NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F073620

Metagenome / Metatranscriptome Family F073620

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F073620
Family Type Metagenome / Metatranscriptome
Number of Sequences 120
Average Sequence Length 41 residues
Representative Sequence MKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLES
Number of Associated Samples 100
Number of Associated Scaffolds 120

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.17 %
% of genes near scaffold ends (potentially truncated) 90.00 %
% of genes from short scaffolds (< 2000 bps) 90.83 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(21.667 % of family members)
Environment Ontology (ENVO) Unclassified
(33.333 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.833 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 35.82%    β-sheet: 2.99%    Coil/Unstructured: 61.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 120 Family Scaffolds
PF03358FMN_red 6.67
PF05368NmrA 5.00
PF08281Sigma70_r4_2 5.00
PF00106adh_short 3.33
PF13561adh_short_C2 2.50
PF02566OsmC 2.50
PF13564DoxX_2 1.67
PF02954HTH_8 1.67
PF00248Aldo_ket_red 1.67
PF14534DUF4440 1.67
PF02678Pirin 1.67
PF02738MoCoBD_1 1.67
PF01047MarR 1.67
PF00107ADH_zinc_N 0.83
PF00440TetR_N 0.83
PF13602ADH_zinc_N_2 0.83
PF14552Tautomerase_2 0.83
PF06537DHOR 0.83
PF12852Cupin_6 0.83
PF13185GAF_2 0.83
PF13460NAD_binding_10 0.83
PF01638HxlR 0.83
PF08240ADH_N 0.83
PF06779MFS_4 0.83
PF10604Polyketide_cyc2 0.83
PF02515CoA_transf_3 0.83
PF01197Ribosomal_L31 0.83
PF00561Abhydrolase_1 0.83

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 120 Family Scaffolds
COG1764Organic hydroperoxide reductase OsmC/OhrADefense mechanisms [V] 2.50
COG1765Uncharacterized OsmC-related proteinGeneral function prediction only [R] 2.50
COG1741Redox-sensitive bicupin YhaK, pirin superfamilyGeneral function prediction only [R] 1.67
COG0254Ribosomal protein L31Translation, ribosomal structure and biogenesis [J] 0.83
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.83
COG1804Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferasesLipid transport and metabolism [I] 0.83
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.83


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.67 %
UnclassifiedrootN/A8.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_100397414All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales617Open in IMG/M
3300000955|JGI1027J12803_103999553All Organisms → cellular organisms → Bacteria → Proteobacteria2867Open in IMG/M
3300000955|JGI1027J12803_109270839All Organisms → cellular organisms → Bacteria → Acidobacteria583Open in IMG/M
3300001082|JGI12664J13189_1008894All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola621Open in IMG/M
3300001867|JGI12627J18819_10413802All Organisms → cellular organisms → Bacteria → Proteobacteria549Open in IMG/M
3300002910|JGI25615J43890_1004186All Organisms → cellular organisms → Bacteria2173Open in IMG/M
3300002912|JGI25386J43895_10094310All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300004480|Ga0062592_100856860All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia813Open in IMG/M
3300005330|Ga0070690_100812068All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae726Open in IMG/M
3300005347|Ga0070668_101456901Not Available625Open in IMG/M
3300005434|Ga0070709_10802733All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300005538|Ga0070731_10144887All Organisms → cellular organisms → Bacteria1575Open in IMG/M
