Basic Information | |
---|---|
Family ID | F073976 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 120 |
Average Sequence Length | 38 residues |
Representative Sequence | MPTGYVLGDIATKAAYFSVAAAAFIFVAMTLLPGLHP |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 120 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 89.17 % |
% of genes near scaffold ends (potentially truncated) | 12.50 % |
% of genes from short scaffolds (< 2000 bps) | 91.67 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (57.500 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (26.667 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.333 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 120 Family Scaffolds |
---|---|---|
PF00166 | Cpn10 | 4.17 |
PF08281 | Sigma70_r4_2 | 3.33 |
PF13545 | HTH_Crp_2 | 2.50 |
PF03979 | Sigma70_r1_1 | 2.50 |
PF00118 | Cpn60_TCP1 | 1.67 |
PF08241 | Methyltransf_11 | 0.83 |
PF00027 | cNMP_binding | 0.83 |
PF00011 | HSP20 | 0.83 |
PF04998 | RNA_pol_Rpb1_5 | 0.83 |
PF00589 | Phage_integrase | 0.83 |
COG ID | Name | Functional Category | % Frequency in 120 Family Scaffolds |
---|---|---|---|
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 4.17 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 2.50 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 1.67 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.83 |
COG0086 | DNA-directed RNA polymerase, beta' subunit/160 kD subunit | Transcription [K] | 0.83 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 57.50 % |
All Organisms | root | All Organisms | 42.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_106055072 | Not Available | 517 | Open in IMG/M |
3300000956|JGI10216J12902_107162720 | Not Available | 1323 | Open in IMG/M |
3300001081|JGI12662J13196_1000240 | All Organisms → cellular organisms → Bacteria | 2622 | Open in IMG/M |
3300001081|JGI12662J13196_1016555 | Not Available | 609 | Open in IMG/M |
3300001081|JGI12662J13196_1020111 | Not Available | 553 | Open in IMG/M |
3300001545|JGI12630J15595_10003887 | All Organisms → cellular organisms → Bacteria | 3239 | Open in IMG/M |
3300001545|JGI12630J15595_10008567 | Not Available | 2209 | Open in IMG/M |
3300001545|JGI12630J15595_10032199 | Not Available | 1080 | Open in IMG/M |
3300001545|JGI12630J15595_10059639 | Not Available | 757 | Open in IMG/M |
3300001545|JGI12630J15595_10084606 | Not Available | 623 | Open in IMG/M |
3300001661|JGI12053J15887_10228587 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300001661|JGI12053J15887_10279284 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300001661|JGI12053J15887_10431819 | Not Available | 631 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100240169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1701 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100271707 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101102822 | Not Available | 681 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101310029 | Not Available | 616 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10131860 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10476730 | Not Available | 503 | Open in IMG/M |
3300004152|Ga0062386_100868194 | Not Available | 745 | Open in IMG/M |
3300004152|Ga0062386_101715967 | Not Available | 524 | Open in IMG/M |
3300005105|Ga0066812_1018553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
3300005435|Ga0070714_100451050 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
