NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073571

Metagenome / Metatranscriptome Family F073571

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073571
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 44 residues
Representative Sequence MVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH
Number of Associated Samples 43
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.67 %
% of genes near scaffold ends (potentially truncated) 90.00 %
% of genes from short scaffolds (< 2000 bps) 62.50 %
Associated GOLD sequencing projects 41
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.167 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Sediment → Marine
(17.500 % of family members)
Environment Ontology (ENVO) Unclassified
(27.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(25.833 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 34.88%    Coil/Unstructured: 65.12%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF07228SpoIIE 3.33
PF02518HATPase_c 2.50
PF00994MoCF_biosynth 1.67
PF00850Hist_deacetyl 1.67
PF07702UTRA 1.67
PF02423OCD_Mu_crystall 1.67
PF06974WS_DGAT_C 1.67
PF09853DUF2080 1.67
PF02572CobA_CobO_BtuR 1.67
PF06750DiS_P_DiS 1.67
PF00749tRNA-synt_1c 1.67
PF00342PGI 1.67
PF01734Patatin 1.67
PF01243Putative_PNPOx 1.67
PF01925TauE 0.83
PF13421Band_7_1 0.83
PF01979Amidohydro_1 0.83
PF07022Phage_CI_repr 0.83
PF01636APH 0.83
PF02080TrkA_C 0.83
PF03054tRNA_Me_trans 0.83
PF00970FAD_binding_6 0.83
PF01740STAS 0.83
PF03934T2SSK 0.83
PF08359TetR_C_4 0.83
PF02310B12-binding 0.83
PF01553Acyltransferase 0.83
PF01266DAO 0.83
PF00216Bac_DNA_binding 0.83
PF01891CbiM 0.83
PF14622Ribonucleas_3_3 0.83
PF13336AcetylCoA_hyd_C 0.83
PF04055Radical_SAM 0.83
PF13549ATP-grasp_5 0.83
PF02566OsmC 0.83
PF08669GCV_T_C 0.83
PF00012HSP70 0.83
PF02780Transketolase_C 0.83
PF01926MMR_HSR1 0.83
PF02190LON_substr_bdg 0.83
PF07973tRNA_SAD 0.83
PF00210Ferritin 0.83
PF01255Prenyltransf 0.83
PF00462Glutaredoxin 0.83
PF01207Dus 0.83
PF02769AIRS_C 0.83
PF09505Dimeth_Pyl 0.83
PF14833NAD_binding_11 0.83
PF08264Anticodon_1 0.83
PF027373HCDH_N 0.83
PF00440TetR_N 0.83
PF01761DHQ_synthase 0.83
PF01963TraB_PrgY_gumN 0.83
PF03992ABM 0.83
PF12724Flavodoxin_5 0.83
PF08735DUF1786 0.83
PF07947YhhN 0.83
PF01022HTH_5 0.83
PF13424TPR_12 0.83
PF13450NAD_binding_8 0.83
PF13511DUF4124 0.83
PF13669Glyoxalase_4 0.83
PF07732Cu-oxidase_3 0.83
PF12833HTH_18 0.83
PF03950tRNA-synt_1c_C 0.83
PF12832MFS_1_like 0.83
PF00581Rhodanese 0.83
PF00534Glycos_transf_1 0.83
PF04228Zn_peptidase 0.83
PF02441Flavoprotein 0.83
PF13247Fer4_11 0.83
PF03692CxxCxxCC 0.83
PF13414TPR_11 0.83
PF00701DHDPS 0.83
PF01066CDP-OH_P_transf 0.83
PF05099TerB 0.83
PF00069Pkinase 0.83
PF02146SIR2 0.83
PF05973Gp49 0.83
PF01875Memo 0.83
PF13275S4_2 0.83
PF00710Asparaginase 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG1989Prepilin signal peptidase PulO (type II secretory pathway) or related peptidaseCell motility [N] 5.00
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.33
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 3.33
COG0008Glutamyl- or glutaminyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 2.50
COG0166Glucose-6-phosphate isomeraseCarbohydrate transport and metabolism [G] 1.67
COG0252L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit DTranslation, ribosomal structure and biogenesis [J] 1.67
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.67
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 1.67
COG2109ATP:corrinoid adenosyltransferaseCoenzyme transport and metabolism [H] 1.67
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 1.67
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 1.67
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 1.67
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.83
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.83
COG0310ABC-type Co2+ transport system, permease componentInorganic ion transport and metabolism [P] 0.83
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 0.83
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.83
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.83
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.83
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.83
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.83
COG0846NAD-dependent protein deacetylase, SIR2 familyPosttranslational modification, protein turnover, chaperones [O] 0.83
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.83
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.83
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.83
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.83
COG1355Predicted class III extradiol dioxygenase, MEMO1 familyGeneral function prediction only [R] 0.83
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.83
