVMCNICGKNCGKGGSLKTHIESKHSGVDYKAYKKCFYGKVKTVIADAWDDSVSTSDDKTVITHVLVRRFIGN
Ga0194053_1022206923300021520Anoxic Zone FreshwaterMSRRKKGAVRPGHGVMCNICGKNCGKGGSLKTHIESKHSGVDYKAYKKCFYGKVKTVIADAWDDSVSTSDDKTVITHVLVRRFIGNPGPRGATRSARRPHQP
Ga0228536_104808613300022177Defined MediumMAGRRKGAVRPGHGVMCNICGKNCGKGGALKTHIEGAHPPVTYEVYKICFYGKSKNTLADAWDDSVSTKNGDTVVTHVLARRFVQEPGPRGATRAVCKQKA
Ga0228535_100729963300022181Defined MediumRRKKHAVRPGAGVMCNVCGVNCGKGGALKKHVEGAHKVDYKQYKTCFSGCVKTLIADSWDDSVKTSTGKIVITHVLVRRFIGDPSKRGVSWKNP
Ga0212124_1018672913300022553FreshwaterAEKPKGTVRVGHGVMCNICGINCGKGGALKKHVEGAHAPVTYEAYKICFYSKQKTILADAWDDSVSTSKGNTVVTHIFVRRFIQEPGPRGATRAVRKQKV
Ga0212124_1059617613300022553FreshwaterGVMCNICGRNCGKGGGLKKHVEEIHKVDYDQYKTCFYGTVVTLISDTWDDSVNTSGGKTVITHVLVRRFIGDPGPRGVCK
Ga0212093_104492653300022554Hot Spring SedimentMPQRKKGAVRKGAGSMCNICGINGGKGGSLRKHIEGAHGVDYDSYKKCFYGDVRTVIADTWDDSVNTSKGDTVMTHVLVRRFVGYPGPRGVSKINKK
Ga0212088_1081523313300022555Freshwater Lake HypolimnionKGAVRTGHGAMCNICGRNCGKGGALKRHVEGAHEVTYEAYKKCFYGDARTFIANAWDDSVTTHDGRPVVTHVLVRRFIVDPGPRGATRAARP
Ga0212121_1016397533300022556Anoxic Lake WaterMPRRRKYAVSNRAGVMCNVCGRNCGHTRALKKHVEGAHNVAYDVYKRCFYAEAKTVLADAWDDTVKTHAGDTVITHVLVRRFVGDPGPRGVPRAARPIR
Ga0210022_118838613300025017AquiferMPRKKKGAVRKGRGVMCNICGLNCGKGGALKKHVEGTHEVDYEIYKKCFYGIAKNTIADSWDDSVSTAKGKTVITHVLVRRFVGEPGHRGANRAARIKK
Ga0208953_1001072213300025081GroundwaterMCNICGRNCGKGGALRTHIEGAHKVSYDAYKTCFYGDVKTQIADTWDDSVKTHGGQTVITHVLVRRFIGNPGERGVRRKVP
Ga0208373_118546723300025152SoilMARRKKHAVRSGAGSMCNICGRNCGKGGALRTHIEGAHKVSYDAYKTCFYGDVKTQIADTWDDSVKTHGGQTVITHVLVRRFIGNPGERGVRRKVP
Ga0209431_1099079713300025313SoilICGVNCGKGGALKKHVEGAHEVDYKIYKKCFYGITNNVIADGWDDSVSTSSGKTVITHVLVRRFVGEPGPRGATRTARVNK
Ga0209520_1049650013300025319SoilGVMCNICGVNCGKGGALKKHVEGAHEVDYKIYKKCFYGITNNVIADGWDDSVSTSSGKTVITHVLVRRFVGEPGPRGATRTARVNK
Ga0209641_1046140913300025322SoilMPRRKKGAVRKGRGVMCNICGVNCGKGGALKKHVEGAHEVDYKIYKKCFYGITNNVIADGWDDSVSTSSGKTVITHVLVRRFVGEPGPRGATRTARVNK
Ga0209342_1082331213300025326SoilMPRRKKGAVRKGRGVMCNICGVNCGKGGALKKHVEGAHEVDYKIYKKCFYGITNNVIADGWDDSVSTSSGKTVITHVLVRRFVGEPGPR