3300005538|Ga0070731_10564707All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005541|Ga0070733_10716884All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005586|Ga0066691_10825573All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300005591|Ga0070761_10919082All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300005843|Ga0068860_100607939All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300005921|Ga0070766_11234100All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300006028|Ga0070717_11482341All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300006358|Ga0068871_100565536All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300006797|Ga0066659_11206883All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria632Open in IMG/M
3300006844|Ga0075428_101440083All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria722Open in IMG/M
3300006847|Ga0075431_101589928Not Available611Open in IMG/M
3300006893|Ga0073928_10072368All Organisms → cellular organisms → Bacteria → Proteobacteria2987Open in IMG/M
3300006969|Ga0075419_11238053All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. LAMO17WK12:I5552Open in IMG/M
3300007255|Ga0099791_10198752All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300009038|Ga0099829_10586692All Organisms → cellular organisms → Bacteria926Open in IMG/M
3300009094|Ga0111539_12443966All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300009147|Ga0114129_11018238All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300009156|Ga0111538_10153030All Organisms → cellular organisms → Bacteria2930Open in IMG/M
3300009156|Ga0111538_11459996All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300009162|Ga0075423_12995721All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium517Open in IMG/M
3300009645|Ga0116106_1267222All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola544Open in IMG/M
3300010046|Ga0126384_10768872All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium860Open in IMG/M
3300010134|Ga0127484_1069086All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300010304|Ga0134088_10401492All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium668Open in IMG/M
3300010400|Ga0134122_11155105All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae771Open in IMG/M
3300011270|Ga0137391_10456802All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300011271|Ga0137393_11075557All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300012198|Ga0137364_11071762Not Available607Open in IMG/M
3300012202|Ga0137363_11054031All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300012203|Ga0137399_11539710All Organisms → cellular organisms → Bacteria → Proteobacteria552Open in IMG/M
3300012203|Ga0137399_11747324All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium510Open in IMG/M
3300012205|Ga0137362_10773222All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300012206|Ga0137380_10278546All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1502Open in IMG/M
3300012207|Ga0137381_11464117Not Available575Open in IMG/M
3300012211|Ga0137377_10386915Not Available1336Open in IMG/M
3300012212|Ga0150985_121854802All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia616Open in IMG/M
3300012351|Ga0137386_10901185Not Available633Open in IMG/M
3300012685|Ga0137397_10334368All Organisms → cellular organisms → Bacteria1129Open in IMG/M
3300012917|Ga0137395_10885633All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300012922|Ga0137394_10473576All Organisms → cellular organisms → Bacteria → Proteobacteria1065Open in IMG/M
3300012930|Ga0137407_10099041All Organisms → cellular organisms → Bacteria2494Open in IMG/M
3300012930|Ga0137407_10482592All Organisms → cellular organisms → Bacteria → Acidobacteria1156Open in IMG/M
3300012930|Ga0137407_12268927All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium519Open in IMG/M
