Basic Information | |
---|---|
Family ID | F073299 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 44 residues |
Representative Sequence | FMNSRAGFAWHNEYSWIRQRGTAPDGSDLTSSSLMLGFDFDF |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 83.33 % |
% of genes from short scaffolds (< 2000 bps) | 78.33 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.19 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.167 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.833 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.29% β-sheet: 0.00% Coil/Unstructured: 75.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF13442 | Cytochrome_CBB3 | 71.67 |
PF00034 | Cytochrom_C | 3.33 |
PF13620 | CarboxypepD_reg | 1.67 |
PF10091 | Glycoamylase | 0.83 |
PF00116 | COX2 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 0.83 |
COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.17 % |
Unclassified | root | N/A | 15.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459005|F1BAP7Q01AXCAE | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
2228664022|INPgaii200_c0727240 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300001305|C688J14111_10177045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 659 | Open in IMG/M |
3300002917|JGI25616J43925_10260573 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300004091|Ga0062387_101419014 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300004091|Ga0062387_101722161 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300005167|Ga0066672_10128340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1574 | Open in IMG/M |
3300005337|Ga0070682_100220774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1349 | Open in IMG/M |
3300005364|Ga0070673_101313783 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 679 | Open in IMG/M |
3300005438|Ga0070701_10174374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1254 | Open in IMG/M |
3300005518|Ga0070699_101649346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 587 | Open in IMG/M |
3300005538|Ga0070731_10679997 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
3300005549|Ga0070704_100476455 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300005560|Ga0066670_10224470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1134 | Open in IMG/M |
3300005560|Ga0066670_10378182 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
3300005561|Ga0066699_11226990 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300005564|Ga0070664_100506731 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
3300005566|Ga0066693_10206088 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
3300005578|Ga0068854_100102723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2145 | Open in IMG/M |
3300005840|Ga0068870_11282725 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005902|Ga0075273_10067547 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
3300006028|Ga0070717_10115978 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
3300006028|Ga0070717_10359395 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
3300006052|Ga0075029_100117918 | All Organisms → cellular organisms → Bacteria | 1608 | Open in IMG/M |
3300006797|Ga0066659_11818611 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300006806|Ga0079220_11902703 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300006854|Ga0075425_100815040 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300009093|Ga0105240_12215969 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300010047|Ga0126382_12095680 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300010154|Ga0127503_10837430 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300010359|Ga0126376_13227287 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300010360|Ga0126372_11665135 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300010362|Ga0126377_11357314 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300010397|Ga0134124_12626800 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300010398|Ga0126383_11607392 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300011269|Ga0137392_10601943 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300011270|Ga0137391_11022815 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300012199|Ga0137383_10801303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
