Basic Information | |
---|---|
Family ID | F073367 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 40 residues |
Representative Sequence | RTPDITEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.33 % |
% of genes from short scaffolds (< 2000 bps) | 88.33 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (97.500 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.35% β-sheet: 0.00% Coil/Unstructured: 67.65% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF12710 | HAD | 26.67 |
PF07993 | NAD_binding_4 | 1.67 |
PF05973 | Gp49 | 1.67 |
PF09413 | DUF2007 | 1.67 |
PF08241 | Methyltransf_11 | 0.83 |
PF00501 | AMP-binding | 0.83 |
PF13594 | Obsolete Pfam Family | 0.83 |
PF13304 | AAA_21 | 0.83 |
PF12713 | DUF3806 | 0.83 |
PF08242 | Methyltransf_12 | 0.83 |
PF14534 | DUF4440 | 0.83 |
PF00180 | Iso_dh | 0.83 |
PF13649 | Methyltransf_25 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 1.67 |
COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 1.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.50 % |
Unclassified | root | N/A | 2.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001471|JGI12712J15308_10116947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 680 | Open in IMG/M |
3300001593|JGI12635J15846_10067997 | All Organisms → cellular organisms → Bacteria | 2646 | Open in IMG/M |
3300001593|JGI12635J15846_10574632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100667159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 917 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101773879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 517 | Open in IMG/M |
3300002908|JGI25382J43887_10070061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1895 | Open in IMG/M |
3300004082|Ga0062384_100577816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300004082|Ga0062384_100936383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300004092|Ga0062389_100271509 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
3300005184|Ga0066671_10635366 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300005434|Ga0070709_11208425 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 608 | Open in IMG/M |
3300005439|Ga0070711_100546749 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300005542|Ga0070732_10933545 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300005553|Ga0066695_10156464 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1421 | Open in IMG/M |
3300005764|Ga0066903_100543213 | All Organisms → cellular organisms → Bacteria | 1989 | Open in IMG/M |
3300006162|Ga0075030_100382721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1121 | Open in IMG/M |
3300006162|Ga0075030_101555154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 517 | Open in IMG/M |
3300006791|Ga0066653_10356096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
3300006806|Ga0079220_10503526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 829 | Open in IMG/M |
3300006893|Ga0073928_10498365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
3300006914|Ga0075436_100330934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1095 | Open in IMG/M |
3300009038|Ga0099829_10514145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 994 | Open in IMG/M |
3300009162|Ga0075423_10178780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2227 | Open in IMG/M |
3300009174|Ga0105241_12198970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 547 | Open in IMG/M |
3300009792|Ga0126374_11576227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 542 | Open in IMG/M |
3300010321|Ga0134067_10001647 | All Organisms → cellular organisms → Bacteria | 5215 | Open in IMG/M |
