Basic Information | |
---|---|
Family ID | F074256 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 56 residues |
Representative Sequence | VPPSGAIDAWPIWYRLMDLTGAFVSALAPVCAVARLASARRRPRVPAIDAAGADVSH |
Number of Associated Samples | 69 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 8.55 % |
% of genes near scaffold ends (potentially truncated) | 44.54 % |
% of genes from short scaffolds (< 2000 bps) | 95.80 % |
Associated GOLD sequencing projects | 69 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (81.513 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (79.832 % of family members) |
Environment Ontology (ENVO) | Unclassified (93.277 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (84.034 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.65% β-sheet: 0.00% Coil/Unstructured: 62.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF14214 | Helitron_like_N | 0.84 |
PF07714 | PK_Tyr_Ser-Thr | 0.84 |
PF13966 | zf-RVT | 0.84 |
PF07727 | RVT_2 | 0.84 |
PF13963 | Transpos_assoc | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 81.51 % |
All Organisms | root | All Organisms | 18.49 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005335|Ga0070666_11214794 | Not Available | 562 | Open in IMG/M |
3300005347|Ga0070668_101989328 | Not Available | 536 | Open in IMG/M |
3300005353|Ga0070669_101688538 | Not Available | 552 | Open in IMG/M |
3300005843|Ga0068860_100735492 | Not Available | 998 | Open in IMG/M |
3300009976|Ga0105128_110105 | Not Available | 642 | Open in IMG/M |
3300009981|Ga0105133_100440 | Not Available | 1597 | Open in IMG/M |
3300009989|Ga0105131_128033 | Not Available | 590 | Open in IMG/M |
3300009994|Ga0105126_1042148 | Not Available | 564 | Open in IMG/M |
3300009994|Ga0105126_1046818 | Not Available | 542 | Open in IMG/M |
3300009995|Ga0105139_1054624 | Not Available | 711 | Open in IMG/M |
3300010403|Ga0134123_13519114 | Not Available | 507 | Open in IMG/M |
3300014968|Ga0157379_12051253 | Not Available | 566 | Open in IMG/M |
3300015270|Ga0182183_1033729 | Not Available | 696 | Open in IMG/M |
3300015278|Ga0182099_1062558 | Not Available | 528 | Open in IMG/M |
3300015280|Ga0182100_1041723 | Not Available | 677 | Open in IMG/M |
3300015290|Ga0182105_1016767 | Not Available | 920 | Open in IMG/M |
3300015290|Ga0182105_1100906 | Not Available | 516 | Open in IMG/M |
3300015297|Ga0182104_1003087 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1521 | Open in IMG/M |
3300015301|Ga0182184_1046379 | Not Available | 656 | Open in IMG/M |
3300015301|Ga0182184_1090417 | Not Available | 523 | Open in IMG/M |
3300015306|Ga0182180_1061859 | Not Available | 587 | Open in IMG/M |
3300015306|Ga0182180_1077441 | Not Available | 541 | Open in IMG/M |
3300015311|Ga0182182_1046093 | Not Available | 709 | Open in IMG/M |
3300015312|Ga0182168_1091223 | Not Available | 590 | Open in IMG/M |
3300015315|Ga0182120_1085819 | Not Available | 608 | Open in IMG/M |
3300015315|Ga0182120_1097415 | Not Available | 579 | Open in IMG/M |
3300015315|Ga0182120_1122528 | Not Available | 529 | Open in IMG/M |
3300015317|Ga0182136_1003956 | Not Available | 1559 | Open in IMG/M |
3300015317|Ga0182136_1071052 | Not Available | 653 | Open in IMG/M |
3300015318|Ga0182181_1022420 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 873 | Open in IMG/M |
3300015319|Ga0182130_1050453 | Not Available | 719 | Open in IMG/M |
3300015319|Ga0182130_1084232 | Not Available | 604 | Open in IMG/M |
3300015319|Ga0182130_1132014 | Not Available | 510 | Open in IMG/M |
3300015324|Ga0182134_1014321 | Not Available | 1120 | Open in IMG/M |
3300015326|Ga0182166_1007096 | Not Available | 1303 | Open in IMG/M |
3300015327|Ga0182114_1059314 | Not Available | 749 | Open in IMG/M |
3300015327|Ga0182114_1133554 | Not Available | 546 | Open in IMG/M |