3300005437|Ga0070710_10075682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium icense | 1951 | Open in IMG/M |
3300005437|Ga0070710_10366426 | Not Available | 958 | Open in IMG/M |
3300005439|Ga0070711_100750582 | Not Available | 825 | Open in IMG/M |
3300005602|Ga0070762_11079394 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300006041|Ga0075023_100035973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1485 | Open in IMG/M |
3300006172|Ga0075018_10190453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 968 | Open in IMG/M |
3300006175|Ga0070712_100061672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2649 | Open in IMG/M |
3300006175|Ga0070712_100442607 | Not Available | 1081 | Open in IMG/M |
3300006175|Ga0070712_101468681 | Not Available | 595 | Open in IMG/M |
3300006797|Ga0066659_11334651 | Not Available | 598 | Open in IMG/M |
3300006844|Ga0075428_101789371 | Not Available | 640 | Open in IMG/M |
3300009038|Ga0099829_11041171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 679 | Open in IMG/M |
3300009038|Ga0099829_11071861 | Not Available | 668 | Open in IMG/M |
3300009088|Ga0099830_10837029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 760 | Open in IMG/M |
3300009089|Ga0099828_10589540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1001 | Open in IMG/M |
3300009143|Ga0099792_10711693 | Not Available | 651 | Open in IMG/M |
3300009789|Ga0126307_10155241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1833 | Open in IMG/M |
3300009840|Ga0126313_10647391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 853 | Open in IMG/M |
3300010036|Ga0126305_10384519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 923 | Open in IMG/M |
3300010038|Ga0126315_10290318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1007 | Open in IMG/M |
3300010038|Ga0126315_10455046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium | 811 | Open in IMG/M |
3300010041|Ga0126312_10148654 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
3300010041|Ga0126312_10589142 | Not Available | 799 | Open in IMG/M |
3300010339|Ga0074046_10151598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1478 | Open in IMG/M |
3300010375|Ga0105239_10817473 | Not Available | 1068 | Open in IMG/M |
3300010861|Ga0126349_1088949 | Not Available | 545 | Open in IMG/M |
3300011003|Ga0138514_100089444 | Not Available | 660 | Open in IMG/M |
3300011269|Ga0137392_11058849 | Not Available | 666 | Open in IMG/M |
3300011270|Ga0137391_10361275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1246 | Open in IMG/M |
3300011270|Ga0137391_11335992 | Not Available | 563 | Open in IMG/M |
3300012021|Ga0120192_10004288 | Not Available | 1908 | Open in IMG/M |
3300012189|Ga0137388_10388511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1291 | Open in IMG/M |
3300012189|Ga0137388_11329293 | Not Available | 658 | Open in IMG/M |
3300012198|Ga0137364_11405321 | Not Available | 517 | Open in IMG/M |
3300012224|Ga0134028_1190831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
3300012356|Ga0137371_10544153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 894 | Open in IMG/M |
3300012363|Ga0137390_11025132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 776 | Open in IMG/M |
3300012683|Ga0137398_11041855 | Not Available | 566 | Open in IMG/M |
3300012917|Ga0137395_11243987 | Not Available | 518 | Open in IMG/M |