3300012944|Ga0137410_10198020All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1554Open in IMG/M
3300012944|Ga0137410_10296433All Organisms → cellular organisms → Bacteria1280Open in IMG/M
3300012944|Ga0137410_11038465All Organisms → cellular organisms → Bacteria → Proteobacteria699Open in IMG/M
3300013100|Ga0157373_11442060All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Collimonas → unclassified Collimonas → Collimonas sp. OK412524Open in IMG/M
3300014168|Ga0181534_10017933All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales3606Open in IMG/M
3300017792|Ga0163161_12006973All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300018013|Ga0187873_1135033All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300018034|Ga0187863_10265208All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300018044|Ga0187890_10225305All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300018052|Ga0184638_1245832All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium617Open in IMG/M
3300018429|Ga0190272_12260168All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300020034|Ga0193753_10001814All Organisms → cellular organisms → Bacteria17706Open in IMG/M
3300020061|Ga0193716_1066403All Organisms → cellular organisms → Bacteria1634Open in IMG/M
3300020170|Ga0179594_10007150All Organisms → cellular organisms → Bacteria2948Open in IMG/M
3300020581|Ga0210399_10009911All Organisms → cellular organisms → Bacteria7450Open in IMG/M
3300020582|Ga0210395_11302833All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia solitsugae532Open in IMG/M
3300020583|Ga0210401_11612516All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300021073|Ga0210378_10214676Not Available733Open in IMG/M
3300021181|Ga0210388_11471870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola570Open in IMG/M
3300021407|Ga0210383_10745637All Organisms → cellular organisms → Bacteria840Open in IMG/M
3300021420|Ga0210394_10878052All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300021432|Ga0210384_11615397All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola554Open in IMG/M
3300021433|Ga0210391_10517745All Organisms → cellular organisms → Bacteria → Proteobacteria937Open in IMG/M
3300021433|Ga0210391_11443062All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300022557|Ga0212123_10399985All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300022557|Ga0212123_10567268All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300022694|Ga0222623_10349542All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300022712|Ga0242653_1003402All Organisms → cellular organisms → Bacteria1640Open in IMG/M
3300023030|Ga0224561_1004352All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300024288|Ga0179589_10377563Not Available647Open in IMG/M
3300025910|Ga0207684_10712755All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300025910|Ga0207684_11571897All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium533Open in IMG/M
3300025916|Ga0207663_10219810All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300025935|Ga0207709_10252353All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300026330|Ga0209473_1093990All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1255Open in IMG/M
3300026361|Ga0257176_1047182All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium675Open in IMG/M
3300026557|Ga0179587_10279867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1072Open in IMG/M
3300026557|Ga0179587_10766992All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300027692|Ga0209530_1175365All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300027729|Ga0209248_10033541All Organisms → cellular organisms → Bacteria1595Open in IMG/M