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 0.83
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 0.83
COG1916Pheromone shutdown protein TraB, contains GTxH motif (function unknown)Function unknown [S] 0.83
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.83
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.83
COG2321Predicted metalloproteaseGeneral function prediction only [R] 0.83
COG3156Type II secretory pathway, component PulKIntracellular trafficking, secretion, and vesicular transport [U] 0.83
COG3657Putative component of the toxin-antitoxin plasmid stabilization moduleDefense mechanisms [V] 0.83
COG3714Uncharacterized membrane protein YhhNFunction unknown [S] 0.83
COG3793Tellurite resistance protein TerBInorganic ion transport and metabolism [P] 0.83
COG4012Uncharacterized protein, DUF1786 family, actin-like ATPase superfamilyGeneral function prediction only [R] 0.83
COG4679Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin systemDefense mechanisms [V] 0.83
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.83
COG0020Undecaprenyl pyrophosphate synthaseLipid transport and metabolism [I] 0.83
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.17 %
UnclassifiedrootN/A20.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000242|TDF_OR_ARG05_123mDRAFT_1009013Not Available2640Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1019309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1647Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1027459All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1049341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae852Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1071678Not Available672Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1092604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria578Open in IMG/M
3300001685|JGI24024J18818_10125712All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300001685|JGI24024J18818_10184175All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium597Open in IMG/M
3300001685|JGI24024J18818_10204979Not Available554Open in IMG/M
3300004097|Ga0055584_100016297All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales7300Open in IMG/M
3300004097|Ga0055584_101564630All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria683Open in IMG/M
3300005589|Ga0070729_10555834All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria624Open in IMG/M
3300006467|Ga0099972_10017816All Organisms → cellular organisms → Bacteria → Proteobacteria3166Open in IMG/M
3300006467|Ga0099972_10105177All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300006467|Ga0099972_11097118All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1653Open in IMG/M
3300006467|Ga0099972_12014354All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300006467|Ga0099972_12338942Not Available722Open in IMG/M
3300006467|Ga0099972_12849106Not Available1644Open in IMG/M
3300006467|Ga0099972_12852744All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Legionellales → Coxiellaceae → Coxiella → unclassified Coxiella (in: g-proteobacteria) → Coxiella sp. DG_401947Open in IMG/M
3300006467|Ga0099972_12907091All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2208Open in IMG/M
3300006467|Ga0099972_12921877All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1032Open in IMG/M
3300006467|Ga0099972_13174753All Organisms → cellular organisms → Bacteria → Proteobacteria1971Open in IMG/M
3300006467|Ga0099972_13463487All Organisms → cellular organisms → Bacteria → Proteobacteria1579Open in IMG/M
3300007511|Ga0105000_1178787All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1228Open in IMG/M
3300009008|Ga0115649_1051797All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfonema → Desulfonema limicola5499Open in IMG/M
3300009008|Ga0115649_1432287All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300009035|Ga0102958_1112924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium857Open in IMG/M
3300009128|Ga0118727_1032045All Organisms → cellular organisms → Bacteria6404Open in IMG/M
3300009128|Ga0118727_1392444All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria742Open in IMG/M
3300009138|Ga0102959_1285932Not Available553Open in IMG/M
3300009138|Ga0102959_1302612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300009374|Ga0118720_1017309All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina5307Open in IMG/M
3300010330|Ga0136651_10011539All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis4847Open in IMG/M
3300010330|Ga0136651_10050811All Organisms → cellular organisms → Bacteria2232Open in IMG/M
3300010330|Ga0136651_10054646All Organisms → cellular organisms → Bacteria → Proteobacteria2145Open in IMG/M
3300010330|Ga0136651_10092413Not Available1598Open in IMG/M