3300012955|Ga0164298_11140149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
3300012961|Ga0164302_10504917 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 854 | Open in IMG/M |
3300012961|Ga0164302_10743998 | Not Available | 732 | Open in IMG/M |
3300012985|Ga0164308_11223486 | Not Available | 679 | Open in IMG/M |
3300012987|Ga0164307_11031259 | Not Available | 671 | Open in IMG/M |
3300012988|Ga0164306_10830935 | Not Available | 747 | Open in IMG/M |
3300012989|Ga0164305_10505184 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
3300012989|Ga0164305_11336837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
3300018071|Ga0184618_10354703 | Not Available | 625 | Open in IMG/M |
3300018072|Ga0184635_10120779 | Not Available | 1041 | Open in IMG/M |
3300018468|Ga0066662_11664857 | Not Available | 667 | Open in IMG/M |
3300019789|Ga0137408_1403376 | All Organisms → cellular organisms → Bacteria | 5094 | Open in IMG/M |
3300019887|Ga0193729_1027354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2430 | Open in IMG/M |
3300019890|Ga0193728_1227286 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
3300020579|Ga0210407_10649120 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300020579|Ga0210407_11333286 | Not Available | 535 | Open in IMG/M |
3300020580|Ga0210403_10393531 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
3300020581|Ga0210399_10201244 | Not Available | 1656 | Open in IMG/M |
3300020581|Ga0210399_11036406 | Not Available | 659 | Open in IMG/M |
3300020581|Ga0210399_11439815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 537 | Open in IMG/M |
3300020583|Ga0210401_10526450 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300021168|Ga0210406_10124247 | Not Available | 2179 | Open in IMG/M |
3300021168|Ga0210406_10788255 | Not Available | 724 | Open in IMG/M |
3300021178|Ga0210408_10041785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3598 | Open in IMG/M |
3300021178|Ga0210408_10436642 | Not Available | 1042 | Open in IMG/M |
3300021403|Ga0210397_11329794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 558 | Open in IMG/M |
3300021406|Ga0210386_10900188 | Not Available | 758 | Open in IMG/M |
3300021478|Ga0210402_11309254 | Not Available | 652 | Open in IMG/M |
3300021479|Ga0210410_11415094 | Not Available | 588 | Open in IMG/M |
3300021559|Ga0210409_11683778 | Not Available | 511 | Open in IMG/M |
3300026319|Ga0209647_1051258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2219 | Open in IMG/M |
3300026555|Ga0179593_1185823 | Not Available | 1958 | Open in IMG/M |
3300026557|Ga0179587_10877196 | Not Available | 592 | Open in IMG/M |
3300026984|Ga0208732_1003287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1215 | Open in IMG/M |
3300027105|Ga0207944_1017505 | Not Available | 625 | Open in IMG/M |
3300027161|Ga0208368_110103 | Not Available | 537 | Open in IMG/M |
3300027537|Ga0209419_1030438 | Not Available | 1015 | Open in IMG/M |
3300027565|Ga0209219_1080952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 805 | Open in IMG/M |
3300027587|Ga0209220_1146394 | Not Available | 612 | Open in IMG/M |
3300027603|Ga0209331_1015498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1976 | Open in IMG/M |
3300027610|Ga0209528_1001493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4644 | Open in IMG/M |
3300027610|Ga0209528_1079872 | Not Available | 724 | Open in IMG/M |
3300027651|Ga0209217_1127900 | Not Available | 713 | Open in IMG/M |