3300027889|Ga0209380_10104409All Organisms → cellular organisms → Bacteria1639Open in IMG/M
3300027889|Ga0209380_10454243All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300027895|Ga0209624_10738580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola648Open in IMG/M
3300027895|Ga0209624_10764379All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae636Open in IMG/M
3300028047|Ga0209526_10045196All Organisms → cellular organisms → Bacteria → Proteobacteria3098Open in IMG/M
3300028381|Ga0268264_11015811All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae836Open in IMG/M
3300028906|Ga0308309_10237436All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300030760|Ga0265762_1004813All Organisms → cellular organisms → Bacteria2416Open in IMG/M
3300030760|Ga0265762_1018348All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300030813|Ga0265750_1079519All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola544Open in IMG/M
3300031234|Ga0302325_12471091All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola621Open in IMG/M
3300031525|Ga0302326_12000721All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola749Open in IMG/M
3300031715|Ga0307476_10147749All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia phenazinium1686Open in IMG/M
3300031715|Ga0307476_10647638All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300031718|Ga0307474_10801034All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola745Open in IMG/M
3300031740|Ga0307468_100592086All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium903Open in IMG/M
3300031740|Ga0307468_101074937Not Available715Open in IMG/M
3300031740|Ga0307468_101462623All Organisms → cellular organisms → Bacteria → Proteobacteria631Open in IMG/M
3300031754|Ga0307475_10922186All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300031820|Ga0307473_10612847All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae753Open in IMG/M
3300031823|Ga0307478_10731817All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae828Open in IMG/M
3300031852|Ga0307410_10940318All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300031962|Ga0307479_11364732Not Available668Open in IMG/M
3300031962|Ga0307479_11781406All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae568Open in IMG/M
3300032180|Ga0307471_100492244All Organisms → cellular organisms → Bacteria → Proteobacteria1373Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil21.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil10.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.17%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.17%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.50%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.50%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.67%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.67%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.67%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.83%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.83%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.83%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.83%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.83%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.83%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.83%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.83%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.83%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.83%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001082Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300002910Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cmEnvironmentalOpen in IMG/M
