Basic Information | |
---|---|
Family ID | F073823 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 40 residues |
Representative Sequence | YVRTLDEVLEHALQKEAVAPPIVPQPEPKQKRVGPDSPRAIH |
Number of Associated Samples | 99 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.50 % |
% of genes near scaffold ends (potentially truncated) | 95.83 % |
% of genes from short scaffolds (< 2000 bps) | 84.17 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.167 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.500 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 0.00% Coil/Unstructured: 85.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF01906 | YbjQ_1 | 9.17 |
PF05362 | Lon_C | 3.33 |
PF00069 | Pkinase | 3.33 |
PF13506 | Glyco_transf_21 | 2.50 |
PF16491 | Peptidase_M48_N | 1.67 |
PF02777 | Sod_Fe_C | 1.67 |
PF13302 | Acetyltransf_3 | 0.83 |
PF07228 | SpoIIE | 0.83 |
PF13632 | Glyco_trans_2_3 | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 13.33 |
COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 9.17 |
COG0466 | ATP-dependent Lon protease, bacterial type | Posttranslational modification, protein turnover, chaperones [O] | 3.33 |
COG1067 | Predicted ATP-dependent protease | Posttranslational modification, protein turnover, chaperones [O] | 3.33 |
COG1750 | Predicted archaeal serine protease, S18 family | General function prediction only [R] | 3.33 |
COG3480 | Predicted secreted protein YlbL, contains PDZ domain | Signal transduction mechanisms [T] | 3.33 |
COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.17 % |
Unclassified | root | N/A | 0.83 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001137|JGI12637J13337_1004788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1128 | Open in IMG/M |
3300001162|JGI12714J13572_1001146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1246 | Open in IMG/M |
3300001593|JGI12635J15846_10584585 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300002912|JGI25386J43895_10193009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
3300004597|Ga0068947_1246615 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300005167|Ga0066672_10936637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300005171|Ga0066677_10785519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
3300005439|Ga0070711_101841188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
3300005454|Ga0066687_10189510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1115 | Open in IMG/M |
3300005552|Ga0066701_10475340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300005557|Ga0066704_10762522 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300005568|Ga0066703_10155967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1373 | Open in IMG/M |
3300005586|Ga0066691_10093532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1680 | Open in IMG/M |
3300005586|Ga0066691_10586952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
3300005591|Ga0070761_10661438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300005598|Ga0066706_10141234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1801 | Open in IMG/M |
3300006031|Ga0066651_10128868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1307 | Open in IMG/M |
3300006050|Ga0075028_100414192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
3300006176|Ga0070765_100046330 | All Organisms → cellular organisms → Bacteria | 3518 | Open in IMG/M |
3300006176|Ga0070765_100088265 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2650 | Open in IMG/M |
3300006755|Ga0079222_11751106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