3300027660|Ga0209736_1143877 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
3300027663|Ga0208990_1088216 | Not Available | 875 | Open in IMG/M |
3300027674|Ga0209118_1108586 | Not Available | 780 | Open in IMG/M |
3300027681|Ga0208991_1072029 | Not Available | 1040 | Open in IMG/M |
3300027727|Ga0209328_10185918 | Not Available | 628 | Open in IMG/M |
3300027824|Ga0209040_10132302 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
3300027903|Ga0209488_10665548 | Not Available | 749 | Open in IMG/M |
3300027903|Ga0209488_10847551 | Not Available | 644 | Open in IMG/M |
3300027915|Ga0209069_10718003 | Not Available | 589 | Open in IMG/M |
3300028828|Ga0307312_11134437 | Not Available | 517 | Open in IMG/M |
3300030969|Ga0075394_10361876 | Not Available | 703 | Open in IMG/M |
3300031057|Ga0170834_112528694 | Not Available | 761 | Open in IMG/M |
3300031446|Ga0170820_14440513 | Not Available | 796 | Open in IMG/M |
3300031469|Ga0170819_13237498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
3300034113|Ga0364937_061517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 26.67% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.17% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.83% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.50% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.50% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.50% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.83% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.83% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.83% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.83% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.83% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.83% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.83% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.83% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.83% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.83% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010861 | Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012224 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
3300027105 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF018 (SPAdes) | Environmental | Open in IMG/M |
3300027161 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF032 (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030969 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300034113 | Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1060550722 | 3300000559 | Soil | MATGYVLSNAATKAAVCLTAAAFIFVAMLLLTGLHP* |
JGI10216J12902_1071627203 | 3300000956 | Soil | MRRSYVLSDVAAKAAYFSLAAAAVIFILMLTLTGLHP* |
JGI12662J13196_10002409 | 3300001081 | Forest Soil | MTMXTGYVLGDIVTKAAYFSLAAAAFIFVAMTLLPGLHP* |
JGI12662J13196_10165551 | 3300001081 | Forest Soil | MTMPTGYVLGDIATKAAYFSVAAAAFIFVTMTLLPGLHPYSASRS* |
JGI12662J13196_10201112 | 3300001081 | Forest Soil | MTMPTGYVLGDIVAKSTYFSLAAAAFIFVAMTLLPGLHF* |
JGI12630J15595_100038873 | 3300001545 | Forest Soil | MTMLTGYVLGDIVTKAAYFSLAAAAFIFVAMTLLPGLHP* |
JGI12630J15595_100085674 | 3300001545 | Forest Soil | MTMPTGYVLGDIVTKSAYFSLAAAAFIFVAMTLLPGLHF* |
JGI12630J15595_100321991 | 3300001545 | Forest Soil | MPTGYVLGDIATKAAYFSVAAAAFIFVTMTLLPGLHP* |
JGI12630J15595_100596392 | 3300001545 | Forest Soil | MPTGYVLGDIVTKAAYFSLAAAAFIFVAMTLLPGLHP* |
JGI12630J15595_100846061 | 3300001545 | Forest Soil | MTMPTSYVLGELVTKAAYFSLAAAAFIFVTMTLLPGLHP* |