Ga0209751_1090553523300025327SoilMPRRKKGAVRKGRGVMCNICGVNCGKGGALKKHVEGAHEVDYKIYKKCFYGITNNVIADGWDDSVSTSSGKTVITHVLVRRFVGEPGPRGATRTARVN
Ga0209310_113867723300025715Anaerobic Digestor SludgeMAQRKKGAVRPGHGVMCNICGLNCGKGGALRTHVMGAHDVAYDKYKACFYPADSVIIADSWDDSVIAEDGTPVVVHVLVRRFVGDPGKRGVPRAA
Ga0207661_1008476633300025944Corn RhizosphereMSRRRKGAVRTGHGAMCNICGRNCGKGGALKKHVEGAHDVAYDAYRKCFDGDAKTFIADAWDGSVSTSSGDPVITHVLVRRFIGDPSWREVTRSARPPVL
Ga0209077_103574413300027675Freshwater SedimentMARKPKGTVRVGHGVMCNICGINCGKGGALKKHVEGAHAPVTYEVYKICFYGKPKTVLADAWDDSVTTKNGDAVVTHVLARRFIQN
Ga0209819_1004288033300027722Freshwater SedimentMARKPKGTVRVGHGVMCNICGINCGKGGALKKHVEGAHAPVTYEVYKICFYGKPKTVLADAWDDSVTTKNGDAVVTHVLARRFIQNPGPRGATRAVRKQKA
Ga0209582_106943123300027724Activated SludgeMAGRAKGAVRVGHGVMCNICGKNCGKGGALKRHVEGAHQPVTYEAYKVCFYGVAKNVLADTWDDSVSTKNGDTVVTHVFARRFIQEPGPRGATRTARKQPA
Ga0209287_1004318333300027792Freshwater SedimentMAARPKGAVRTGHGVMCNICGKNCGKGGALKTHIEGAHPPVTYEVYKICFYGEQKNILADSWDDSVSTKNGDTVVTHVLARRFVQEPGPRGATRAVRKQKA
Ga0209777_1021633323300027896Freshwater Lake SedimentMSGRKKHAVRKGAGAMCNICGLNCGKGGALKKHIEDVHKVSYDDYKDCFYGDEVKTIITDSWDDSVRTSNGKTVITHVLVRRFIGDPGPRGVSYKNP
Ga0311022_1228365213300029799Anaerobic Digester DigestateMPYRKKGAVRKGKGSMCNICGLNCGKGGALKAHVEGSHGVDYNAYKKCFYEEVKTVIADSWDDSVQTKSGRTVVTHVLVRRFMGYPGPRGAPRA
Ga0272380_1016575723300029959Bioremediated Contaminated GroundwaterMARRRKHQVGKGKGTMCNICGKNCGKGGALKKHIEGAHFVSYDDYKKCFYSQANNILADSWDDNVITSNGTTVITHVFVRRFVNEPGPRGVPRAA
Ga0311338_1022520373300030007PalsaKGAARPGHGSMCNICGLNCGKGGPLKTHIEGAHKPVTYDAYKICFAEESKIIDAWDDSRSTSKGNKVVIHALVHRFVLPAGSKKATRSPRRDSN
Ga0311370_1104193113300030503PalsaMAKKRKKGAVRPGHGVMCNVCGLNCGKGGALSKHVEAVHQIKYKDYKMCFYGKPKTIIANGWDDTVSTSDGKTVITHVLVRRFIRDPGPRG
Ga0311372_1041177723300030520PalsaMAKKRKKGAVRPGHGVMCNVCGLNCGKGGALSKHVEAVHQIKYKDYKMCFYGKPKTIIANGWDDTVSTSDGKTVITHVLVRRFIRDPGPRGATRAARH
Ga0311354_1101669013300030618PalsaMARRRKGAARPGHGSMCNICGLNCGKGGPLKTHIEGAHKPVTYDAYKICFAEESKIIDAWDDSRSTSKGNKVVIHALVHRFVLPAGSKKATRSPRRDSN
Ga0302325_1060293123300031234PalsaVRSGHGVMCNICGRNCGKGGALKTHVEGAHSVDYDEYKRCFYGSVSTLIADAWDGSVTTTSGKTVITHVLVRRFIGETDWRKVTRSARPLV