3300006796|Ga0066665_10070378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2483 | Open in IMG/M |
3300007265|Ga0099794_10010761 | All Organisms → cellular organisms → Bacteria | 3893 | Open in IMG/M |
3300007265|Ga0099794_10092257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1504 | Open in IMG/M |
3300009088|Ga0099830_10814598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300009143|Ga0099792_10896509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300010046|Ga0126384_10395540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1165 | Open in IMG/M |
3300010321|Ga0134067_10000301 | All Organisms → cellular organisms → Bacteria | 8513 | Open in IMG/M |
3300010358|Ga0126370_12265554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300010362|Ga0126377_11768710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300010366|Ga0126379_11468822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
3300010376|Ga0126381_102830849 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300010858|Ga0126345_1276480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
3300011047|Ga0138553_102743 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300011049|Ga0138554_135646 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
3300011269|Ga0137392_10083871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2478 | Open in IMG/M |
3300011269|Ga0137392_10318011 | All Organisms → cellular organisms → Bacteria | 1288 | Open in IMG/M |
3300011269|Ga0137392_10357156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
3300011269|Ga0137392_10505280 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1004 | Open in IMG/M |
3300011269|Ga0137392_10646991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
3300011271|Ga0137393_10013629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5734 | Open in IMG/M |
3300011271|Ga0137393_10052698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3191 | Open in IMG/M |
3300011271|Ga0137393_10284061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1408 | Open in IMG/M |
3300011271|Ga0137393_11079270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
3300012096|Ga0137389_11129536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
3300012202|Ga0137363_10793685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
3300012203|Ga0137399_10502945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
3300012349|Ga0137387_10074307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2324 | Open in IMG/M |
3300012582|Ga0137358_10022545 | All Organisms → cellular organisms → Bacteria | 4069 | Open in IMG/M |
3300012582|Ga0137358_10884939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300012683|Ga0137398_11167146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
3300012917|Ga0137395_10433234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
3300012923|Ga0137359_11007048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
3300012925|Ga0137419_11933057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300012927|Ga0137416_11703066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300012927|Ga0137416_11976027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
3300012929|Ga0137404_10576888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
3300012929|Ga0137404_10810802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
3300013832|Ga0120132_1065509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
3300014150|Ga0134081_10290023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300014154|Ga0134075_10046800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1781 | Open in IMG/M |