JGI12053J15887_102285872 | 3300001661 | Forest Soil | MPTGYVLGELVTKAAYFSLAAAAFIFITMTLLPGLHP* |
JGI12053J15887_102792842 | 3300001661 | Forest Soil | MPTGYVLGDIATKAAYFSVAAAAFIFVAMTLLPGLHP* |
JGI12053J15887_104318192 | 3300001661 | Forest Soil | MPTGYVLADMATKAAYFSVAVAAFIFVAMTLLPGLHP* |
JGIcombinedJ26739_1002401692 | 3300002245 | Forest Soil | MPTGYVLGDLATKAAYFSLAAAAFIFVAMTLLPGLHP* |
JGIcombinedJ26739_1002717073 | 3300002245 | Forest Soil | MPTGYVLGDMATKAAYFPVAAAAFIFVAMTLLPGLHP* |
JGIcombinedJ26739_1011028221 | 3300002245 | Forest Soil | MPTSYVLGELVTKAAYFSLAAAAFIFVTMTLLPGLHP* |
JGIcombinedJ26739_1013100292 | 3300002245 | Forest Soil | MTMPTGYVLGDMATKAAYFSVAVAAFIFVAMTLLPGLHL* |
JGIcombinedJ51221_101318601 | 3300003505 | Forest Soil | MAMPTGYVLGDLATKAAYFSLAAAAFIFVAMTLLPGLHP* |
JGIcombinedJ51221_104767301 | 3300003505 | Forest Soil | MTMPTGYVLGDIVTKSAYYSLAAAAFIFVAMTLLPGLHF* |
Ga0062386_1008681942 | 3300004152 | Bog Forest Soil | MTMPTGYVLGDMASKAAYFSMAVAAFIFVTMTLFTGLHP* |
Ga0062386_1017159672 | 3300004152 | Bog Forest Soil | MTMPTGYVLGDMATKAAYFSLAAAAFIFVAMTLLPGLHP* |
Ga0066812_10185532 | 3300005105 | Soil | RMTMPTGYVLGDMATKAAYFFVAAAAFIFVAMTLLPGLHP* |
Ga0070714_1004510503 | 3300005435 | Agricultural Soil | MTMPTGYVLGDMVTKAAYFSLAAAAFIFVAMTLLPGLHP* |
Ga0070710_100756822 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMPRGYVLGDMATKAAYFSVAAAAFIFVAMTLLPGLHP* |
Ga0070710_103664261 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMPTGYVLGELVTKAAYFSLAAAAFIFVTMTLLPGLHP* |
Ga0070711_1007505822 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MTMPRGYVLGDMATKAAYYSVAAAAFIFVAMTLLPGLHP* |
Ga0070762_110793941 | 3300005602 | Soil | MPRGYVLGDMAAKATYFSVAAAAFIFVAMTLLPGLH |
Ga0075023_1000359733 | 3300006041 | Watersheds | MPTGYVLGDMATKAAYFSVAVAAFIFVAMTLLPGLHP* |
Ga0075018_101904533 | 3300006172 | Watersheds | MGYVLGDIATKAAYFSVAMAAFIFVTMTLLTGLHP* |
Ga0070712_1000616724 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPRGYVLGDMATKAAYYSVAAAAFIFVAMTLLPGLHP* |
Ga0070712_1004426072 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTGYVLGDMVTKAAYFSLAAAAFIFVAMTLLPGLHP* |
Ga0070712_1014686812 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MGYALGDIATKAAYFSVAMAAFIFVAMTLLTGLHP* |
Ga0066659_113346511 | 3300006797 | Soil | MGYALGDIATKAAYFSVAMAAFIFVTMTLLTGLHP* |
Ga0075428_1017893711 | 3300006844 | Populus Rhizosphere | MGYALGDIPTKAAYFSVAMAAFIFVTMTLLTGLHP* |
Ga0099829_110411711 | 3300009038 | Vadose Zone Soil | MTMPTGYVLGDIATKAAYFSVAAAAFIFVAMTLLPGLHP* |
Ga0099829_110718611 | 3300009038 | Vadose Zone Soil | MPTGYVLGDLAAKAAYFSLAAAAFIFVAMTLLPGLHP* |
Ga0099830_108370293 | 3300009088 | Vadose Zone Soil | MTMLTGYVLGDIATKAAYFSVAAAAFIFVAMTLLPGLHP* |
Ga0099828_105895403 | 3300009089 | Vadose Zone Soil | MTMPTGYVLGDIATKAAYFSVAAAAFIFVTMTLLPGLHP* |
Ga0099792_107116932 | 3300009143 | Vadose Zone Soil | MPTGYVLGDLAAKAAYFSVAAAAFIFVAMTLLPGLHP* |
Ga0126307_101552413 | 3300009789 | Serpentine Soil | MATGYAVSDVATKAAYFSLAAAAFVFVAMLLLTTLHP* |
Ga0126313_106473911 | 3300009840 | Serpentine Soil | VMATGYAVSDVATKAAYFSLAAAAFVFVAMLLLTTLHP* |
Ga0126305_103845193 | 3300010036 | Serpentine Soil | MATGYAVSDVATKAAYFSLATAAFVFVAMLLLTTLHP* |
Ga0126315_102903183 | 3300010038 | Serpentine Soil | MTTGYAVSDVATKAAYFSLAAAAFVFVAMLLLTALHP* |
Ga0126315_104550461 | 3300010038 | Serpentine Soil | MLCGRLVMATGYAVSDVATKAAYFSLAAAAFVFVAMLLLTALHP* |
Ga0126312_101486542 | 3300010041 | Serpentine Soil | MATGYAVSDVATKAAYFSLAAAAFVFVAMLLLTALHP* |
Ga0126312_105891422 | 3300010041 | Serpentine Soil | MATGYSVSDVATKAAYFSLAAAAFVFVAMLLLTSLHP* |