3300010322|Ga0134084_10027919 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
3300010358|Ga0126370_12559461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 509 | Open in IMG/M |
3300010359|Ga0126376_10337101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1330 | Open in IMG/M |
3300010366|Ga0126379_10755082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1070 | Open in IMG/M |
3300010373|Ga0134128_10234818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2059 | Open in IMG/M |
3300010398|Ga0126383_10192033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1952 | Open in IMG/M |
3300010401|Ga0134121_11115113 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
3300011120|Ga0150983_10988520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 627 | Open in IMG/M |
3300011269|Ga0137392_10416650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
3300012199|Ga0137383_10035897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3505 | Open in IMG/M |
3300012205|Ga0137362_10899392 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
3300012205|Ga0137362_10939983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 737 | Open in IMG/M |
3300012210|Ga0137378_11505185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 584 | Open in IMG/M |
3300012351|Ga0137386_11107376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 559 | Open in IMG/M |
3300012357|Ga0137384_10138326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2039 | Open in IMG/M |
3300012582|Ga0137358_10397426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 932 | Open in IMG/M |
3300012582|Ga0137358_10573352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 758 | Open in IMG/M |
3300012683|Ga0137398_10199552 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1318 | Open in IMG/M |
3300012683|Ga0137398_11012263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300012917|Ga0137395_10129075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1712 | Open in IMG/M |
3300012924|Ga0137413_10086435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1920 | Open in IMG/M |
3300012925|Ga0137419_10149139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1686 | Open in IMG/M |
3300012929|Ga0137404_12065889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 532 | Open in IMG/M |
3300012929|Ga0137404_12335461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 501 | Open in IMG/M |
3300012930|Ga0137407_11121368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 746 | Open in IMG/M |
3300012931|Ga0153915_12138395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300012960|Ga0164301_11551138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 548 | Open in IMG/M |
3300012982|Ga0168317_1117535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300013306|Ga0163162_11420243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 790 | Open in IMG/M |
3300013307|Ga0157372_10168782 | All Organisms → cellular organisms → Bacteria | 2531 | Open in IMG/M |
3300014969|Ga0157376_11307756 | Not Available | 755 | Open in IMG/M |
3300015241|Ga0137418_10095173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2686 | Open in IMG/M |
3300015373|Ga0132257_100567360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1399 | Open in IMG/M |
3300016270|Ga0182036_11802626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 518 | Open in IMG/M |
3300016445|Ga0182038_11846697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 546 | Open in IMG/M |
3300017933|Ga0187801_10070858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1290 | Open in IMG/M |
3300017942|Ga0187808_10258505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 780 | Open in IMG/M |