3300015052|Ga0137411_1220100 | All Organisms → cellular organisms → Bacteria | 2844 | Open in IMG/M |
3300015052|Ga0137411_1221281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
3300015054|Ga0137420_1324686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6021 | Open in IMG/M |
3300015264|Ga0137403_11513674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300015358|Ga0134089_10196383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
3300018482|Ga0066669_10123962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1847 | Open in IMG/M |
3300019877|Ga0193722_1004617 | All Organisms → cellular organisms → Bacteria | 3422 | Open in IMG/M |
3300020580|Ga0210403_10345141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
3300021086|Ga0179596_10272626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 839 | Open in IMG/M |
3300021086|Ga0179596_10562767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300021168|Ga0210406_10587406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
3300021168|Ga0210406_11268017 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300021180|Ga0210396_10811342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
3300021181|Ga0210388_10649227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 921 | Open in IMG/M |
3300021401|Ga0210393_10803786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
3300021405|Ga0210387_10838577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
3300021407|Ga0210383_11528278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
3300021420|Ga0210394_10973147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
3300021432|Ga0210384_10041673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4212 | Open in IMG/M |
3300021474|Ga0210390_10519438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
3300021475|Ga0210392_11273154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300024251|Ga0247679_1095060 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300025905|Ga0207685_10736908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300025906|Ga0207699_10808224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 689 | Open in IMG/M |
3300025906|Ga0207699_11171502 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300025917|Ga0207660_10622218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
3300026277|Ga0209350_1153686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
3300026297|Ga0209237_1185845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
3300026318|Ga0209471_1163805 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 902 | Open in IMG/M |
3300026325|Ga0209152_10039141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1641 | Open in IMG/M |
3300026527|Ga0209059_1211937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300026532|Ga0209160_1090931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1575 | Open in IMG/M |
3300026547|Ga0209156_10013950 | All Organisms → cellular organisms → Bacteria | 5073 | Open in IMG/M |
3300026548|Ga0209161_10189213 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1152 | Open in IMG/M |
3300026551|Ga0209648_10809946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
3300026557|Ga0179587_10617086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
3300027061|Ga0209729_1049488 | Not Available | 535 | Open in IMG/M |
3300027635|Ga0209625_1007160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2422 | Open in IMG/M |
3300027826|Ga0209060_10022533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3273 | Open in IMG/M |
3300027853|Ga0209274_10328926 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