3300010330|Ga0136651_10215462Not Available973Open in IMG/M
3300010330|Ga0136651_10430061Not Available648Open in IMG/M
3300010330|Ga0136651_10458260Not Available624Open in IMG/M
3300010330|Ga0136651_10530838Not Available571Open in IMG/M
3300010330|Ga0136651_10591084Not Available536Open in IMG/M
3300010392|Ga0118731_100163913Not Available623Open in IMG/M
3300010392|Ga0118731_103382792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria6558Open in IMG/M
3300010392|Ga0118731_103710708All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1005Open in IMG/M
3300010392|Ga0118731_104566165All Organisms → cellular organisms → Bacteria4000Open in IMG/M
3300010392|Ga0118731_105247940All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina variabilis4825Open in IMG/M
3300010392|Ga0118731_112080119Not Available545Open in IMG/M
3300010392|Ga0118731_112228566All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae24674Open in IMG/M
3300010392|Ga0118731_112372991All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae4490Open in IMG/M
3300010392|Ga0118731_112883733Not Available3339Open in IMG/M
3300010392|Ga0118731_115208661Not Available502Open in IMG/M
3300010430|Ga0118733_100011204All Organisms → cellular organisms → Bacteria22870Open in IMG/M
3300010430|Ga0118733_100021160All Organisms → cellular organisms → Bacteria → Proteobacteria15143Open in IMG/M
3300010430|Ga0118733_100046437All Organisms → cellular organisms → Bacteria9195Open in IMG/M
3300010430|Ga0118733_100047260All Organisms → cellular organisms → Bacteria9093Open in IMG/M
3300010430|Ga0118733_100054832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae8327Open in IMG/M
3300010430|Ga0118733_100204671All Organisms → cellular organisms → Bacteria3915Open in IMG/M
3300010430|Ga0118733_100360628All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2878Open in IMG/M
3300010430|Ga0118733_100378168All Organisms → cellular organisms → Bacteria2805Open in IMG/M
3300010430|Ga0118733_100649724All Organisms → cellular organisms → Bacteria → Proteobacteria2100Open in IMG/M
3300013099|Ga0164315_10001995All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria15530Open in IMG/M
3300013099|Ga0164315_10017359All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5679Open in IMG/M
3300013099|Ga0164315_10027304All Organisms → cellular organisms → Bacteria4541Open in IMG/M
3300013099|Ga0164315_10031148All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4248Open in IMG/M
3300013099|Ga0164315_10059604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3053Open in IMG/M
3300013099|Ga0164315_10110625All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2225Open in IMG/M
3300013099|Ga0164315_11397354All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium551Open in IMG/M
3300013101|Ga0164313_10005319All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria11397Open in IMG/M
3300013101|Ga0164313_10034520Not Available4281Open in IMG/M
3300013101|Ga0164313_10054216All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae3374Open in IMG/M
3300013101|Ga0164313_10476089All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1039Open in IMG/M
3300013101|Ga0164313_10478765Not Available1036Open in IMG/M
3300013101|Ga0164313_10743417All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300013119|Ga0171655_1004196All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria18594Open in IMG/M
3300014913|Ga0164310_10359834Not Available861Open in IMG/M
3300014914|Ga0164311_10033310All Organisms → cellular organisms → Bacteria → Proteobacteria3050Open in IMG/M
3300014914|Ga0164311_10038506All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2837Open in IMG/M
3300014914|Ga0164311_10091839All Organisms → cellular organisms → Bacteria → Proteobacteria1814Open in IMG/M
3300014914|Ga0164311_10208508All Organisms → cellular organisms → Bacteria → Terrabacteria group1157Open in IMG/M
3300014914|Ga0164311_10368595All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria835Open in IMG/M
3300017990|Ga0180436_10258442All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1264Open in IMG/M
3300017992|Ga0180435_10412747All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1121Open in IMG/M
3300017992|Ga0180435_10627672All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria903Open in IMG/M
3300021337|Ga0210341_1546893All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium511Open in IMG/M
3300021346|Ga0210335_1638920All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria822Open in IMG/M
3300021496|Ga0190343_1020650All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria926Open in IMG/M
3300021496|Ga0190343_1022612All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfamplus → Desulfamplus magnetovallimortis879Open in IMG/M