3300012202|Ga0137363_10297673 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
3300012202|Ga0137363_11010588 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300012212|Ga0150985_102362963 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300012357|Ga0137384_10339105 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
3300012683|Ga0137398_10844407 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300012929|Ga0137404_10489586 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300012948|Ga0126375_10268533 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
3300012958|Ga0164299_11132758 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300012961|Ga0164302_11894691 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300012986|Ga0164304_10892393 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300015245|Ga0137409_10139945 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2221 | Open in IMG/M |
3300015374|Ga0132255_101144682 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300017933|Ga0187801_10128451 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300017973|Ga0187780_10151768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1607 | Open in IMG/M |
3300018047|Ga0187859_10492984 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300018058|Ga0187766_10327794 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
3300018088|Ga0187771_10069978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2773 | Open in IMG/M |
3300018090|Ga0187770_10221774 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300018431|Ga0066655_11342649 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300018433|Ga0066667_12164295 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300020579|Ga0210407_10780800 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300020580|Ga0210403_10181124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1727 | Open in IMG/M |
3300021086|Ga0179596_10220993 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300021171|Ga0210405_10328101 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300021344|Ga0193719_10161879 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300021445|Ga0182009_10132974 | All Organisms → cellular organisms → Bacteria | 1167 | Open in IMG/M |
3300021560|Ga0126371_13151261 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
3300022722|Ga0242657_1138149 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300024331|Ga0247668_1086447 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300025475|Ga0208478_1040366 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300025913|Ga0207695_10787952 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300025922|Ga0207646_11763423 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300025922|Ga0207646_11898151 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300025923|Ga0207681_10293533 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300025928|Ga0207700_10521783 | All Organisms → cellular organisms → Bacteria | 1053 | Open in IMG/M |
3300025960|Ga0207651_11614924 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300026305|Ga0209688_1070571 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300026322|Ga0209687_1123884 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300026377|Ga0257171_1103331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300027565|Ga0209219_1121937 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300027765|Ga0209073_10384639 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300028800|Ga0265338_10185482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1582 | Open in IMG/M |