3300027862|Ga0209701_10245105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1050 | Open in IMG/M |
3300027862|Ga0209701_10336040 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
3300027875|Ga0209283_10752568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
3300027882|Ga0209590_10303221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1026 | Open in IMG/M |
3300027884|Ga0209275_10293276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
3300027898|Ga0209067_10150182 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1236 | Open in IMG/M |
3300028023|Ga0265357_1020890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300030940|Ga0265740_1005914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
3300031564|Ga0318573_10035218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2369 | Open in IMG/M |
3300031681|Ga0318572_10207111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1146 | Open in IMG/M |
3300031753|Ga0307477_10589210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 750 | Open in IMG/M |
3300031754|Ga0307475_11241826 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300031962|Ga0307479_10137987 | All Organisms → cellular organisms → Bacteria | 2387 | Open in IMG/M |
3300031962|Ga0307479_12100753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300032091|Ga0318577_10092221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1411 | Open in IMG/M |
3300032180|Ga0307471_101567842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
3300032180|Ga0307471_103182368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300032180|Ga0307471_103272297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300032261|Ga0306920_103707953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.33% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.83% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.17% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.17% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.17% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.50% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.67% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.83% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.83% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.83% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
3300001162 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300004597 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 35 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010858 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011047 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 34 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011049 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 35 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013832 | Permafrost microbial communities from Nunavut, Canada - A3_5cm_0M | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Host-Associated | Open in IMG/M |
3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12637J13337_10047883 | 3300001137 | Forest Soil | TYVHNLDEVLEHALSKDAVAPPIVPHPEPKPKRVGGESPRAIH* |
JGI12714J13572_10011463 | 3300001162 | Forest Soil | EVLEHALQKEAVTPPIVPQPEPKPKRVGPDIPRAIH* |
JGI12635J15846_105845853 | 3300001593 | Forest Soil | MKIVYVHTLDEVLEHALQKEPMPPAVVPPEPKGKRVEVPRAIH* |
JGI25386J43895_101930092 | 3300002912 | Grasslands Soil | KITYVRTLDEVLEHALQKDAVAPPIVPQPEPKPKRAGPEIPRAIH* |
Ga0068947_12466152 | 3300004597 | Peatlands Soil | MKITYVRNLDEVLEHALSKEAVVPPIVPQPEPKPKRVGPESPRAIH* |
Ga0066672_109366372 | 3300005167 | Soil | YVHTLDEVLEHALQKEAVTPPIVPQPEPKQKRLGPEGPRAIH* |