3300017959|Ga0187779_10081432 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1927 | Open in IMG/M |
3300017972|Ga0187781_11009660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 608 | Open in IMG/M |
3300018085|Ga0187772_10062907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2312 | Open in IMG/M |
3300018433|Ga0066667_12219516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 512 | Open in IMG/M |
3300020004|Ga0193755_1196017 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 580 | Open in IMG/M |
3300020140|Ga0179590_1071743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 913 | Open in IMG/M |
3300020581|Ga0210399_10171840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1797 | Open in IMG/M |
3300020582|Ga0210395_11437385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 502 | Open in IMG/M |
3300021477|Ga0210398_10968692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 680 | Open in IMG/M |
3300021478|Ga0210402_10637690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 986 | Open in IMG/M |
3300021560|Ga0126371_10455426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
3300022504|Ga0242642_1033055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 755 | Open in IMG/M |
3300024284|Ga0247671_1040124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 725 | Open in IMG/M |
3300025939|Ga0207665_10897982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 703 | Open in IMG/M |
3300025942|Ga0207689_10396976 | Not Available | 1149 | Open in IMG/M |
3300026298|Ga0209236_1009111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis → Nannocystis exedens | 5886 | Open in IMG/M |
3300026307|Ga0209469_1031981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1761 | Open in IMG/M |
3300026310|Ga0209239_1077500 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1442 | Open in IMG/M |
3300026314|Ga0209268_1148550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300026317|Ga0209154_1133475 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
3300026320|Ga0209131_1420535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 502 | Open in IMG/M |
3300026333|Ga0209158_1157732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
3300026343|Ga0209159_1128607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1050 | Open in IMG/M |
3300026482|Ga0257172_1091140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
3300026551|Ga0209648_10081832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2693 | Open in IMG/M |
3300027645|Ga0209117_1088808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
3300027678|Ga0209011_1008103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Nannocystaceae → Nannocystis → Nannocystis exedens | 3562 | Open in IMG/M |
3300027727|Ga0209328_10137986 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
3300027729|Ga0209248_10182705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300027765|Ga0209073_10118299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 952 | Open in IMG/M |
3300027846|Ga0209180_10075180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1900 | Open in IMG/M |
3300027853|Ga0209274_10626647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 556 | Open in IMG/M |
3300027853|Ga0209274_10757533 | Not Available | 500 | Open in IMG/M |
3300028138|Ga0247684_1093656 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
3300028536|Ga0137415_11441543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 512 | Open in IMG/M |
3300028806|Ga0302221_10450129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 561 | Open in IMG/M |
3300028906|Ga0308309_10863108 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300030399|Ga0311353_10510953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1063 | Open in IMG/M |