3300030007|Ga0311338_11794344 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300030706|Ga0310039_10043045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2031 | Open in IMG/M |
3300030740|Ga0265460_13075113 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300031231|Ga0170824_105718215 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300031250|Ga0265331_10494933 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300031446|Ga0170820_15783753 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
3300031469|Ga0170819_12818441 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300031474|Ga0170818_108592788 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300031521|Ga0311364_10021461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7103 | Open in IMG/M |
3300031740|Ga0307468_102448758 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300031820|Ga0307473_10082263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1655 | Open in IMG/M |
3300031938|Ga0308175_100889649 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300031962|Ga0307479_11999976 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300032076|Ga0306924_10827368 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300032180|Ga0307471_100749955 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
3300032205|Ga0307472_101473781 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300032783|Ga0335079_10826696 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300032805|Ga0335078_12307467 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300032895|Ga0335074_11288795 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300033004|Ga0335084_12380246 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300034163|Ga0370515_0019060 | All Organisms → cellular organisms → Bacteria | 3173 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.33% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.50% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.67% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.00% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 4.17% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.33% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.50% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.67% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.67% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.67% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.83% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.83% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.83% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.83% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.83% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.83% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.83% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.83% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.83% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.83% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
E41_09437660 | 2170459005 | Grass Soil | TSRAGFAFHNEYSWIRQRGTSPVTGTDLSTNSLMLGFDFDF |
INPgaii200_07272401 | 2228664022 | Soil | NPFMTSRAGFAFHNEYSWIRQRGTAPDATDLSSNSIMLGFDFAF |
C688J14111_101770452 | 3300001305 | Soil | YYPVMNSRAGFAWHNEYSWIRGKGLAPDGSDLTNNSVMAGFDFDF* |
JGI25616J43925_102605731 | 3300002917 | Grasslands Soil | NSRAGFAFHNEYSWIKQVGTAPDGSDLTSNSIMAGFDFDF* |
Ga0062387_1014190142 | 3300004091 | Bog Forest Soil | IMTSRAGFAWHNEYSWIRYKGLAPDGSDLTSSSLMLGFDFAF* |
Ga0062387_1017221611 | 3300004091 | Bog Forest Soil | RAGFAWHNEYSWIRTQGVSPVTATDLTSSSLMSGFDFDF* |