Ga0066677_107855191 | 3300005171 | Soil | DIKITYVHTLDEVLEHALQKEAVTPPIIPQPEPKQKRLGPEGPRAIH* |
Ga0070711_1018411881 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RNLDEVLEHALSKNAVAPPIVPQPEPKQKRVGPESPRAIH* |
Ga0066687_101895101 | 3300005454 | Soil | KITYVHTLDEVLDHALQKEPVAQPLAPAPESKAERLGPGSPRAIH* |
Ga0066701_104753401 | 3300005552 | Soil | YVHTLDEVLDHALQKEPVAQPLAPAPESKAERLGPGSPRAIH* |
Ga0066704_107625222 | 3300005557 | Soil | RTLDEVLENALEKEPTTSAIVPPEPKGKRVEVPRAIH* |
Ga0066703_101559671 | 3300005568 | Soil | HTLDEVLDHALQKEPVAQPLAPAPESKAERLGPGSPRAIH* |
Ga0066691_100935323 | 3300005586 | Soil | TYVHTLDEVLEHALQKEAVTPPIVPQPEPKQKRLGPEGPRAIH* |
Ga0066691_105869522 | 3300005586 | Soil | IKITYVRTLDEVLEHALQKESLTPPIVPQPEPKPKRVGPESPRAIH* |
Ga0070761_106614382 | 3300005591 | Soil | EVLEHALSKEAVVPPIVPQPEPKPKRVGGESPRAIH* |
Ga0066706_101412343 | 3300005598 | Soil | LDEVLEHALQKDPVAPIIPPPEPKSKRVGPDGPRAIH* |
Ga0066651_101288685 | 3300006031 | Soil | ITYVRTLDEVLEHALQREALTPPIVPQSEPKQKRVGPEGPRAIH* |
Ga0075028_1004141922 | 3300006050 | Watersheds | KITYVRTLDEVLEHALQKEAVTPPIVPQPEPKPKRVGPDSPRAIH* |
Ga0070765_1000463301 | 3300006176 | Soil | NLDEVLEHALSKDAVAPPIVPHPEPKPKRVGGESPRAIH* |
Ga0070765_1000882653 | 3300006176 | Soil | TLDEVLEHALQKDPIASPIVPPTEPKPKRLPADGPRAIH* |
Ga0079222_117511061 | 3300006755 | Agricultural Soil | LDEVLEHALEKEPTTSAIVPPEPKGKRVEIPRAIH* |
Ga0066665_100703781 | 3300006796 | Soil | HTLDEVLEHALQKEAVTPPIVPQPEPKQKRLGPEGPRAIH* |
Ga0099794_100107617 | 3300007265 | Vadose Zone Soil | LEHALQKEPVAPPIVPQPEPKQKQVGPDGPRAIH* |
Ga0099794_100922574 | 3300007265 | Vadose Zone Soil | DEVLEHALQKEPIAPPVVPQPEPKQKRVDPNSPRAIH* |
Ga0099830_108145982 | 3300009088 | Vadose Zone Soil | YVRTLDEVLEHALQKEAVTPPIVPQPEPKPKRVGPDSPRAIH* |
Ga0099792_108965092 | 3300009143 | Vadose Zone Soil | TLDEVLEHALQKEAVTPPIVPQPEPKPKRLGPDAPRAIH* |
Ga0126384_103955401 | 3300010046 | Tropical Forest Soil | TLDEVLEHALQKEPIVPPIAPEPESKPKRLGPESPRAIH* |
Ga0134067_100003011 | 3300010321 | Grasslands Soil | DEVLEHALQKEPVAAPLAPEPETKGKRLGPESPRAIH* |
Ga0126370_122655541 | 3300010358 | Tropical Forest Soil | LEHALQKEPVATPLAPEPEPKGKRLGPESPRAIH* |
Ga0126377_117687102 | 3300010362 | Tropical Forest Soil | YVHSLDEVLEHALQKEPITPPIAPEPESKPKRLGPESPKAIH* |
Ga0126379_114688222 | 3300010366 | Tropical Forest Soil | LEHALQKEPVAAPLAPEPEPKEKRLGPESPRAIH* |
Ga0126381_1028308491 | 3300010376 | Tropical Forest Soil | TLDEVLEHALQKEPVATPLPPEPEPKTKRIGPESPRAIH* |
Ga0126345_12764801 | 3300010858 | Boreal Forest Soil | TYVRNLDEVLEHALSKEAVAPPIVPQPGPKQKPVGTESPRAIH* |
Ga0138553_1027432 | 3300011047 | Peatlands Soil | VRTLDEVLEHALQKESVTPPIVPQPEPKPKRVGPDSPRAIH* |
Ga0138554_1356461 | 3300011049 | Peatlands Soil | MKITYVRNLDEVLEHALSKEAVVPPIVPQPEPKPKRVGGESPRAIH* |
Ga0137392_100838714 | 3300011269 | Vadose Zone Soil | LEHALQKDPVTPPLAPQPEPKQKRVGPDSPRAIH* |
Ga0137392_103180113 | 3300011269 | Vadose Zone Soil | VRNLDEVLEHALSKEAVAPPVVPQPEPKQKRVGPETPRAIH* |
Ga0137392_103571563 | 3300011269 | Vadose Zone Soil | IVYVRTLDEVLEHALQKEAVAPPIVPQPEPKQKRAGPDSPRAIH* |
Ga0137392_105052801 | 3300011269 | Vadose Zone Soil | VRTLDEVLEHALQKEPIAPPIVPQPEPKQKRVDPNSPRAIH* |
Ga0137392_106469911 | 3300011269 | Vadose Zone Soil | RTLDEVLEHALEKEPVAPAIVPPEPKGKRVGPDVPRAIH* |
Ga0137393_100136291 | 3300011271 | Vadose Zone Soil | RNLDEVLEHALSKEAVAPPVVPQPEPKQKRVGPETPRAIH* |
Ga0137393_100526984 | 3300011271 | Vadose Zone Soil | DIKITYVHTLDEVLEQALSKEAVAPSIVPQPEPKQKRVGPDSPRPVH* |
Ga0137393_102840611 | 3300011271 | Vadose Zone Soil | DEVLEHALQKDPVEPAIVPPEPKGKRVEVPRAIH* |
Ga0137393_110792702 | 3300011271 | Vadose Zone Soil | ITYVRTLDEVLEHALQKEAVTPPIVPQPEPKPKRVGPESPRAIH* |