3300031233|Ga0302307_10059389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2029 | Open in IMG/M |
3300031561|Ga0318528_10218784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
3300031640|Ga0318555_10036645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2423 | Open in IMG/M |
3300031718|Ga0307474_11472130 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 536 | Open in IMG/M |
3300031720|Ga0307469_12024756 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 559 | Open in IMG/M |
3300031736|Ga0318501_10758249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 536 | Open in IMG/M |
3300031740|Ga0307468_100577547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 912 | Open in IMG/M |
3300031754|Ga0307475_10160977 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1786 | Open in IMG/M |
3300031777|Ga0318543_10147368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1033 | Open in IMG/M |
3300031823|Ga0307478_10779594 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
3300031833|Ga0310917_10346913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1007 | Open in IMG/M |
3300031890|Ga0306925_11409197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 687 | Open in IMG/M |
3300031897|Ga0318520_10512561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
3300031942|Ga0310916_10770946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 811 | Open in IMG/M |
3300031947|Ga0310909_11302420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 584 | Open in IMG/M |
3300032035|Ga0310911_10469076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 729 | Open in IMG/M |
3300032205|Ga0307472_100523032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1028 | Open in IMG/M |
3300032954|Ga0335083_10241446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1622 | Open in IMG/M |
3300033004|Ga0335084_11025984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.17% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.00% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.00% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.50% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.50% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.50% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.50% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.67% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.67% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.67% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.83% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.83% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.83% |
Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.83% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022504 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-2-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12712J15308_101169472 | 3300001471 | Forest Soil | EPGQRAIGGAVFTELLREEMLRSLEHAERYGWGV* |
JGI12635J15846_100679973 | 3300001593 | Forest Soil | TPDIMETGARASSTSGLMEILHEEMQRTLEHAERYGWGV* |
JGI12635J15846_105746322 | 3300001593 | Forest Soil | RTPDIAEPGQRAIGGSVFTELLREEMLRSLEHAERYGWGV* |
JGIcombinedJ26739_1006671591 | 3300002245 | Forest Soil | AEPGQRAIGGSVFTELLREEMLRSLEHAERYGWGV* |
JGIcombinedJ26739_1017738791 | 3300002245 | Forest Soil | YRTPDIMETGARASSTSGLMEILHEEMQRTLEHAERYGWGV* |
JGI25382J43887_100700611 | 3300002908 | Grasslands Soil | GGYRTPDITEPGARSVGGSVFTEVLREEMQRTFEHAERYGWGV* |
Ga0062384_1005778161 | 3300004082 | Bog Forest Soil | RTPDIIEPGARAIGGSAFMEILREEMQRTLEHAERYGWGV* |
Ga0062384_1009363832 | 3300004082 | Bog Forest Soil | AGGYRTPDIAQPGASTIAGSVFTEMLREEMQRTLEHAERYGWGV* |