Ga0066672_101283403 | 3300005167 | Soil | FMTSRAGFAFHNEFSWFRQRGVAPDGVSDLSTNSLMAGFDFAF* |
Ga0066671_100119665 | 3300005184 | Soil | DNYVFGYRYYPIMNSRGGFAWHNEYSWIRGRGLAPDGSDLTSNSLMLGFDFDF* |
Ga0066388_1008329813 | 3300005332 | Tropical Forest Soil | GNLDNYVFGYRYYPIMNARAGFAWHNEYSWIRGRGLAPDGSDLTNQSLMLGFDFDF* |
Ga0070682_1002207741 | 3300005337 | Corn Rhizosphere | FMTSRAGFAFHNEYSWIRQRGTSPVTGTDLSSNSLLLGFDFDF* |
Ga0070673_1013137832 | 3300005364 | Switchgrass Rhizosphere | RYMPTMNSRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF* |
Ga0070701_101743741 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | YMPTMNSRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF* |
Ga0070707_1003205663 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTFGYRWYPIMNPRAGFALHNEYSWLRQRGTSPVTATDLTSSALMLGFDFDF* |
Ga0070699_1016493461 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FGYRWYPIMTSRAGFAFHNEYSRITQRSAAPDGTDLTSSSVFVGFDFDF* |
Ga0070731_106799972 | 3300005538 | Surface Soil | RYMPIMTSRAGFAWHNEYNWLRQSKAAPDGTDLTSSELLLGFDFAF* |
Ga0070732_103999782 | 3300005542 | Surface Soil | DMYTFGFRWYPIMNPRAGFAWHNEYSWLRTRGTSPVSFTDLTSSSLMSGFDFDF* |
Ga0070704_1004764551 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | IMNSRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF* |
Ga0066670_102244701 | 3300005560 | Soil | YRYYPVMNSRAGFAWHNEYSWIRGKGLAPDGSDLTNNSLMAGFDFDF* |
Ga0066670_103781822 | 3300005560 | Soil | GFAFHNEYSWIRQRGTSPVTGTDLSSNSLLLGFDFDF* |
Ga0066699_112269901 | 3300005561 | Soil | SRAGFAWHNEYSWIRQRGGAPDGTDLTSNSLMLGFDFDF* |
Ga0070664_1005067311 | 3300005564 | Corn Rhizosphere | FHNEYSWIRQRGTSPVTGTDLSSNSLMLGFDFDF* |
Ga0066693_102060882 | 3300005566 | Soil | AFHNEYSWIRQRGTSPVTGTDLSSNSLLLGFDFDF* |
Ga0068854_1001027234 | 3300005578 | Corn Rhizosphere | AGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF* |
Ga0068870_112827251 | 3300005840 | Miscanthus Rhizosphere | SRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF* |
Ga0075273_100675471 | 3300005902 | Rice Paddy Soil | NSRAGLAFHNEYSWVRQRGTSPTTGTDLSSSSLFLGLDFDF* |
Ga0070717_101159781 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FMSSRAGFAFHNEYSWIRQRGTSPVTGTDLSSNSLMLGFDFDF* |
Ga0070717_103593952 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | FAFHNEYSWIRQRGTAPDNGDLSSNSIMIGFDFAF* |
Ga0075029_1001179183 | 3300006052 | Watersheds | AGFAWHNEYSWVRQRGTASDGTDLTSSSLLLGFDFDF* |
Ga0066659_118186111 | 3300006797 | Soil | RYYPIMNSRAGFAWHNEYSWIRGRGLAPDGSDLTNNSLMLGFDFDF* |
Ga0079221_110311281 | 3300006804 | Agricultural Soil | IDMYTVGFRYYPIMNPRAGFAFHNEYSWFRQRGTSPVTGTDLTTSSLMLGWDFDF* |
Ga0079220_119027032 | 3300006806 | Agricultural Soil | YNPFMTSRDGFAFHNEYSWIRQRGTAPDGTDLTSSSILLGFDFAF* |
Ga0075425_1008150402 | 3300006854 | Populus Rhizosphere | SRAGFAFHNEYSWIRQRGTAPDASDLSSNSLMLGFDFDF* |
Ga0105240_122159692 | 3300009093 | Corn Rhizosphere | FMNSRAGFAWHNEYSWIRQRGTAPDGSDLTSSSLMLGFDFDF* |
Ga0126382_120956802 | 3300010047 | Tropical Forest Soil | GFAWHNEYSWIRGRGLAPDGSDLTNQSLMLGFDFDF* |
Ga0127503_108374302 | 3300010154 | Soil | TSRAGFAFHNEYAWFRQQGTAPLGNALTSSSLMFGFDFDF* |
Ga0126376_132272872 | 3300010359 | Tropical Forest Soil | YNPFMTSRAGFAFHNEYSWIRQRGTAPDGSDLSSNSLLLGFDFDL* |
Ga0126372_116651352 | 3300010360 | Tropical Forest Soil | FRYMPFMTSRAGFAWHNEYSWIKNSGLAPNGTDLTSSSLMSGFDFDF* |
Ga0126378_124450442 | 3300010361 | Tropical Forest Soil | ALPSSLGNIDMYTVGFRYYPIMNPRAGFAFHNEYSWFRQRGTSPVTGTDLTTSSLMLGWDFDF* |
Ga0126377_113573142 | 3300010362 | Tropical Forest Soil | FHNEYSWFRQRGTSSIPDQDLKTNSILVGMDFDF* |
Ga0126379_103877343 | 3300010366 | Tropical Forest Soil | GNIDMYTVGFRYYPIMNPRAGFAFHNEYSWFRQRGTSPVTGTDLTTSSLMLGWDFDF* |
Ga0134124_126268001 | 3300010397 | Terrestrial Soil | GVRWYPNITSRAGFALHGEYSWLKQHKTAPVTGTDVTSSSVFFGTDFDF* |
Ga0126383_116073923 | 3300010398 | Tropical Forest Soil | GFAFHNEYSWIRQRGTAPDGSDLTSSSIMLGFDFDF* |