Ga0137389_111295361 | 3300012096 | Vadose Zone Soil | VRTLDEVLEHALEKEPVAPAIVPPEPKGKRVGPDVPRAIH* |
Ga0137363_107936852 | 3300012202 | Vadose Zone Soil | YVRTLDEVLEHALQKEPIAPPIVPQPEPKQKRVDPNSPRAIH* |
Ga0137399_105029453 | 3300012203 | Vadose Zone Soil | YVRTLDEVLEHALQKDPIAPPVVPQPEPKQKRVDPNSPRAIH* |
Ga0137387_100743075 | 3300012349 | Vadose Zone Soil | YVHTLDEVLDHALQKEPVAQPLAPAPESKAKRLGPESPRAIH* |
Ga0137358_100225451 | 3300012582 | Vadose Zone Soil | MKITYVRTLDEVLEHALQKDPVAPPIVPSEPKAKRLPTDGPRAIH* |
Ga0137358_108849391 | 3300012582 | Vadose Zone Soil | KITYVRTLDEVLEHALEKEPVAPAIVPPEPKGKRVEVPRAIH* |
Ga0137398_111671462 | 3300012683 | Vadose Zone Soil | EVLEHALLKEAVTPPIVPQPEPKPKRLGPDSPRAIH* |
Ga0137395_104332342 | 3300012917 | Vadose Zone Soil | DEVLEHELQKEAVTPPIVPQPEPKPKRLGPDAPRAIH* |
Ga0137359_110070481 | 3300012923 | Vadose Zone Soil | KITYVRTLDEVLEHALQKEPIAPPVVPQPEPKQKRVDPNSPRAIH* |
Ga0137419_119330571 | 3300012925 | Vadose Zone Soil | LDEVLEHALQKEPIAPPVVPQPEPKQKRVDPNSPRAIH* |
Ga0137416_117030662 | 3300012927 | Vadose Zone Soil | LDEVLEHALEKEPVAPAIVPPEPKGKRVEVPRAIH* |
Ga0137416_119760272 | 3300012927 | Vadose Zone Soil | DEVLEHALQKDPVTPPLAPQPEPKQKRVGPDSPRAIH* |
Ga0137404_105768881 | 3300012929 | Vadose Zone Soil | LDEVLEHALQKEAVTPPIVPQPEPKPKRLGPDSPRAIH* |
Ga0137404_108108022 | 3300012929 | Vadose Zone Soil | RTLDEVLEHALQKEAVTPPIVPQPEPKQKRVGPDVPRAIH* |
Ga0120132_10655091 | 3300013832 | Permafrost | VRTLDEVLEHARSKEVVAPPPIVPEPKTKTPHVGPDAPRAIH* |
Ga0134081_102900231 | 3300014150 | Grasslands Soil | IKITYVHTLDEVLEHALQKEPVAAPLAPEPETKGKRLGPESPRAIH* |
Ga0134075_100468001 | 3300014154 | Grasslands Soil | DEVLEHALSKEPVVAPLGTQSERGAKRTGPESPRAIH* |
Ga0137411_12201005 | 3300015052 | Vadose Zone Soil | MKITYVRTLDEVLEHALQKEPIAPPVVPQPEPEAETGGSNSPRAIH* |
Ga0137411_12212812 | 3300015052 | Vadose Zone Soil | YVRTLDEVLEHALQKDPIAPPIVPEPKQKRVDPNSPRAIH* |
Ga0137420_132468611 | 3300015054 | Vadose Zone Soil | VRTLDEVLEHALQKEAVTPPIVPQPEPKPKRLGPDAPRAIH* |
Ga0137403_115136741 | 3300015264 | Vadose Zone Soil | VRTLDEVLEHALQKDAVVAPIIPPPASGAKEAGPDGTSAIH* |
Ga0134089_101963831 | 3300015358 | Grasslands Soil | LEHALQKEAVTPPIVPQPEPKQKRLGPEGPRAIH* |
Ga0066669_101239623 | 3300018482 | Grasslands Soil | RTVDQVLEHAVQKGPVAQPLAPAPESKAERLGPGSPRAIH |
Ga0193722_10046176 | 3300019877 | Soil | TLEEVLEHALSKESIVPPVVPEPKKRIGPDAPRAIH |
Ga0210403_103451413 | 3300020580 | Soil | VLEHALQKNAVAPPIVPEPEAKPKRVGPDSPRAIH |
Ga0179596_102726262 | 3300021086 | Vadose Zone Soil | TLDEVLEHALQKEAVTPPIVPQPEPKPKRVGPDIPRAIH |
Ga0179596_105627672 | 3300021086 | Vadose Zone Soil | DIKITYVHTLDEVLEHALQKEAVTPPIIPQPEPKPKRVGPDSPRAIH |
Ga0210406_105874061 | 3300021168 | Soil | DEVLEHALQKDPIASPIVPPTEPKPKRLPADGPRAIH |
Ga0210406_112680171 | 3300021168 | Soil | GDMKIVYVRTLDEVLEHALQKEPMPPAVVPPEPKGKRVEVPRAIH |
Ga0210396_108113422 | 3300021180 | Soil | LDEVLEHALEKEPVTPAIVPPEPKGKRVEVPRAIH |
Ga0210388_106492272 | 3300021181 | Soil | DEVLEHALSKEAVAPPIVPQPEPKPKRVGGESPRAIH |
Ga0210393_108037861 | 3300021401 | Soil | MKITYVRNLDEVLEHALSKEAVVPPIVPQPEPKPKRVGGESPRAIH |
Ga0210387_108385772 | 3300021405 | Soil | DEVLEHALSKDAVAPPIVPQPEPKPKRVGPDGPRAIH |
Ga0210383_115282781 | 3300021407 | Soil | VRTLDEVLEHALQKDPVATPIVPPEPKAKRLPPDAPRAIH |
Ga0210394_109731472 | 3300021420 | Soil | VLEHALSKDAVAPPIVPHPEPKPKRVAGESPRAIH |
Ga0210384_100416734 | 3300021432 | Soil | YVRTLDEVLEHALQAEAVVPPIVPQPEVKPKSVGPAGPRAIH |
Ga0210390_105194381 | 3300021474 | Soil | NLDEVLEHALSKEAVAPPIVPQPEPKPKRVGGESPRAIH |
Ga0210392_112731541 | 3300021475 | Soil | TLDEVLEHALQKEAVAPPIVPEPEAKPKRVGPDSPRAIH |