Ga0302325_1065852933300031234PalsaMSRRKKGAVRTGHGAMCNICGRNCGKGGALKNHIEGAHNVAYTEYKKCFYPKGFMKHILANAWDDSVSTSTGKPVITHVLVRRFIGESDWRKVTRSAKPAAEQ
Ga0302325_1263975113300031234PalsaRAMAKKRKKGAVRPGHGVMCNVCGLNCGKGGALSKHVEAVHQIKYKDYKMCFYGKPKTIIANGWDDTVSTSDGKTVITHVLVRRFIRDPGPRGATRAARH
Ga0315291_1017070333300031707SedimentMQRRRKGAVRSGKGVMCNICGKNCGKGGTLKKHVEQGHELPYEHYKLCFYGKVKTLIADGWDDSVSTSDQKTVVTHVLVRRFVGDPGPRGATRSANPAV
Ga0310686_11744558723300031708SoilLARKKKGAVRSGHGVMCNICGRNCGKGGALKTHVEGAHSVDYDEYKRCFYGSVSTLIADAWDGSVTTTSGKTVITHVLVRRFIGETDWRKVTRSARPLV
Ga0306917_1106526823300031719SoilMAQRRKAGAVRAGHGVMCNMCGKNCGKGAPLKKHVESAHGIGYGDYKKCYYTGVKTILADSWDDSVFTSKGNTVLTHILVRRFVGNP
Ga0306918_1055357923300031744SoilMAQRRKAGAVRAGHGVMCNMCGKNCGKGAPLKKHVESAHGIGYGDYKKCYYTGVKTILADSWDDSVFTSKGNTVLTHILVRRFVGNPGPRGATRSVRPN
Ga0315293_1024454513300031746SedimentMPRKAKYAVSTGAGVMCNICGLNCGKGGALKKHVEGAHEVDYDAYKKCFYGEVKTIIADGWDDSVSTASGKTVITHVLVRRFVGDPGTRGATRTVRPQK
Ga0315288_1011581853300031772SedimentMARRRKGAVRTGRGAMCNICGKNCGKGGALKRHVEGAHSVPYEHYRTCFYDGAVRTVIADAWDDSVSTSAGKTVVTHVMVRRFVGDPGPRGATRSVPQAV
Ga0315288_1101243913300031772SedimentMITRAKSAVRVGHGVMCNICGINCGKGGALKKHVEGAHSPVTYEGYKICFYGEVRNVLADAWDDSVVTKNGNTVVTHVFARRFVQDPGPRGVTRAVRKQKA
Ga0316217_1032063913300031813FreshwaterMPRRRKGAVRAGHGAMCNICGLNCGKGGALKKHIEGAHSVDYESYKRCFYGQVKTVIADAWDDNVSTHGGETVVTHVLVRRFIGDPGERGATRSARPAV
(restricted) Ga0255338_10000148093300031825Sandy SoilMAGRAKGAVRVGHGVMCNICGKNCGKGGALKRHVEGAHQPVTYEAYKVCFYGEAKNILADTWDDSVSTKNGDTVVTHVFARRFIQEPGPRGATRTARKQPV
Ga0315285_1012250833300031885SedimentMCNICGKNCGKGGALKKHVEQGHELPYEHYKLCFYGKVKTLIADGWDDSVSTSDRKTVVTHVLVRRFVGDPGPRGATRSANPAV
Ga0306925_1037153723300031890SoilMAQRRKAGAVRAGHGVMCNMCGKNCGKGAPLKKHVESAHGIGYGDYKKCYYTGVKTILADSWDDSVFTSKGNTVLTHILVRRFVGNPGPRGATRSVRPQLI
Ga0306923_1025548923300031910SoilMAQRRKAGAVRAGHGVMCNMCGKNCGKGAPLKKHVESAHGIGYGDYKKCYYTGVKTILADSWDDSVFTSKGNTVLPHILVRRFVGNPGPRGATRSVRPN
Ga0306921_1169969813300031912SoilGHGVMCNMCGKNCGKGAPLKKHVESAHGIGYGDYKKCYYTGVKTILADSWDDSVFTSKGNTVLTHILVRRFVGNPGPRGATRSVRPQLI
Ga0310910_1116158313300031946SoilMAQRRKAGAVRAGHGVMCNMCGKNCGKGAPLKKHVESAHGIGYGDYKKCYYTGVKTILADSWDDSVFTSKGNTVLPHILVRRFVGNPGPRGATRSVRPQLI