3300021506|Ga0190358_1120892All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300021514|Ga0190293_1000646All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria12400Open in IMG/M
3300021514|Ga0190293_1002564All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria6249Open in IMG/M
3300021514|Ga0190293_1002922All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5802Open in IMG/M
3300021514|Ga0190293_1003546All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5283Open in IMG/M
3300021514|Ga0190293_1023418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium 4572_32.11953Open in IMG/M
3300022391|Ga0210374_1070065All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria673Open in IMG/M
(restricted) 3300022913|Ga0233404_10030928Not Available1215Open in IMG/M
(restricted) 3300022938|Ga0233409_10265258All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales593Open in IMG/M
(restricted) 3300022938|Ga0233409_10362958All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria511Open in IMG/M
(restricted) 3300023089|Ga0233408_10133057All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria556Open in IMG/M
(restricted) 3300023210|Ga0233412_10267619Not Available751Open in IMG/M
(restricted) 3300023276|Ga0233410_10088159All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria955Open in IMG/M
3300027834|Ga0209344_10090209All Organisms → cellular organisms → Bacteria → Proteobacteria1676Open in IMG/M
3300027834|Ga0209344_10177516All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1094Open in IMG/M
3300027834|Ga0209344_10377370All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300027834|Ga0209344_10429555All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium606Open in IMG/M
3300027852|Ga0209345_10543983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium659Open in IMG/M
3300027852|Ga0209345_10807679All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatibacillum502Open in IMG/M
3300027858|Ga0209013_10018030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae5485Open in IMG/M
3300027858|Ga0209013_10050706Not Available2911Open in IMG/M
3300027858|Ga0209013_10059502All Organisms → cellular organisms → Bacteria2638Open in IMG/M
(restricted) 3300028045|Ga0233414_10608438All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp.518Open in IMG/M
3300032136|Ga0316201_11623645All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatitalea → unclassified Desulfatitalea → Desulfatitalea sp.534Open in IMG/M
3300032258|Ga0316191_10447426All Organisms → cellular organisms → Bacteria940Open in IMG/M
3300032260|Ga0316192_10214169Not Available1336Open in IMG/M
3300032260|Ga0316192_10758713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria653Open in IMG/M
3300032260|Ga0316192_10846617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria614Open in IMG/M
3300032262|Ga0316194_10720466Not Available628Open in IMG/M
3300032262|Ga0316194_10981035Not Available532Open in IMG/M
3300032263|Ga0316195_10008670All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5016Open in IMG/M
3300032276|Ga0316188_10094333All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1457Open in IMG/M
3300033429|Ga0316193_10800735All Organisms → cellular organisms → Bacteria750Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine17.50%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment15.83%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine10.00%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment8.33%
Marine Hydrothermal VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent7.50%
Hydrothermal Vent Microbial MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat6.67%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater5.83%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine5.83%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow5.00%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine5.00%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment3.33%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.50%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment2.50%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.50%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.67%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000242Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3mEnvironmentalOpen in IMG/M
3300001685Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005589Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2EnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300007511Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300009008Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7umEnvironmentalOpen in IMG/M
3300009035Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MGEnvironmentalOpen in IMG/M