Ga0247679_10950602 | 3300024251 | Soil | KITYVHTLDEVLEHALEKEGVAPPIVPQAAPKQKRPDSPRAIH |
Ga0207685_107369081 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TYVRTLDEVLEHALEKEPTTSAIVPPEPKGKRVEIPRAIH |
Ga0207699_108082242 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TYVRTLDEVLEHALEKEPVTPAIVPPEPKGKRVEVPRAIH |
Ga0207699_111715022 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VRTLDEVLEHALQKDPSVPTIVPPEPKAKRVEVPRAIH |
Ga0207660_106222182 | 3300025917 | Corn Rhizosphere | KITYVRNLDEVLEHALSKNAVAPPIVPQPEPKQKRVGPESPRAIH |
Ga0209350_11536861 | 3300026277 | Grasslands Soil | VLEHALQKEAVTPPIVPQPEPKPKRVGPDSPRAIH |
Ga0209237_11858451 | 3300026297 | Grasslands Soil | EVLEHALQKEAVTPPIVPQPEPKPKRVGPESPRAIH |
Ga0209471_11638052 | 3300026318 | Soil | LDEVLEHALQKVAVTPPILPQPEPKPKRVGPDVPRAIH |
Ga0209152_100391411 | 3300026325 | Soil | DIKITYVHTLDEVLEHALQKEAVTPPIVPQPEPKQKRLGPEGPRAIH |
Ga0209059_12119371 | 3300026527 | Soil | ITYVRTLDEVLEHALQKEPVAQPIPPEPASKPKGLGPESPRAIH |
Ga0209160_10909313 | 3300026532 | Soil | KITYVHTLDEVLEHALQKEAVTPPIVPQPEPKQKRLGPEGPRAIH |
Ga0209156_100139507 | 3300026547 | Soil | YVRTLDEVLEHALQREALTPPIVPQSEPKQKRVGPEGPRAIH |
Ga0209161_101892131 | 3300026548 | Soil | YVHTLDEALEHALEKEGVAPPIVPQAAPKQKRPDSPRAIH |
Ga0209648_108099462 | 3300026551 | Grasslands Soil | LDEVLEHALQKEAVTPPIVPQPEPKPKRLGPESPRAIH |
Ga0179587_106170861 | 3300026557 | Vadose Zone Soil | TLDEVLEHALKKEPIAPPVVPQPEPKQKRVDPNSPRAIH |
Ga0209729_10494882 | 3300027061 | Forest Soil | VLDHALQKEPVAQPLAPAPESKAERLGPGSPRAIH |
Ga0209625_10071604 | 3300027635 | Forest Soil | ITYVRTLDEVLEHALSKEVVAPPPVVPEPKTKTPHVGPDAPRAIH |
Ga0209060_100225331 | 3300027826 | Surface Soil | EVLEHALQKDSIAPPIVPPTEPKPKRLPADGPRAIH |
Ga0209274_103289261 | 3300027853 | Soil | EVLEHALSKEAVVPPIVPQPEPKPKRVGGESPRAIH |
Ga0209701_102451051 | 3300027862 | Vadose Zone Soil | VRTLDEVLEHALEKEPVAPAIVPPEPKGKRVGPDVPRAIH |
Ga0209701_103360402 | 3300027862 | Vadose Zone Soil | LDEVLEHALQKEAVTPPIVPQPEPKPKRVGPDSPRAIH |
Ga0209283_107525681 | 3300027875 | Vadose Zone Soil | YVRTLDEVLEHALQKEAVAPPIVPQPEPKQKRVGPDSPRAIH |
Ga0209590_103032211 | 3300027882 | Vadose Zone Soil | DIKITYVRTLDEVLEHALQEGTITPPIAPEPKPKRVGPDIPRAIH |
Ga0209275_102932761 | 3300027884 | Soil | LDEVLEHALSKEALAPPIVPEPKPKSLGPLSPRAIH |
Ga0209067_101501823 | 3300027898 | Watersheds | IRITYVRTLDEVLEHALQKESVTPPITPQPEAKPKRVGPDIPRAIH |
Ga0265357_10208901 | 3300028023 | Rhizosphere | NLDEVLEHALSKEAVAPPIVPQPEPKPKRVGPESPRAIH |
Ga0265740_10059141 | 3300030940 | Soil | YVRNLDEVLEHALSKEAVAPPIVPQPEPKPKRVGPESPRAIH |
Ga0318573_100352183 | 3300031564 | Soil | EVLEHALQKEPVAQPLAPAPESKVKRLGPESPRAIH |
Ga0318572_102071111 | 3300031681 | Soil | YVHTLDEVLEHALQKEPVAQPLAPAPESKVKRLGPESPRAIH |
Ga0307477_105892102 | 3300031753 | Hardwood Forest Soil | VRTLDEVLEHALQKEAVTPPVVPQPEPKQKRIGPGPDSPRAIH |
Ga0307475_112418263 | 3300031754 | Hardwood Forest Soil | DLKITYVHTLDEVLEHALEKESVAPPIVPQAAPKQKRPGTESPRAIH |
Ga0307479_101379875 | 3300031962 | Hardwood Forest Soil | YVRTLDEVLEHALQKEPMPPAVVPPEPKGKRVEVPRAIH |
Ga0307479_121007532 | 3300031962 | Hardwood Forest Soil | TYVRTLDEVLEHALQKEAVTPPIVPQPEPKPKRVGPDSPRAIH |
Ga0318577_100922213 | 3300032091 | Soil | TYVHTLDEVLEHALQKEPVAQPLAPAPESKVKRLGPESPRAIH |
Ga0307471_1015678422 | 3300032180 | Hardwood Forest Soil | TYVRTLDEVLEHALQKEPIAPPVVPQPEPKQKRVDPNSPRAIH |
Ga0307471_1031823681 | 3300032180 | Hardwood Forest Soil | KITYVRTLDEVLEHALQKEAVTPPIVPQPEPKPKRVGPDSPRAIH |
Ga0307471_1032722972 | 3300032180 | Hardwood Forest Soil | VRTLDEVLEHALSKDVVAPPIVPQPEPQKKSPDSPRAIH |
Ga0306920_1037079531 | 3300032261 | Soil | KITYVHTLDEVLEHALQKEPVAQPLAPAPESKLKRLGPESPRAIH |
⦗Top⦘ |