Ga0062389_1002715091 | 3300004092 | Bog Forest Soil | RTTDIAGPGGRTVGGSVFTEMLREEMQRTLEHAERYGWGV* |
Ga0066671_106353662 | 3300005184 | Soil | LSGGYRTPDLAAPGTKTVGTAGFMEILHDEMQRTLEHAERYGWGV* |
Ga0070709_112084252 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | QSVVRVLQAGNRTPDLATPGTKPVGTTGFMDILHVEMQRTLEHAERYGWGV* |
Ga0070711_1005467491 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | SVVRVLSGGYRTPDLAGPGSKPIGTAGFMEILHQELQRTLEHAERYGWGV* |
Ga0070732_109335452 | 3300005542 | Surface Soil | HRTPDITEPGARTVGGSIFTEILREEMQRTLEHAERYGWGV* |
Ga0066695_101564641 | 3300005553 | Soil | ADWIEQSVVRVLQDGNRTPDLAMPGAKPIGTTGFMDILHVEMQRTLEHAERYGWGV* |
Ga0066903_1005432133 | 3300005764 | Tropical Forest Soil | YRTPDLASPGSKPIGTSGFMEILHTELQRSLEHAERYGWGV* |
Ga0075030_1003827211 | 3300006162 | Watersheds | LSGGYRTPDIAEPGARTVTGSTFTEMLREEMQRTLEHAERYGWGV* |
Ga0075030_1015551542 | 3300006162 | Watersheds | AEKGSRAVGTHAFNEILREEMQRTLEHAERYGWGV* |
Ga0066653_103560961 | 3300006791 | Soil | DLAMPGAKPIGTTGFMDILHVEMQRTLEHAERYGWGV* |
Ga0079220_105035261 | 3300006806 | Agricultural Soil | RTSDLAAPGSKPIGTNGFMEILHVEMQRTLEHAERYGWGV* |
Ga0073928_104983652 | 3300006893 | Iron-Sulfur Acid Spring | EPGARTVSGSAFTEMLREEMQRTLEHAERYGWGV* |
Ga0075436_1003309341 | 3300006914 | Populus Rhizosphere | VVRVLQAGNRTPDLATPGAKPVGTTGFMEILHVEMQRTLEHAERYGWGV* |
Ga0099829_105141451 | 3300009038 | Vadose Zone Soil | EPGARAVGGSVFTEILREEMQRTFEHAERYGWGV* |
Ga0075423_101787803 | 3300009162 | Populus Rhizosphere | VVRVLSAGHRTPDLAAAGCKPIGTNGFMEVLHTEMQRTLEHAERYGWGV* |
Ga0105241_121989701 | 3300009174 | Corn Rhizosphere | GYRTPDLASPGFKPVGTAGFNETLHTEMQRTLEHAERYGWGV* |
Ga0126374_115762272 | 3300009792 | Tropical Forest Soil | AGYRTPDIAEPKARLVRGSVFTEILREEMQRTFEHAERYGWGV* |
Ga0134067_100016474 | 3300010321 | Grasslands Soil | EPGVRAVGGSVFTEILREEMQRTFEHAERYGWGV* |
Ga0134084_100279193 | 3300010322 | Grasslands Soil | DITEPGARAVGGSVFTEVLREEMQRTFEHAERYGWGV* |
Ga0126370_125594612 | 3300010358 | Tropical Forest Soil | GAGYRTPDLASPGSKPIGTTGFMEILHEEMQRTLEHAERYGWGV* |
Ga0126376_103371013 | 3300010359 | Tropical Forest Soil | EQSVVRVLAAGHRTPDLAAPGSKTIGTSGFMEILHTEMQRTLEHAERYGWGV* |
Ga0126379_107550821 | 3300010366 | Tropical Forest Soil | LAAPGSKAIGTSGFMEILHTEMQRTLEHAERYGWGV* |
Ga0134128_102348183 | 3300010373 | Terrestrial Soil | AQPGASTSGGSVFTEMLREEMQRTLEHAERYGWGV* |
Ga0126383_101920333 | 3300010398 | Tropical Forest Soil | APGAKAVGTNGFMEILHVEMQRTLEHAERYGWGV* |
Ga0134121_111151131 | 3300010401 | Terrestrial Soil | ADIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV* |
Ga0150983_109885201 | 3300011120 | Forest Soil | IAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV* |
Ga0137392_104166502 | 3300011269 | Vadose Zone Soil | VLSAGYRTPDIAEPNARAVGGSVFTEILKEEMQRTFEHAERYGWGV* |
Ga0137383_100358973 | 3300012199 | Vadose Zone Soil | GGYRTPDLAAGGVKPVGTAGFMEILHEEMQRTLEHAERYGWGV* |
Ga0137362_108993922 | 3300012205 | Vadose Zone Soil | ITEPGARAVGGSMFTEILREEMQRTFEHAERYGWGV* |
Ga0137362_109399832 | 3300012205 | Vadose Zone Soil | TPDITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV* |
Ga0137378_115051851 | 3300012210 | Vadose Zone Soil | TEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV* |
Ga0137386_111073761 | 3300012351 | Vadose Zone Soil | DWIEQSVVRVLQAGHRTPDLAMPGAKPVGMTGFMDILHVEMQRTLEHAERYGWGV* |
Ga0137384_101383262 | 3300012357 | Vadose Zone Soil | RTPDIAEPKARVVGGSVFTEILREEMQRTFEHAERYGWGV* |
Ga0137358_103974261 | 3300012582 | Vadose Zone Soil | DITEQGARAVGGSVFTEILREEMQRTFEHAERYGWGV* |
Ga0137358_105733522 | 3300012582 | Vadose Zone Soil | TPDLVAAGAKPVGTAGFMEILHEEMQRTLEHAERYGWGV* |
Ga0137398_101995521 | 3300012683 | Vadose Zone Soil | PDITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV* |