Ga0214473_1216161723300031949SoilVMCNICAKNCGKGGALKKHVEQGHELPYEHYKLCFYGKVKTLIADGWDDSVSTSDRKTVVTHVLVRRFVGDPGPRGATRSANPAV
Ga0315284_1156008413300032053SedimentMCNICGRNCGKGGPLKTHVESAHGVNYEDYKNVFYGDDVKILADAWDDQVATSSGKTVIIHVLVRRFVGDPGHRGVRKTAK
Ga0315284_1159908813300032053SedimentMSLRRKGAVRKGAGAMCNICGLNCGKGGALKKHVEVVHDVEYENYKKCFYDEAKTIIADAWDDSVSTAKGKTVITHVLVRRFVGSPGPRGATRSVPSKR
Ga0315279_1043425713300032070SedimentMSRRKKHAVRPGAGSMCNICGLNCGKGGALRKHVEGAHDVDYNQYKKCFYGKVVTLIADTWDDSVSTSNDKTVITHVLVRRFVGDPGPRGATWKKP
Ga0315281_10014209143300032163SedimentMPKRIKGAVRKGQGVMCNICGINCGKGGALKKHVEGAHDVPYESYKKCFYDVAKTIIADSWDDSVSTSKGNTVVTHVFVRRFIGDPGHRGATRAARVNK
Ga0315281_1110546113300032163SedimentMARRKKGAVRKGQGVMCNICGYNCGKGGGLKKHVESIHGVNYQDYKKCFYLDANTIIADGWDDSVTTSSGKTVITHVLVRRFVGDPGHR
Ga0315268_1013288843300032173SedimentMPRRRKGAVAKGAGAMCNICGRNCGKGGALKKHIEGAHEVRYRDYVKCFYGSPKTIIANAWDDSVSTARGRTVITHVLVRRFVGDPGPRGVPRAANPQP
Ga0315268_1087176823300032173SedimentMAGRSKGAVRTGHGVMCNICGKNCGKGGALKTHIEGAHPPVTYEAYKICFYGEPKSILADAWDDSVSTKGGDTVVTHVLARRFVQEPGPRGATRAVRRQKA
Ga0306920_10160970113300032261SoilGAPLKKHVESAHGIGYGDYKKCYYTGVKTILADSWDDSVFTSKGNTVLPHILVRRFVGNPGPRGATRSVRPQLI
Ga0315273_1041645513300032516SedimentRTGRGAMCNICGKNCGKGGALKRHVEGAHSVPYEHYRTCFYDGAVRTVIADAWDDSVSTSAGKTVVTHVMVRRFVGDPGPRGATRSVPQAV
Ga0316229_121655613300032676FreshwaterGHGVMCNICGKNCGKGGSLKTHIESKHSGVDYKAYKKCFYGKVKTVIADAWDDSVSTSDDKTVITHVLVRRFIGNPGPRGATRSARRPHQP
Ga0326728_10001435243300033402Peat SoilMARRKKGAVRSGHGVMCNICGKNCGKGGALKTHVEGAHTPVTYEAYKICFYGIASNVLADAWDDSVSTSSGKTVVTHVLARRFVQDPGPRGATRTVRKQAV
Ga0326728_1086081813300033402Peat SoilMAGRKKGAVRPGHGVMCNICGKNCGKGGALKTHVEGAHAPVTYEAYKICFYRVASNVLADAWDDSVSTSSGKTVVTHVLARRFVQDPGPRGATRTVRKQPV
Ga0326724_0474609_211_5223300034091Peat SoilLARRKKGAVRRGHGIMCNICGKNCGKGGALKTHIEGAHQVSYVDYKKCFYGNVKTRIADSWDDSVKTHSGDSVVTHVLVRRFIRTQNKKGVSRAARTIKEVFP
Ga0364942_0197235_131_4303300034165SedimentMSRRKKGAVRKGKGVMCNICGLNCGKGGALRRHIEGAHNVDYGSYKKCFYGEAKTIIANSWDDSVSTPQGRTVITHVLVRRFVGDAGPRGVPRAARVHK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.