Ga0074046_101515983 | 3300010339 | Bog Forest Soil | MTMGYVLGDITSKTAYFSVAAAAFIFVTMTLLPGLYP* |
Ga0105239_108174733 | 3300010375 | Corn Rhizosphere | MGYALGDIATKAACFSVAMAAFIFVTMTLLTGLHP* |
Ga0126349_10889492 | 3300010861 | Boreal Forest Soil | RRMTMPTGYVLGDMATKAAYFSVAVAAFIFVAMTLLPGLHP* |
Ga0138514_1000894442 | 3300011003 | Soil | MTMPTGYVLGELVTKAAYFSLAAAAFIFVAMTLLPGLHP* |
Ga0137392_110588493 | 3300011269 | Vadose Zone Soil | MTMPTGYVFGDIVTKAAYFSVAAAAFIFVTMTLLPGLHP* |
Ga0137391_103612754 | 3300011270 | Vadose Zone Soil | MGYVLGDIATKAAYFSVAMAAVIFVAMTLLTGLHP* |
Ga0137391_113359922 | 3300011270 | Vadose Zone Soil | MTMPTSYVLGDIASKAAYFSLAAAAFIFVTMTLFNGVHP* |
Ga0120192_100042881 | 3300012021 | Terrestrial | MNRSYAFSDLAVKAAFFSLAAAAFIFVLMLVLTGVHP* |
Ga0137388_103885112 | 3300012189 | Vadose Zone Soil | MTMLTGCVLGDIATKAAYFSVAAAAFIFVAMTLLPGLHP* |
Ga0137388_113292931 | 3300012189 | Vadose Zone Soil | RRLVMATGYVLSDVVTKMAYFSLAAAAFVFVAMILVTGLHP* |
Ga0137364_114053211 | 3300012198 | Vadose Zone Soil | MTMPTGYVLGDIVTKAAYFSVAAAAFIFVTMSLLPGLHP* |
Ga0134028_11908311 | 3300012224 | Grasslands Soil | RSDCRRMTMGYVLGDIATKAAYFSVAMAAFIFVTMTLLTGLHP* |
Ga0137371_105441532 | 3300012356 | Vadose Zone Soil | MPTGYVLGDIVTKAAYFSVAAAALIFVTMTLLPGLHP* |
Ga0137390_110251321 | 3300012363 | Vadose Zone Soil | MTIPMGYVLGDMATKAAYFSVAAAAFIFVAMTLLPGLHP* |
Ga0137398_110418552 | 3300012683 | Vadose Zone Soil | MTMPTGYVLGDIVTKAAYFSLAAAAFIFVAMTLLPGLHP* |
Ga0137395_112439872 | 3300012917 | Vadose Zone Soil | MTMPTGYVLGDMATKAAYFSVAAAAFIFVAMTLLPGLHP* |
Ga0164298_111401491 | 3300012955 | Soil | MGYTLGDIATKAAYFSVAAAAFIFVMMTLLPGLHP* |
Ga0164302_105049171 | 3300012961 | Soil | MGYALGDIATKAAYFSVAMEAFIFVTMTLLTGLHP* |
Ga0164302_107439982 | 3300012961 | Soil | MTMPRGYVLGDMATKAAYYSVAAAAFIFVAMTLFPGLHP* |
Ga0164308_112234861 | 3300012985 | Soil | MPTGYVLGDMATKAAYFSVAAAAFIFVAMTLLPGLHP* |
Ga0164307_110312592 | 3300012987 | Soil | MTMLTGYVLGDMVTKAAYFSLVALAFIFVAMTLLPGLHP* |
Ga0164306_108309352 | 3300012988 | Soil | MTMPRGYVLGDMATKAAYYSVAGAAFIFVAMTLLPGLHP* |
Ga0164305_105051841 | 3300012989 | Soil | MGYALGDIATKAAYFSVALAAFIFITMTLLTGLHP* |
Ga0164305_113368372 | 3300012989 | Soil | MPTGYILGDMVTKAAYFSLAAAAFIFVAMTLLPGLHL* |
Ga0184618_103547031 | 3300018071 | Groundwater Sediment | MTMPTGYVLGDMATKAAYFSVAAAAFIFVAMTLLPGLHP |
Ga0184635_101207792 | 3300018072 | Groundwater Sediment | MTMPTGYVLGDIATKAAYFSVAAAAFIFVAMTLLPGLLHP |
Ga0066662_116648572 | 3300018468 | Grasslands Soil | MTMPTGYVLGDIVTKAAYFSVAAAAFIFVTMTLLPGLHP |
Ga0137408_14033767 | 3300019789 | Vadose Zone Soil | VPTGYVLGDMAIKAAYFSVAAAAFIFVGMTLLPGLHP |
Ga0193729_10273541 | 3300019887 | Soil | MPTGYVLGDIVTKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0193728_12272862 | 3300019890 | Soil | MTMPTGYVLGDIVTKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0210407_106491202 | 3300020579 | Soil | MPTGYVLGDLATKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0210407_113332861 | 3300020579 | Soil | MPTGYVLGDMVTKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0210403_103935313 | 3300020580 | Soil | MPTGYVLGDVATKAAYFSVAVAAFIFVAMTLLPGLHP |
Ga0210399_102012442 | 3300020581 | Soil | MPTGYVLGDMATKAAYFSVAAAAFIFVAMTLLPGLHP |
Ga0210399_110364061 | 3300020581 | Soil | MAMPTGYVLGDLATKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0210399_114398151 | 3300020581 | Soil | MGYTLGDIATKAAYFSVALAAFIFITMTLLTGLHP |
Ga0210401_105264502 | 3300020583 | Soil | MTMPRGYVLGDIATKAAYFSVAAAAFIFVAMTLLPGLHP |