Ga0137398_110122631 | 3300012683 | Vadose Zone Soil | TVDISDSSAHTVTGSAFVEMLRDEMQRTLEHAERYGWGV* |
Ga0137395_101290751 | 3300012917 | Vadose Zone Soil | YRTPDIAENGARTVTGSAFTEMLREEMQRTLEHAERYGWGV* |
Ga0137413_100864351 | 3300012924 | Vadose Zone Soil | AEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV* |
Ga0137419_101491391 | 3300012925 | Vadose Zone Soil | TEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV* |
Ga0137404_120658891 | 3300012929 | Vadose Zone Soil | RTPDITEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV* |
Ga0137404_123354612 | 3300012929 | Vadose Zone Soil | TPDMASPGSKPIGTAGFMEILHGEMQRTLEHAERYGWGV* |
Ga0137407_111213681 | 3300012930 | Vadose Zone Soil | ITEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV* |
Ga0153915_121383952 | 3300012931 | Freshwater Wetlands | GYRTPDIMEPGARTVGGSVFTEILREEMQRTFEHAERYGWGV* |
Ga0164301_115511382 | 3300012960 | Soil | PDLAAPGCKPIGTNGFMEILHVEMQRTLEHAERYGWGV* |
Ga0168317_11175352 | 3300012982 | Weathered Mine Tailings | EPGARNVGGSAFAEILREEMQRTLEHAERYGWGV* |
Ga0163162_114202432 | 3300013306 | Switchgrass Rhizosphere | VRVLAGGYRTPDLAAPGCKPIGTNGFMEILQVEMQRTLEHAERYGWGV* |
Ga0157372_101687821 | 3300013307 | Corn Rhizosphere | IAGPGGRVVGGSIFTETLREEMQRTLEHAERYGWGV* |
Ga0157376_113077561 | 3300014969 | Miscanthus Rhizosphere | GPGGRIVPASVFTEMLREEMQRTLEHAERYGWGV* |
Ga0137418_100951734 | 3300015241 | Vadose Zone Soil | PDIAEPGARTLSGSAFTEMLREEMQRTLEHAERYGWGV* |
Ga0132257_1005673601 | 3300015373 | Arabidopsis Rhizosphere | APGCKPIGTNGFMEILQVEMQRTLEHAERYGWGV* |
Ga0182036_118026261 | 3300016270 | Soil | IAEPKARVVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0182038_118466972 | 3300016445 | Soil | YRTPDLAAPGCKPIGTNGFMEILHEEMQRTLEHAERYGWGV |
Ga0187801_100708581 | 3300017933 | Freshwater Sediment | GYRTTDISEPGAKTVGGSVFTEILHEEMQRTFEHAEKYGWGV |
Ga0187808_102585051 | 3300017942 | Freshwater Sediment | ICAPGAKAVGGSVFTEILREEMQRTYEHAERYGWGV |
Ga0187779_100814321 | 3300017959 | Tropical Peatland | LNGYRTPDITEPAAKTVGTSAFMETLHEEMQRTLEHAERYGWGV |
Ga0187781_110096602 | 3300017972 | Tropical Peatland | VLAGGYRTVDLAEPGAKTVSGSAFTEILREEMQRTFEHAERYGWGV |
Ga0187772_100629072 | 3300018085 | Tropical Peatland | VLAGGYRTVDLAEPGARTVSGSAFTEILREEMQRTFEHAERFGWGV |
Ga0066667_122195162 | 3300018433 | Grasslands Soil | GGYRTPDLIAAGAKPVGTAGFMEILHEEMQRTLEHAERYGWGV |
Ga0193755_11960172 | 3300020004 | Soil | DIAEPGARAVGGSVFTEILREEMLRTLEHAERYGWGV |
Ga0179590_10717433 | 3300020140 | Vadose Zone Soil | SGGYRTPDIAENGARTVTGSAFTEMLREEMQRTLEHAERYGWGV |
Ga0210399_101718401 | 3300020581 | Soil | RRRYRTPDITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0210395_114373851 | 3300020582 | Soil | TPDISEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV |
Ga0210398_109686922 | 3300021477 | Soil | YRTPDIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV |
Ga0210402_106376901 | 3300021478 | Soil | PDIAQPGGSTIGGSVFTEMLREEMQRTLEHAERYGWGV |
Ga0126371_104554262 | 3300021560 | Tropical Forest Soil | AEPKARVVGGSVFTEVLREEMQRTFEHAERYGWGV |
Ga0242642_10330551 | 3300022504 | Soil | RTPDISEPGARTVSGSAFTEMLREEMQRTLEHAERYGWGV |
Ga0247671_10401241 | 3300024284 | Soil | IAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV |
Ga0207665_108979822 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LIGPGAKRVGTAGFMEILHDEMQRTLEHAERYGWGV |
Ga0207689_103969763 | 3300025942 | Miscanthus Rhizosphere | SDLAGPGGRIVAASVFTEMLREEMQRTLEHAERYGWGV |
Ga0209236_10091115 | 3300026298 | Grasslands Soil | ITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0209469_10319811 | 3300026307 | Soil | RTPDIAEPKARVVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0209239_10775002 | 3300026310 | Grasslands Soil | SEPGVRAVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0209268_11485502 | 3300026314 | Soil | ISEPGVRAVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0209154_11334751 | 3300026317 | Soil | DIAEPKSRIVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0209131_14205351 | 3300026320 | Grasslands Soil | GYRTPDIAENGARTVTGSAFTEMLREEMQRTLEHAERYGWGV |