3300009128Combined Assembly of Gp0137084, Gp0137083EnvironmentalOpen in IMG/M
3300009138Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D2_MGEnvironmentalOpen in IMG/M
3300009374Combined Assembly of Gp0137041, Gp0137043EnvironmentalOpen in IMG/M
3300010330Marine hydrothermal vent microbial communities from Guaymas Basin, Gulf of California to study Microbial Dark Matter (Phase II) - Marker 14 Mat core 4569-2 3-6 cm metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300013099Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay6, Core 4569-2, 0-3 cmEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013119Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 314m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300014913Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay1, Core 4569-9, 0-3 cmEnvironmentalOpen in IMG/M
3300014914Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay2, Core 4569-9, 9-12 cmEnvironmentalOpen in IMG/M
3300017990Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaGEnvironmentalOpen in IMG/M
3300017992Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_1 metaGEnvironmentalOpen in IMG/M
3300021337Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.425 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021346Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.374 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021496Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-13-1-2_MGEnvironmentalOpen in IMG/M
3300021506Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-1-2_MGEnvironmentalOpen in IMG/M
3300021514Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-30-0-1_MGEnvironmentalOpen in IMG/M
3300022391Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300027834Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027852Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes)EnvironmentalOpen in IMG/M
3300027858Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes)EnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300032136Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrowEnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032262Coastal sediment microbial communities from Maine, United States - Cross River sediment 1EnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300032276Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1EnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TDF_OR_ARG05_123mDRAFT_100901333300000242MarineMVFSRPAGVGRHDLTPQNSSLFLRVKSAARLGRTRQSLFLDGHXXG
TDF_OR_ARG05_123mDRAFT_101930923300000242MarineMLNSAHPQMVFFRNIGVGRPDLTPQNSTLFLRVKSVVRLDLTQKSSFLNGH*
TDF_OR_ARG05_123mDRAFT_102745923300000242MarineSDHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLT*
TDF_OR_ARG05_123mDRAFT_104934113300000242MarineRDIGVGRHDLTPQNSTLLLRIKSVVRLDLTQKSSFLDGH*
TDF_OR_ARG05_123mDRAFT_107167813300000242MarineMVFFRDIGVGRHDLTPQNSTLLLRVKSVIRLDLTQKSSFLDGH*
TDF_OR_ARG05_123mDRAFT_109260413300000242MarineAHPQMVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDGH*
JGI24024J18818_1012571223300001685MarinePQMVFFRDIGVGRHDLTPQNSTLLLRVKSIVRLDLT*
JGI24024J18818_1018417523300001685MarineMVFXRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH*
JGI24024J18818_1020497913300001685MarineMLRGSLFCAHPQMVFFRDICVGRHDLTPQNSTLLLRVKSVVRLDLTKKSS
Ga0055584_10001629763300004097Pelagic MarineRDIGVGRHDLTPQNSTLLLQVKSVARLDITQKSSFLDGH*
Ga0055584_10156463023300004097Pelagic MarineQMVFFRDIGVGRHDLTPQNSSLLFRVKSVVRLDFTQKSSFLDGH*
Ga0070729_1055583413300005589Marine SedimentSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDEH*
Ga0099972_1001781613300006467MarineSVHPQMVFIRDIGVGRQDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH*
Ga0099972_1010517713300006467MarineMVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLMQKSSFLDGH*
Ga0099972_1109711813300006467MarineQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDEH*
Ga0099972_1201435423300006467MarineMVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLMQKSS
Ga0099972_1233894223300006467MarineMVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDG
Ga0099972_1284910623300006467MarineRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH*
Ga0099972_1285274413300006467MarinePQMVFFRDIGVGRHDLTPQNSTLLLRVKSVARLDLTQKSSFLDGH*
Ga0099972_1290709113300006467MarineQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH*
Ga0099972_1292187723300006467MarineFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDGH*
Ga0099972_1317475333300006467MarineLVSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSFLDGH*
Ga0099972_1346348733300006467MarineFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH*
Ga0105000_117878723300007511MarineMVFFRDIGVGRHDLTPQNSTLFLRVKSDPLLDLTK
Ga0115649_105179713300009008MarineMVFFRDIGVGRHDLTPQNSTLFLRVKSDVLLDLTQKSLFLDGH*