Ga0210406_101242475 | 3300021168 | Soil | MTMPRGYVLGDMAAKAAYFSVAAAAFIFVAMTLLPGLHP |
Ga0210406_107882552 | 3300021168 | Soil | MPTGYVLGDMATKAAYFFVAVAAFIFVAMTLLPGLHP |
Ga0210408_100417855 | 3300021178 | Soil | MPRGYVLGDMATKAAYFSVAAAAFIFVAMTLLPGLHP |
Ga0210408_104366421 | 3300021178 | Soil | MPTGYILGDMVTKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0210397_113297942 | 3300021403 | Soil | MTMPTGYVLGDIATKAAYFSVAAAAFIFVTMTLLPGLHP |
Ga0210386_109001882 | 3300021406 | Soil | MTMPTGYVLGEIVTKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0210402_113092541 | 3300021478 | Soil | MPTGYVLGDMATKAAYFFVAVAAFIFVAMTLLPGLH |
Ga0210410_114150941 | 3300021479 | Soil | RNDCRRMTMPTGYVLGDIVTKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0210409_116837783 | 3300021559 | Soil | MGYALGDIATKAAYFSVAMAAFIFVTMTLLPGLHP |
Ga0209647_10512581 | 3300026319 | Grasslands Soil | MGYVLGDIATKAAYFSVAMAAFIFVTMTLLTGLHP |
Ga0179593_11858231 | 3300026555 | Vadose Zone Soil | TGYVLGDIVTKAAYFSLAAAAYIFVAMTLLPGLHP |
Ga0179587_108771961 | 3300026557 | Vadose Zone Soil | MTMPTGYVLGELVTKAAYFSLAAAAVIFITMTLLPGLHP |
Ga0208732_10032872 | 3300026984 | Forest Soil | MTMPTGYVLGDLATKAAYFSVAAAAFIFVAMTLLPGLHP |
Ga0207944_10175052 | 3300027105 | Forest Soil | MAMPTGYVLGDLATKAAYFSVAAAAFIFVTMTLLPGLHP |
Ga0208368_1101031 | 3300027161 | Forest Soil | MPTGYVLGDMATKAAYFPVAVAAFIFVAMTLLPGLHP |
Ga0209419_10304383 | 3300027537 | Forest Soil | MLTGYVLGDIVTKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0209219_10809522 | 3300027565 | Forest Soil | MPTGYVLGDMATKAAYFSLAAAAFIFVAMTLLPGLHF |
Ga0209220_11463942 | 3300027587 | Forest Soil | MPTGYVLGELVTKAAYFSLAAAAFIFITMTLLPGLHP |
Ga0209331_10154984 | 3300027603 | Forest Soil | MHTGYVLGDIVTKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0209528_10014938 | 3300027610 | Forest Soil | MPTGYVLGDIVTKSAYFSLAAAAFIFVAMTLLPGLHF |
Ga0209528_10798722 | 3300027610 | Forest Soil | MTMPTSYVLGELVTKAAYFSLAAAAFIFITMTLLPGLHP |
Ga0209217_11279001 | 3300027651 | Forest Soil | MTMPTGYVLGDMATKAAYFPVAAAAFIFVAMTLLPGLHP |
Ga0209736_11438772 | 3300027660 | Forest Soil | MPTGYVLGELVTKAAYFSLAAAAFIFVTMTLLPGLHP |
Ga0208990_10882162 | 3300027663 | Forest Soil | MTMPTGYVLGELVTKAAYFSVAAAAFIFVAMTLLPGLHP |
Ga0209118_11085862 | 3300027674 | Forest Soil | MTMPTGYVLGELVTKAAYFSLAAAAFIFITMTLLPGLHP |
Ga0208991_10720291 | 3300027681 | Forest Soil | MPTGYVLGELVTKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0209328_101859181 | 3300027727 | Forest Soil | MPTGYVLGDIATKAAYFSVAAAAFIFVTMTLLPGLHP |
Ga0209040_101323023 | 3300027824 | Bog Forest Soil | MTMPTGYVLGDMASKAAYFSMAVAAFIFVTMTLFTGLHP |
Ga0209488_106655482 | 3300027903 | Vadose Zone Soil | MPTGYVLGDLAAKAAYFSVAAAAFIFVAMTLLPGLHP |
Ga0209488_108475512 | 3300027903 | Vadose Zone Soil | MTMPTGYVLGELVTKAAYFSLAAAAFIFVTMTLLPGLHP |
Ga0209069_107180032 | 3300027915 | Watersheds | MTMPTGYVLGDLATKAAYFSLAAAAFIFVAMTLLPGLHP |
Ga0307312_111344371 | 3300028828 | Soil | TMPTGYVLGDMATKAAYFSVAAAAFIFVAMTLLPALHP |
Ga0075394_103618763 | 3300030969 | Soil | MTMPTGYVLGDMATKAAYFSVAVAAFIFVAMTLLPGLHP |
Ga0170834_1125286941 | 3300031057 | Forest Soil | MPTGYVLGDTVTKAAYFSLAAAAFIFVTMTLLPVLHP |
Ga0170820_144405131 | 3300031446 | Forest Soil | MPTGYVLGELVTKAAYFSLAAAAFFFVTMTLLPGLHP |
Ga0170819_132374982 | 3300031469 | Forest Soil | MTMPTGYVLGDIVAKSAYFFLAAAAFIFVAMTLLPGLHF |
Ga0364937_061517_86_205 | 3300034113 | Sediment | MTMPTGYALGEIATKAAYFSIAAAAFIFIAMTLLPGLHP |
⦗Top⦘ |