3300002912Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cmEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010134Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023030Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026361Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-BEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10039741423300000955SoilMKNARGLLEEFTAASFRDPKEAAAMFTEDGAFEMPYLE
JGI1027J12803_10399955313300000955SoilMSMKNAKELMLEFTASSFRDPQKAAEMFAEDGAFEMPYLASFGVPSEYK
JGI1027J12803_10927083913300000955SoilMKNARQLLEEFIATSFRHPKQAASMFTTDGTFEMPYLED
JGI12664J13189_100889413300001082Forest SoilMKNAKELMLEYTAYSFRDPKKAAEMFAENGAFELP
JGI12627J18819_1041380213300001867Forest SoilMKNARQLLEEFIATSFRDPKQAASMFTADVTFEMPYLENLGFRPVDR
JGI25615J43890_100418623300002910Grasslands SoilMKNARQLLEEFIATSFRDPKQAASMFTADGTFEMPYLEDLGLQPIYRG*
JGI25386J43895_1009431023300002912Grasslands SoilMKNAKELLEEFTAASFRDPKKAAEMFAEDGAFEMPYLESL
Ga0062592_10085686023300004480SoilMKNAKELLLEFTAFSLRDLEKAAAMFGEEGAFEMPYLEGLGVQGR*
Ga0070690_10081206813300005330Switchgrass RhizosphereMKNAKELLEEYTATSFRDPKKAAEMFSEDGAFEMPYLESFGMP
Ga0070668_10145690113300005347Switchgrass RhizosphereMKSARELLEEFTAASFRDPKKAAEMFTEHGAFEMPYLESLGV
Ga0070709_1080273323300005434Corn, Switchgrass And Miscanthus RhizosphereMKNAKELMLEYTAFSFRDPKKAAEMFAEDGAFELPYLATF
Ga0070731_1014488733300005538Surface SoilMKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPYLATF
Ga0070731_1056470723300005538Surface SoilMKNARELMLEYTAFSFRDPKKAAEMFAEDGAFELPYLATF
Ga0070733_1071688413300005541Surface SoilMKNAKELMIEYTAFSLREPKKAAEMFAEDGAFELPYLA
Ga0066691_1082557313300005586SoilMSRKNAKELMLEFIAFSFRDTKKAAEMFAEDGAFEM
Ga0070761_1091908223300005591SoilMKNARELMLEYTAFSLRDPKKAAEMFAEDGAFELPYLA
Ga0068860_10060793933300005843Switchgrass RhizosphereMKNARELLEEFTGTSFRDPRKAAEMFAEDGAFEMP
Ga0070766_1123410023300005921SoilMKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPYLATFG
Ga0070717_1148234123300006028Corn, Switchgrass And Miscanthus RhizosphereMKNAKELMLGYTAFSFREPKKAAEMFAEDGAFELPYLATFG
Ga0068871_10056553613300006358Miscanthus RhizosphereMKNAKELMLEYTAFSFREPKKAAEMFADDGAFELPYLATFGL
Ga0066659_1120688313300006797SoilMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLESVGVP
Ga0075428_10144008313300006844Populus RhizosphereMKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFG
Ga0075431_10158992813300006847Populus RhizosphereMKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFGLPGRYE
Ga0073928_1007236843300006893Iron-Sulfur Acid SpringMKKAKELLLEFTALAMRDAEKTADMFTEDGAFEMPYLATFG*
Ga0075419_1123805313300006969Populus RhizosphereMKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFGIPG
Ga0099791_1019875223300007255Vadose Zone SoilMKTAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFGLPGRYEG
Ga0099829_1058669223300009038Vadose Zone SoilMARNRRIAMKNAKELMLEYTAFSIRDPKKAAEMFAEDGAFEM
Ga0111539_1244396623300009094Populus RhizosphereMKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFGIPGRY
Ga0114129_1101823833300009147Populus RhizosphereMKNAKELLEEFTAASFRDPKKAAEMFSEDGAFEMPYLESFGIPGRYE
Ga0111538_1015303013300009156Populus RhizosphereMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLESFGLPGRYEGR
Ga0111538_1145999613300009156Populus RhizosphereMKNAKELLEEFTAASFRDPKEAAEMFTEDGAFEMPYLESLG
Ga0075423_1299572123300009162Populus RhizosphereMKNARELLEEFTATSFRDPKKAAEMFADDGAFEMPYLESLGVPG
Ga0116106_126722223300009645PeatlandMVRNRRISMKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELP
Ga0126384_1076887223300010046Tropical Forest SoilLKNARQLLEEFTASSFRDTKKSSEMFAEDGAFEMPY
Ga0127484_106908613300010134Grasslands SoilMKNAKELLEEFTAASFRDPKKAAEMFSEDGAFEMPYLESVGVPGRYEGREA
Ga0134088_1040149213300010304Grasslands SoilMKSAKELLEEFTAASFRDPKKAAQMFTKDGAFEMPYLESLGVP
Ga0134122_1115510513300010400Terrestrial SoilMKNARELLEEFTASSFRDPKKAAEMFAEDGAFEMPY