Ga0115649_143228713300009008MarineMVFFRDIGVGRHDLNPQNSSLFLRVKSDTLLDLTKKSLFLDGHYLNEEIISSSAAL
Ga0102958_111292423300009035SoilMLRGSLFCAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLGGH*
Ga0118727_103204553300009128MarineMVFFRDIGVGRHDLTPQNSSLFLRVKSDTLLDLTKKSLFLDGHYLNEEIISSSAAL
Ga0118727_139244423300009128MarineMRSILFSAHPEMIFSRPAGVGRHDLTPQNSTLFLRVKSDARLGRTRKFLFLDGHSFGSAAETACK
Ga0102959_128593213300009138SoilAHPQMVFFRDIGVGRHDLTPQNSTLFLRVKSVVRLDLTEKSSFLDGH*
Ga0102959_130261223300009138SoilFFGEVCLCMLRGSLFCAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVFRLDLTKKSSFLDGH*
Ga0118720_101730953300009374MarineMTFLRDIGVGRHDLTPQNSTLFLRVKSAVRLDLTQKFLFLDGHQLKQLV*
Ga0136651_1001153973300010330Marine Hydrothermal VentMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKK
Ga0136651_1005081113300010330Marine Hydrothermal VentMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFL
Ga0136651_1005464633300010330Marine Hydrothermal VentGVTSAQPQMVFFRDIGVGHHDLIPQNSTLLLRIKSVVRLDLTQKSSFLDGH*
Ga0136651_1009241313300010330Marine Hydrothermal VentMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKFSFLDGH*
Ga0136651_1021546213300010330Marine Hydrothermal VentFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGQ*
Ga0136651_1043006113300010330Marine Hydrothermal VentMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKS
Ga0136651_1045826023300010330Marine Hydrothermal VentSSTSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH*
Ga0136651_1053083823300010330Marine Hydrothermal VentFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH*
Ga0136651_1059108413300010330Marine Hydrothermal VentMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLNGH*
Ga0118731_10016391313300010392MarineMDKTLTSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKS
Ga0118731_10338279243300010392MarineMDTPFPLTSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVARLDLTQKSSFLDGH*
Ga0118731_10371070813300010392MarineMVFFRDIGVGRHDLTPQNSTLLLRVKSVARLDLTQKSSFL
Ga0118731_10456616563300010392MarineRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDGH*
Ga0118731_10524794063300010392MarineFRDIGVGRHDLTPQNSTLLLRVKSVARLDLTQKSSFLDGH*
Ga0118731_11208011913300010392MarineFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH*
Ga0118731_11222856613300010392MarineQMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSFLDRH*
Ga0118731_11237299153300010392MarineAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKPSFLDGH*
Ga0118731_11288373323300010392MarineQMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSFLDGH*
Ga0118731_11520866113300010392MarinePQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLT*
Ga0118733_10001120413300010430Marine SedimentMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLT*
Ga0118733_100021160103300010430Marine SedimentMVFFRDIGVGRHDLTFQNSSLLLRVKSVVRLDLTQKSSFLDGH*
Ga0118733_10004643793300010430Marine SedimentCPAVTLVSAHPQMVFFRDIGLGRQDLTPQNSTLLLRIKSAVRLDLTQKSSFLDGH*
Ga0118733_10004726013300010430Marine SedimentMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFL
Ga0118733_10005483213300010430Marine SedimentDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDGH*
Ga0118733_10020467113300010430Marine SedimentVVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLD
Ga0118733_10036062833300010430Marine SedimentVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDEH*
Ga0118733_10037816843300010430Marine SedimentMVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQ
Ga0118733_10064972443300010430Marine SedimentFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKPSFLDGH*
Ga0164315_10001995123300013099Marine SedimentFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGHYL*
Ga0164315_1001735913300013099Marine SedimentMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDIT*
Ga0164315_1002730413300013099Marine SedimentMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKPSFLDGH*
Ga0164315_1003114813300013099Marine SedimentQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLNGH*
Ga0164315_1005960413300013099Marine SedimentMLRSSLFCAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH
Ga0164315_1011062533300013099Marine SedimentMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKS
Ga0164315_1139735413300013099Marine SedimentVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKTSFLDGHYLIA*
Ga0164313_1000531943300013101Marine SedimentMVFFRDIGVGHHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDRHYLA*
Ga0164313_1003452043300013101Marine SedimentFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH*
Ga0164313_1005421613300013101Marine SedimentMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSF
Ga0164313_1047608933300013101Marine SedimentRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH*
Ga0164313_1047876523300013101Marine SedimentAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLNGH*