Ga0137392_106019432 | 3300011269 | Vadose Zone Soil | GYRWYPIMTSRAGFAFHNEYSRIIQRSAAPDGTDLNSSSVFVGFDLDF* |
Ga0137391_110228152 | 3300011270 | Vadose Zone Soil | WHNEYSWIRQRGTSPVTFTDVTSSSLMSGFDFDF* |
Ga0137383_108013032 | 3300012199 | Vadose Zone Soil | AGFAFHNEFSYFRQRGVSPVNALDLSSNSLLVGFDFAF* |
Ga0137363_102976731 | 3300012202 | Vadose Zone Soil | NPFMTSRAGFAFHNEFSWFRQRGVAPDGVSDLSTNSLMAGFDFAF* |
Ga0137363_110105882 | 3300012202 | Vadose Zone Soil | MNSRAGFAWHNEYSWIRGKGLAPDGSDLTNNSLMLGFDFDF* |
Ga0150985_1023629631 | 3300012212 | Avena Fatua Rhizosphere | YPVMNSRAGFAWHNEYSWIRGKGLAPDGSDLTNNSVMAGFDFDF* |
Ga0137384_103391051 | 3300012357 | Vadose Zone Soil | AWHNEYSWIRGTGLAPDGSDLTSNSLMLGFDFDF* |
Ga0137385_115684591 | 3300012359 | Vadose Zone Soil | STLGNLDNYVFGYRYYPIMNSRGGFAWHNEYSWIRGKGLAPDGTDLTSNSLMLGFDFDF* |
Ga0137398_108444072 | 3300012683 | Vadose Zone Soil | RAGFALHNEYSWIRQRGTSPVTGTDLSTNSVMLGFDFDF* |
Ga0137395_104569372 | 3300012917 | Vadose Zone Soil | AGSSTVAPMASDLGNIDMYTFGFRYMPIMTSCAGFAFHNEYSWVRQRGTAPVTGTDLTSSSLMSGFDFDF* |
Ga0137404_104895861 | 3300012929 | Vadose Zone Soil | YNPFMTSRAGFALHNEYSWIRQRGTSPVTGTDLSTNSVMLGFDFDF* |
Ga0126375_102685332 | 3300012948 | Tropical Forest Soil | FMNARDGFAFHNEYSWIRQRGTAPDNGDLSSNSIMIGFDFAF* |
Ga0164299_111327582 | 3300012958 | Soil | NSRAGFAFHNEYSLARQQHTAPEGNSLSSSSVFVGFDFDF* |
Ga0164302_118946911 | 3300012961 | Soil | AGFAFHNEYSWIRHRGTSPVTGTDLSSNSLLLGFDFDF* |
Ga0164304_108923932 | 3300012986 | Soil | PIMNSRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF* |
Ga0137409_101399451 | 3300015245 | Vadose Zone Soil | GFAFHNEYSWIRQRGTSPVTSTDLSTNSLLLGFDFDF* |
Ga0132255_1011446821 | 3300015374 | Arabidopsis Rhizosphere | MTSRAGFAFHNEYSWIRQRGTAPDATDLSSNSIMVGFDFAF* |
Ga0187801_101284512 | 3300017933 | Freshwater Sediment | RWYPIMLPRAGFAFHNEYSWLRQNGVSPVTGTDLTSSSLLFGFDFDF |
Ga0187780_101517681 | 3300017973 | Tropical Peatland | PIMTSRAGFAWHNEYSWLRVQGVASNGTAATSSSLMSGFDFDF |
Ga0187777_106998041 | 3300017974 | Tropical Peatland | IVGTPSNVGNIDNYVFGYRYMPFMNARAGFAWHNEYSWVRQRGGAPDGTDLTSSSVLLGFDFDF |
Ga0187859_104929841 | 3300018047 | Peatland | SRAGFAFHNEYSWLRQNGTSPVTGTDVTSSSLLLGIDFDF |
Ga0187766_103277942 | 3300018058 | Tropical Peatland | FAFHNEYSWMRQKGTSPVTGTDLTTSSLVFGWDFDF |
Ga0187765_100632653 | 3300018060 | Tropical Peatland | VGNIDNYVFGYRYMPFMNARAGFAWHNEYSWVRQRGGAPDGTDLTSSSVLLGFDFDF |
Ga0187771_100699785 | 3300018088 | Tropical Peatland | IMTSRAGLAWHNEYSWIRTNGIAPLSATDVTSNSLMLGFDFDF |
Ga0187770_102217741 | 3300018090 | Tropical Peatland | RAGFAFHNEYSWLRSNGTAPGGTDQTASSLLFGFDFDF |
Ga0066655_113426491 | 3300018431 | Grasslands Soil | TYVFGYRYMPFMTSRAGLAWHNEYSWNRQRGTAPDGSDTTSSSVMLGLDFDF |
Ga0066667_121642951 | 3300018433 | Grasslands Soil | SRAGFAWHNEYSWARVRASSPLSGTDLTSNSLYFGFDFDF |
Ga0210407_107808002 | 3300020579 | Soil | FMTSRDGFAFHNEYSWIRQRGTAPDGTDLTSSSILLGFDFAF |
Ga0210403_101811243 | 3300020580 | Soil | AWHNEYSWLRMRGSSPVSGTDLTSNSLMSGFDFDF |
Ga0179596_102209932 | 3300021086 | Vadose Zone Soil | AFHNEFSWFRQRGVAPDGVSDLSTNSLMAGFDFAF |
Ga0210405_103281013 | 3300021171 | Soil | PIMTSRAGFAWHNEYSWFRQRGTAPDGTDITNSSLLLGFDFDF |
Ga0193719_101618792 | 3300021344 | Soil | TFGYRWYPIMTSRAGLAFHNEYSWVRVRGLAPITATDLTSNSLFFGFDFDF |
Ga0210383_117357791 | 3300021407 | Soil | GNIDMYTVGFRYYPIMTPRAGFAFHNEYSWFRQRGTSPVTGTDLTSSSLLLGWDFDF |
Ga0182009_101329741 | 3300021445 | Soil | MTSRAGFAFHNEYSWIRQRGTSPVTATDLSSNSLMLGFDFDF |
Ga0126371_131512612 | 3300021560 | Tropical Forest Soil | SSRAGFAFHNEYAWLRQRGTAPDGTDLSSTSLMLGFDFAF |
Ga0242657_11381492 | 3300022722 | Soil | TPRAGFAFHNEYSWFRQRGTSPVTGTDLTSSSLLLGWDFDF |
Ga0247668_10864471 | 3300024331 | Soil | GFAFHNEYSWIRQRGTSPVSGTDLSSNSLMLGFDFDF |
Ga0208478_10403662 | 3300025475 | Arctic Peat Soil | YNPFMTSRAGFAFHNEFSWFRQRGVAPDGTTDLSSSSLMLGFDFAF |
Ga0207695_107879521 | 3300025913 | Corn Rhizosphere | VGFRYIPIMTSRAGFAWHNEYSWIKQYGLAPDGTNLTSSSLMSGFDFDF |