Ga0137391_1045680223300011270Vadose Zone SoilMKKAKELMLEFTALAIRDPQKTAEMFTKDGAFEMPYLAAFGYPTQYKGHEA
Ga0137393_1107555713300011271Vadose Zone SoilMKNARELLEEFTAASFRDPKKAAEMFTDDGAFEMP
Ga0137364_1107176213300012198Vadose Zone SoilMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMP*
Ga0137363_1105403113300012202Vadose Zone SoilMVRNRRRSMKNAKELMLEYTAFSLRDPKKAAEMFVEDGAFE
Ga0137399_1153971023300012203Vadose Zone SoilMKNAKELLEEFTAASFRDPKKAAEMFSEDGAFEMPYLESFG
Ga0137399_1174732413300012203Vadose Zone SoilMEEGSHMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLE
Ga0137362_1077322213300012205Vadose Zone SoilMKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLESFGLPGRYEGREAIEG
Ga0137380_1027854613300012206Vadose Zone SoilMSMKNAKELMLEFTASSFKDPKQAAEMFAEDGAFEMPYLATF
Ga0137381_1146411713300012207Vadose Zone SoilMKNAKELLEEFTAASFRDPKKAAEMFTDDGAFEMPYLESFGIPGR
Ga0137377_1038691513300012211Vadose Zone SoilMKNARLLLEEFIATSFRDPKQAASMFTAGGTFEIPYLE
Ga0150985_12185480213300012212Avena Fatua RhizosphereMKNARELLEEFTAASFRDPKKAAEMFTEGGAFEMPYLESVGLPGRKK
Ga0137386_1090118513300012351Vadose Zone SoilMKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYLE
Ga0137397_1033436833300012685Vadose Zone SoilMKNAKELLEEFTAASFRDPKKSAEMFTEDGAFEMPYLESFGFPGRYEG
Ga0137395_1088563313300012917Vadose Zone SoilMKTAKELLEEFTAASFRDPKKAAEMFSEDGAFEMPYLESVGVPGRYQGRDAIEG
Ga0137394_1047357633300012922Vadose Zone SoilMKNAKELLEEFAAASFRDPKKAAEMFSEDGAFEMPYLESF
Ga0137407_1009904113300012930Vadose Zone SoilMKNAKELLEEFTAASFRDPKKAAKMFTDDGAFEMPY
Ga0137407_1048259233300012930Vadose Zone SoilMVRNRRVSMKNTKELMLEYTAFSFRDPKTAAEMFAEDGAF
Ga0137407_1226892713300012930Vadose Zone SoilMKNARELLEEFTATSFRDPKKAAEMFTEDGAFEMPYLESLGVP
Ga0137410_1019802013300012944Vadose Zone SoilMKNAKELLEEFAAASFRDPKKAAEMFSEDGAFEMPYLESFGLPGRYE
Ga0137410_1029643323300012944Vadose Zone SoilMKNARELLEEFTASSFRDPKKAAEMFAEDGAFEIPYLESVGVPGRY
Ga0137410_1103846533300012944Vadose Zone SoilMKNAKELLEEFTAASFRDPKKAAEMFSEDGAFEMPYLESFGLPGRYE
Ga0157373_1144206013300013100Corn RhizosphereMKNAKELMLEFTASSFRNPQKAAEMFAEDGAFEMPYLAS
Ga0181534_1001793363300014168BogMKNARQLLEEFTAGSFRDPQQAAAMFAEDGVLEMP*
Ga0163161_1200697313300017792Switchgrass RhizosphereMKGSQMKNAKELLEEFTAASFRDPKQAAEMFTEDGAFEMPYLESFGIPGRY
Ga0187873_113503313300018013PeatlandMKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPYLST
Ga0187863_1026520813300018034PeatlandMKNAKELMLEYTAYSFRDPKKAAEMFAENGAFELPYLAT
Ga0187890_1022530523300018044PeatlandMKNAKELMLEYTALSFKDPKRAAEMFTEDGAFEMPYLAALGL
Ga0184638_124583223300018052Groundwater SedimentMKNAKELLEEFTAASFRDPKKAAEMFADDGAFEMPYLES
Ga0190272_1226016823300018429SoilMKGSHMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEIPYLESVG
Ga0193753_1000181413300020034SoilMKNAKELMLEYTAFSFRDPKKAAEMFTEDGAFEMPYLATFG
Ga0193716_106640333300020061SoilMKNAKELMLEYTAFSFRDPKKAAEMFTEDGAFEMSYLATF
Ga0179594_1000715013300020170Vadose Zone SoilMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPY
Ga0210399_10009911123300020581SoilMKNAKELMLEFTASSFRDPQKAAEMFAEDGAFEMPY
Ga0210395_1130283323300020582SoilMKNAKELTLECTAFSFRDPKKAAEMFAEDGAFELPYLATWGDPLR
Ga0210401_1161251623300020583SoilMKNAKELMLEYTAFSFRDPKKAAEMFAEDGAFELPYRATFGLPTEYR
Ga0210378_1021467623300021073Groundwater SedimentMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLESFG
Ga0210388_1147187013300021181SoilMKNARELMLEYTAFSFREPKKAAEMFAEDGAFELPYLATFGL
Ga0210383_1074563713300021407SoilMKNAKELMLEYTAFSFREPKKAVAMFAEDGAFELPYLATFG
Ga0210394_1087805223300021420SoilMKNAKELMLEYTAFSFRDPKKAAEMFTADGAFEMPYLASFGLPP
Ga0210384_1161539713300021432SoilMKNAKELMLEYTAYSFRDPKKAAEMFAEDGAFELPYL
Ga0210391_1051774533300021433SoilMKNAKELMLEYTAFSFRDPKKAAEMFAEDGAFELPYLA
Ga0210391_1144306223300021433SoilMKNAKELMLEYTVFSFRDPKKAAEMFAEDGAFELPYLATFEIG