Ga0164313_1074341733300013101Marine SedimentPQMVFFRDIGVGRHDLNPQNSTLFLRVKSGARLDLTQKSSFLDGH*
Ga0171655_100419613300013119MarineMVFFRDIGVGRHDLTPQNRTLFLRVKSGLLLDLTKKSLFLE
Ga0164310_1035983413300014913Marine SedimentTSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH*
Ga0164311_1003331013300014914Marine SedimentRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGHYL*
Ga0164311_1003850633300014914Marine SedimentMVFFRDIGVGHHDLIPQNSTLLLRIKSVVRLDLTQKSSFLDGH*
Ga0164311_1009183913300014914Marine SedimentDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH*
Ga0164311_1020850813300014914Marine SedimentPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLELTKKSSFLEGH*
Ga0164311_1036859533300014914Marine SedimentFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGQ*
Ga0180436_1025844213300017990Hypersaline Lake SedimentMVFLRDFGVGRHDLTPQNSPLFLRVKSVVRLELTQKS
Ga0180435_1041274713300017992Hypersaline Lake SedimentFRVGGVGCHDLNPRNSELFLRFKSGIRLAHTKKSSFLDGH
Ga0180435_1062767213300017992Hypersaline Lake SedimentMALLRDFGVGRHDLNPQNSPLFLRVKSAARLACSEPV
Ga0210341_154689313300021337EstuarineMVFFRDIGVGRQDLTPQNSTLLLRVKSVVRLDLTQKPSFLGGHYLVNK
Ga0210335_163892023300021346EstuarineMVFFRDIGVGRQDLTPQNSTLLLRVKSVVRLDLTQKSSFLGGHYLVN
Ga0190343_102065013300021496Hydrothermal Vent Microbial MatMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQK
Ga0190343_102261213300021496Hydrothermal Vent Microbial MatMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH
Ga0190358_112089213300021506Hydrothermal Vent Microbial MatMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLD
Ga0190293_1000646123300021514Hydrothermal Vent Microbial MatHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTKKSSFLDGH
Ga0190293_100256413300021514Hydrothermal Vent Microbial MatMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGY
Ga0190293_100292223300021514Hydrothermal Vent Microbial MatMVFFRDIGVGHHDLTPQNSTLFLRVKSVVRLDLTQKSSFLDRHYLA
Ga0190293_100354633300021514Hydrothermal Vent Microbial MatMVFFRDIGVGHHDLIPQNSTLLLRIKSVVRLDLTQKSSFLDGH
Ga0190293_102341813300021514Hydrothermal Vent Microbial MatMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSF
Ga0210374_107006513300022391EstuarineMVFFRDIGVGRQDLTPQNSTLLLRVKSVVRLDLTQKSSFL
(restricted) Ga0233404_1003092833300022913SeawaterNSAHPQIVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH
(restricted) Ga0233409_1026525813300022938SeawaterFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH
(restricted) Ga0233409_1036295813300022938SeawaterDIGVGHHDLTPQNSTLLLRIKSVVRLDLSKKSSFLDGH
(restricted) Ga0233408_1013305713300023089SeawaterQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLT
(restricted) Ga0233412_1026761913300023210SeawaterMVFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQK
(restricted) Ga0233410_1008815913300023276SeawaterFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGHYLTKRLTA
Ga0209344_1009020913300027834MarineVKMVVSAHPQMVFFRDIGVRRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGQ
Ga0209344_1017751623300027834MarineWLNSAHPQMVFFRDIGVGRQDLTPQNSTLLLRVKSVVRLDLT
Ga0209344_1037737013300027834MarineMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQ
Ga0209344_1042955513300027834MarineMGSLDSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFL
Ga0209345_1054398313300027852MarineMVFSRDIGVGRHDLTPQNSTLLLRVKSVARLDLTQKSSFLD
Ga0209345_1080767913300027852MarineVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTEKSSFLDGHQLRFLVHDSAIDNG
Ga0209013_1001803013300027858MarineVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLTQKSSFLDGH
Ga0209013_1005070613300027858MarineMLRGSLFCAHPQMVFFRDICVGRHDLTPQNSTLLLRVKSVVRLDLT
Ga0209013_1005950213300027858MarineGSLFCAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKFVVRLDLTQKSSFLGGH
(restricted) Ga0233414_1060843823300028045SeawaterMVFFRDIGVGRHDLTPQNSTLLLRVESVVRLDLTSKS
Ga0316201_1162364523300032136Worm BurrowMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSF
Ga0316191_1044742623300032258Worm BurrowMLNSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSFLDGHYYGGNQ
Ga0316192_1021416913300032260Worm BurrowSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSAVRLDLTQKSSFLDGHYYGGNQ
Ga0316192_1075871323300032260Worm BurrowSRPAGVGRHDLTPQNSALFLRVKSDARLVRTQKSLFLDGHELMKLDADS
Ga0316192_1084661713300032260Worm BurrowMVFFRDIGVGRQDLTPQNSTLLLRVKSVVRLDLTQKSS
Ga0316194_1072046613300032262SedimentMVFSRPAGVERHDLIPQNSTLFLRVKSTARLGRTQKSLFL
Ga0316194_1098103523300032262SedimentQAFPVEVLFSAHPQMVFFRDIGVGRHDLTPQNSTLLLRVKSVVRLDLT
Ga0316195_1000867023300032263SedimentMVFLLDSGVGCHDLTPQNSRLFLRVKSVTRLGLEQKSSFLDSFYLEV
Ga0316188_1009433313300032276Worm BurrowMVFLRDFCVGRHDLTPQNSLLFLRVKSDTRLELTQKSSFLDEHSIKPIHK
Ga0316193_1080073513300033429SedimentFFRDIGVGRHDLTPQNSSLLLRVKSVVRLDLTQKSSFLDGH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.