Ga0209158_11577322 | 3300026333 | Soil | PDIAEAGTRTVSGSAFTEMLREEMQRTLEHAERYGWGV |
Ga0209159_11286071 | 3300026343 | Soil | YRTPDIAEANARVVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0257172_10911402 | 3300026482 | Soil | DIAEPGARTVSGSAFTEMLREEMQRTLEHAERYGWGV |
Ga0209648_100818323 | 3300026551 | Grasslands Soil | RTPDITEQGARAVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0209117_10888081 | 3300027645 | Forest Soil | LAGGYRTPDIVEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0209011_10081033 | 3300027678 | Forest Soil | TPDITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0209328_101379861 | 3300027727 | Forest Soil | RTPDIMETGARASSTSGLMEILHEEMQRTLEHAERYGWGV |
Ga0209248_101827051 | 3300027729 | Bog Forest Soil | AQPGASTIAGSVFTEMLREEMQRTLEHAERYGWGV |
Ga0209073_101182991 | 3300027765 | Agricultural Soil | PTPDIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV |
Ga0209180_100751802 | 3300027846 | Vadose Zone Soil | DITEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0209274_106266471 | 3300027853 | Soil | DIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV |
Ga0209274_107575332 | 3300027853 | Soil | SDIAGPGGRTVGGSVFTEMLREEMQRTLEHAERYGWGV |
Ga0247684_10936561 | 3300028138 | Soil | TADIAQPGASTIGGSVFTEMLREEMQRTLEHAERYGWGV |
Ga0137415_114415432 | 3300028536 | Vadose Zone Soil | SEPGARAVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0302221_104501292 | 3300028806 | Palsa | GYRTPDIIEPGAKAIGATAFMTILREEMQRTLEHAERYGWGV |
Ga0308309_108631082 | 3300028906 | Soil | IDIAGLVGRSVGGSVFTEMLREEMQRTLEHAERYGWGV |
Ga0311353_105109531 | 3300030399 | Palsa | AGGYRTPDIIEPGAKAIGATAFMTILREEMQRTLEHAERYGWGV |
Ga0302307_100593892 | 3300031233 | Palsa | DIIEPGARAIGGAAFMEILREEMQRTLEHAERYGWGV |
Ga0318528_102187841 | 3300031561 | Soil | RTPDIAEPKARVVGGSVFTEILGEEMQRTFEHAERYGWGV |
Ga0318555_100366451 | 3300031640 | Soil | LSAGYRTPDIAEPKARVVGGSVFTEILREEMQRTFEHAERYGWGV |
Ga0307474_114721301 | 3300031718 | Hardwood Forest Soil | GGYRTPDIIEPGARAVGGRAFMEILREEMQRTLEHAERYGWGV |
Ga0307469_120247561 | 3300031720 | Hardwood Forest Soil | AGYRTPDLVSPGSKAIGRVGFMEILHTEMQRTLEHAERYGWGV |
Ga0318501_107582491 | 3300031736 | Soil | DWVEQSITRTLAAGYRTPDLAAPGTKAIGTNGFMEILHEEMQRTLEHAERYGWGV |
Ga0307468_1005775472 | 3300031740 | Hardwood Forest Soil | YRTPDITEPGARAVGGSVFTEILREEMQRTLEHAERYGWGV |
Ga0307475_101609772 | 3300031754 | Hardwood Forest Soil | ISGPGALIVAGSTFTEMLREEMQRTLEHAERYGWGV |
Ga0318543_101473681 | 3300031777 | Soil | QSITRTLAAGYRTPDLAAPGTKSIGTNGFMEILHEEMQRTLEHAERYGWGV |
Ga0307478_107795941 | 3300031823 | Hardwood Forest Soil | GGYRTPDIAEPGQRAIGGSVFTELLREEMLRSLEHAERYGWGV |
Ga0310917_103469132 | 3300031833 | Soil | GHRTPDLAAPGSKAIGTSGFMEILHTEMQRTLEHAERYGWGV |
Ga0306925_114091971 | 3300031890 | Soil | ASPGSKTIGTNGFMEILHEEMQRTLEHAERYGWGV |
Ga0318520_105125611 | 3300031897 | Soil | SEAGARTVGGSVFADILREELHRTLEHAERYGWGV |
Ga0310916_107709462 | 3300031942 | Soil | RTPDLAAPGSKAIGTSGFMEILHTEMQRTLEHAERYGWGV |
Ga0310909_113024203 | 3300031947 | Soil | SGGYRTPDLAGPGSRPVGAAGFMEILHQEMQRTLEHAERYGWGV |
Ga0310911_104690762 | 3300032035 | Soil | RVLAAGHRTPDLAAPGSKAIGTSGFMEILHTEMQRTLEHAERYGWGV |
Ga0307472_1005230322 | 3300032205 | Hardwood Forest Soil | PDISENGARTVTGSAFTEMLREEMQRTLEHAERYGWGV |
Ga0335083_102414463 | 3300032954 | Soil | DLAAPGTKAIGANGFMEVLHAEMQRTLEHAERYGWGV |
Ga0335084_110259841 | 3300033004 | Soil | LVNGFRTPDIAEPLGKTVGTTSFMEHLHEEMQRTLEHAERYGWGV |
⦗Top⦘ |