Ga0212123_1039998523300022557Iron-Sulfur Acid SpringMKNARQLLEEFIATSFRDPKQAASMFTADGTFEMPYLEDLGFQPIYR
Ga0212123_1056726823300022557Iron-Sulfur Acid SpringMKKAKELLLEFTALAMRDAEKTADMFTEDGAFEMPYLAT
Ga0222623_1034954213300022694Groundwater SedimentMKNAKELLEEFTAASFRDPKQAAEMFTDDGAFEMPYL
Ga0242653_100340233300022712SoilMKNAKELMLEYTASSIRDPKKAAEMFAEDGAFEMPYLTTFGI
Ga0224561_100435213300023030SoilMKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPYLAT
Ga0179589_1037756323300024288Vadose Zone SoilMKNARQLLEEFIATSFRDPKQAASMFTADGTFEMPYLEDLGLQPIYRG
Ga0207684_1071275523300025910Corn, Switchgrass And Miscanthus RhizosphereMKNARQLLEEFIATSFRDPKQAASMFTADGTFEMADLED
Ga0207684_1157189723300025910Corn, Switchgrass And Miscanthus RhizosphereMKNARELLEEFTSASFRDPKKAAEMFTEDGAFEMPYLESLDVPGRY
Ga0207663_1021981033300025916Corn, Switchgrass And Miscanthus RhizosphereMKNAKELMLEYTGFSLRDPKKAAEMFAEDGAFELPYLAT
Ga0207709_1025235343300025935Miscanthus RhizosphereMKNAKELLEEFTAASFRDPKEAAEMFTEDGAFEMPYL
Ga0209473_109399013300026330SoilMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLES
Ga0257176_104718213300026361SoilMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYL
Ga0179587_1027986723300026557Vadose Zone SoilMKNARELLEEFTASSFRDPKKAAEMFAEDGAFEMPYLESV
Ga0179587_1076699223300026557Vadose Zone SoilMKSAKELLEEFTASSFRDPRKAAEMVIEDGAFEMPYLESFGIPGRYERS
Ga0209530_117536513300027692Forest SoilMKTAKELMLEYTAYSFRDPKKAAEMFAEDGAFEMP
Ga0209248_1003354133300027729Bog Forest SoilMKNAKELMLEYTAFSFKDPKTAAEMFAEDGAFELPYLAT
Ga0209380_1010440913300027889SoilMKNAKELMLEYTAFSFRDPKKAAEMFGEDGAFELPYLATF
Ga0209380_1045424323300027889SoilMKNAKELMLEYTAFSFRDPKKAAEMFTEDGAFEMPYLASFGLPPR
Ga0209624_1073858013300027895Forest SoilMKNAKELMLEYTAFSFGNPKKAAEMFAEDGAFELPY
Ga0209624_1076437933300027895Forest SoilMKKAKELLLEFTALAMRDAEKTADMFTEDGAFEMPI
Ga0209526_1004519633300028047Forest SoilMKNARQLLEEFIATSFRDAKQAASMFTADGTFEMPYL
Ga0268264_1101581113300028381Switchgrass RhizosphereMKNARELLEEFTGTSFRDPRKAAEMFAEDGAFEMPYLE
Ga0308309_1023743633300028906SoilMKNAKELMLEYTAYSFRDPKKAAEMFAEDGAFELPYLAT
Ga0265762_100481363300030760SoilLEYTAFSFRDLKKAAEMFAEDGAFELPYLATFGLPTQYRG
Ga0265762_101834833300030760SoilMKNAKELMLEYSAFSFRDPKKAAEMFAEDGAFELPYLATF
Ga0265750_107951923300030813SoilMKNAKELMLEYSAFSFRDPKKAAEMFAEDGAFELPYLATFG
Ga0302325_1247109123300031234PalsaMKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPYL
Ga0302326_1200072113300031525PalsaMKNAKELMLEYTAFSFREPKKAAEMFAEDGAFELPY
Ga0307476_1014774933300031715Hardwood Forest SoilMKNAKELMLEYTAFSFRDPKKAAEMFAEDGAFELPYLATFG
Ga0307476_1064763823300031715Hardwood Forest SoilVKKAKELMLEFTALAIKDPQKTAEMFTEDGAFEMPYLAAFGYPTQYK
Ga0307474_1080103413300031718Hardwood Forest SoilMKNARELMIEYTAFSLRDPKKAAEMFAEDGAFELPYLATFG
Ga0307468_10059208613300031740Hardwood Forest SoilMKTARELREEFTAASFRDPRKAAEMFTEHGAFEMPYL
Ga0307468_10107493723300031740Hardwood Forest SoilMKNARALLEEFTAASFRDPKKAAEMFTEDGAFEMPYL
Ga0307468_10146262313300031740Hardwood Forest SoilMKNAKELLEEFTAASFRDPKKAAEMFTEDGAFEMPYLESFGSPGRYEG
Ga0307475_1092218643300031754Hardwood Forest SoilMTNARHILEEFTASLFVDPKKAAKCLLQDGAFEMPYLD
Ga0307473_1061284723300031820Hardwood Forest SoilMKDARVLLEEFTAASFRDPKKAAEMFSEDGAFEMPY
Ga0307478_1073181733300031823Hardwood Forest SoilMKNAKELMLEYTAYSFRDPKKAAEMFAEDGAFELPYLATF
Ga0307410_1094031813300031852RhizosphereMKNAKELLEEFTAASFRDPKQAAEMFTEDGAFEMPYLESFG
Ga0307479_1136473213300031962Hardwood Forest SoilMTNARQILEEFTASSFLDPKKAAKCLLQDGAFEMPYLDSLRFPWRYGNN
Ga0307479_1178140613300031962Hardwood Forest SoilVKKAKELMLEFTALAIKDPQKTAEMFTEDGAFEMPYLAAFGYPTQYKGQEA
Ga0307471_10049224423300032180Hardwood Forest SoilMKNAKDLLEEFTASSFRDPKKAAEMFTEDGAFEMPYLESFGFPGRYAGREA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.