Ga0207646_102711771 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTFGYRWYPIMNPRAGFALHNEYSWLRQRGTSPVTATDLTSSALMLGFDFDF |
Ga0207646_117634231 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SRAGFAWHNEYSWVRQRGTSLVTFTDLTSSSLMSGFDFDF |
Ga0207646_118981512 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IMTSRAGFAWHNEYSWVRQRGTAPDGISDLTSSSLMLGFDFDF |
Ga0207681_102935331 | 3300025923 | Switchgrass Rhizosphere | RAGVAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF |
Ga0207700_105217832 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | TFGYRWYPIMNPRAGFAVHNEYSWFRQRGTSPVTGTDLTSSALLLGFDFDF |
Ga0207651_116149242 | 3300025960 | Switchgrass Rhizosphere | RYMPTMNSRAGFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF |
Ga0209688_10705712 | 3300026305 | Soil | AFHNEYSWIRQRGTSPVTGTDLSSNSLLLGFDFDF |
Ga0209687_11238842 | 3300026322 | Soil | YPIMTSRAGLAFHNEYSWVRQRGTSPVSATDLTNNSLFFGFDFDF |
Ga0257171_11033311 | 3300026377 | Soil | FISSRAGFAFHNEYSFLRQRGVSPVNALDVSSNSLLVGFDFAF |
Ga0209219_11219371 | 3300027565 | Forest Soil | GFAWHNEYSWVRRRGVAPDLTDLTSSSLLTGFDFDF |
Ga0209073_103846392 | 3300027765 | Agricultural Soil | GFAIHNEYSWIRQRGTAPDGTDLASSSVLLGFDFDF |
Ga0265338_101854823 | 3300028800 | Rhizosphere | YNPFMTSRAGFAFHNEYAWLRQRGTSPVTGTDLTSTSLMLGFYFDF |
Ga0311338_117943441 | 3300030007 | Palsa | MTSRAGFAWFQEYSWNRQTGTAPDGTDLTSSSLMMGIDFDF |
Ga0310039_100430451 | 3300030706 | Peatlands Soil | GFAFHNEYSWLRQNGVSPVTGTDQTASSLLFGFDFDF |
Ga0265460_130751132 | 3300030740 | Soil | PIMTSRAGFAWHNEYSWLRQRGTAPDGSDLTSSSLLLGFDFDF |
Ga0265461_136285351 | 3300030743 | Soil | NYGNLDTYLIGYRYMPFMTNRAGFAWHNEYSWIRYKGLAPDGSDLTSSSLMLGFDFAF |
Ga0170824_1057182152 | 3300031231 | Forest Soil | PIMNSRAGFAWHNEYSWIKQAGGAPDGSDITSNSLMAGFDFDF |
Ga0265331_104949331 | 3300031250 | Rhizosphere | YRYNPFMNSRAGFAFHNEYSWFRQRGGAPDGSDLSSNSLMLGFDFAF |
Ga0170820_157837532 | 3300031446 | Forest Soil | LAWHNEYSWIKYYGLAPDGTDLTASSLMLGFDFDF |
Ga0170819_128184411 | 3300031469 | Forest Soil | MTSRAGFAIHNEYSWIRQRGTSPVTASDLSSSSLMLGFDFDF |
Ga0170819_143836812 | 3300031469 | Forest Soil | NLGNIDNYVFGYRYYPIMTSRTGFAFHNEYSWIRGRGLAPDGSDLSSNSLMLGFDFDF |
Ga0170818_1085927882 | 3300031474 | Forest Soil | ACFFIMNSRAGFAWHNEYSWIKQAGGAPDGSDITSNSLMAGFDFDF |
Ga0311364_100214619 | 3300031521 | Fen | MTSRAGFAFHNEYSWIRQRGTSPTTQTDLTGSSLMLGMDFDF |
Ga0307468_1024487582 | 3300031740 | Hardwood Forest Soil | SRAGFAIHNEYSWIRQRGTSPVSGTDLTSNSLMLGFDFDF |
Ga0307473_100822633 | 3300031820 | Hardwood Forest Soil | RAGFAFHNEYSWIRQRGTAPDGTDLTSGSILLGFDFAF |
Ga0308175_1008896492 | 3300031938 | Soil | NPFMTSRAGFAFHNEYSWIRQRGTSPVTATDLSSNSLLLGFDFDF |
Ga0307479_119999761 | 3300031962 | Hardwood Forest Soil | TSRAGFAWHNEYSWFRQRGTAPDGTDLTNSSLLLGFDFDF |
Ga0306924_108273681 | 3300032076 | Soil | RAGFAFHNEYSWIRQRGTAPDASDLSSNSLMLGFDFDF |
Ga0307471_1007499551 | 3300032180 | Hardwood Forest Soil | GFRWMPFMTSRAGFAWHNEYSWIRGQGLAPDGSALTQSSLMSGFDFDF |
Ga0307472_1014737812 | 3300032205 | Hardwood Forest Soil | WYPIMTSRAGFAFHNEYSRIIQHSAAPDGTDLTSSSVFVGFDFDF |
Ga0335079_106873982 | 3300032783 | Soil | MYTFGFRWYPIMLPRAGFAFHNEYSWLRQNGVSSVTGTDLTSSSLMFGWDFDF |
Ga0335079_108266961 | 3300032783 | Soil | AGFAWHNEYSWIRQRGGAPDGTDLTSSSVLLGFDFDF |
Ga0335078_123074671 | 3300032805 | Soil | FAWHNEYSWIRWQGMAPDGTALTSSSLMSGFDFDF |
Ga0335081_104622353 | 3300032892 | Soil | FTSSLGNIDNYVFGFRWMPIMNNRAGFAWHNEYSWIRWQGMAPDGTALTSSSLMSGFDFD |
Ga0335074_112887951 | 3300032895 | Soil | MNPRAGFAWHNEYSWLRTQGLSPVTGTALTSSSLFSGFDFDF |
Ga0335084_123802461 | 3300033004 | Soil | NPRAGFALHNEYSWLRQRGTSPVTGTDLTTSSLILGFDFDF |
Ga0335077_102326453 | 3300033158 | Soil | DTYVFGMRWMPFMTSRAGLAWHNEYSWNRVQGAAQDGTAVTGSSLMSGLDFDF |
Ga0335077_111596831 | 3300033158 | Soil | NIDSYVFGMRWMPFMTNRAGFAWHNEYSWIRWQGMAPDGTALTSSSLMSGFDFDF |
Ga0370515_0019060_31_165 | 3300034163 | Untreated Peat Soil | MPIMTSRAGFAWHNEYNWLRQSKAAPDGTDLTSSELLLGFDFAF |
⦗Top⦘ |