3300015328|Ga0182153_1074978 | Not Available | 662 | Open in IMG/M |
3300015328|Ga0182153_1137818 | Not Available | 525 | Open in IMG/M |
3300015329|Ga0182135_1010654 | Not Available | 1245 | Open in IMG/M |
3300015329|Ga0182135_1019036 | Not Available | 1050 | Open in IMG/M |
3300015329|Ga0182135_1070484 | Not Available | 683 | Open in IMG/M |
3300015332|Ga0182117_1068868 | Not Available | 731 | Open in IMG/M |
3300015332|Ga0182117_1091131 | Not Available | 655 | Open in IMG/M |
3300015332|Ga0182117_1131831 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 562 | Open in IMG/M |
3300015333|Ga0182147_1000765 | Not Available | 2579 | Open in IMG/M |
3300015333|Ga0182147_1042528 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 857 | Open in IMG/M |
3300015333|Ga0182147_1070093 | Not Available | 717 | Open in IMG/M |
3300015333|Ga0182147_1101721 | Not Available | 621 | Open in IMG/M |
3300015334|Ga0182132_1016906 | Not Available | 1154 | Open in IMG/M |
3300015335|Ga0182116_1000112 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 4198 | Open in IMG/M |
3300015335|Ga0182116_1026403 | Not Available | 1050 | Open in IMG/M |
3300015336|Ga0182150_1025137 | Not Available | 996 | Open in IMG/M |
3300015336|Ga0182150_1103056 | Not Available | 611 | Open in IMG/M |
3300015337|Ga0182151_1024985 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 998 | Open in IMG/M |
3300015337|Ga0182151_1094459 | Not Available | 632 | Open in IMG/M |
3300015338|Ga0182137_1147615 | Not Available | 547 | Open in IMG/M |
3300015339|Ga0182149_1060035 | Not Available | 769 | Open in IMG/M |
3300015339|Ga0182149_1081022 | Not Available | 688 | Open in IMG/M |
3300015339|Ga0182149_1143399 | Not Available | 546 | Open in IMG/M |
3300015340|Ga0182133_1000710 | Not Available | 2808 | Open in IMG/M |
3300015340|Ga0182133_1028526 | Not Available | 1046 | Open in IMG/M |
3300015348|Ga0182115_1069838 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Anthephorinae → Digitaria → Digitaria exilis | 1065 | Open in IMG/M |
3300015348|Ga0182115_1148368 | Not Available | 751 | Open in IMG/M |
3300015349|Ga0182185_1270801 | Not Available | 518 | Open in IMG/M |
3300015350|Ga0182163_1096172 | Not Available | 894 | Open in IMG/M |
3300015350|Ga0182163_1229454 | Not Available | 582 | Open in IMG/M |
3300015352|Ga0182169_1134916 | Not Available | 802 | Open in IMG/M |
3300015352|Ga0182169_1229935 | Not Available | 604 | Open in IMG/M |
3300015353|Ga0182179_1079425 | Not Available | 952 | Open in IMG/M |
3300015353|Ga0182179_1083810 | Not Available | 932 | Open in IMG/M |
3300015353|Ga0182179_1203853 | Not Available | 630 | Open in IMG/M |
3300015353|Ga0182179_1218635 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 610 | Open in IMG/M |
3300015353|Ga0182179_1231998 | Not Available | 593 | Open in IMG/M |
3300015353|Ga0182179_1291825 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 530 | Open in IMG/M |
3300015354|Ga0182167_1022410 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum | 1908 | Open in IMG/M |
3300015354|Ga0182167_1023267 | Not Available | 1885 | Open in IMG/M |
3300015354|Ga0182167_1031378 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1705 | Open in IMG/M |
3300015354|Ga0182167_1038945 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 1576 | Open in IMG/M |
3300015354|Ga0182167_1048322 | Not Available | 1451 | Open in IMG/M |
3300015354|Ga0182167_1119867 | Not Available | 968 | Open in IMG/M |
3300015354|Ga0182167_1214216 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 702 | Open in IMG/M |
3300017412|Ga0182199_1044436 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida | 888 | Open in IMG/M |
3300017412|Ga0182199_1100172 | Not Available | 665 | Open in IMG/M |
3300017412|Ga0182199_1141979 | Not Available | 582 | Open in IMG/M |
3300017414|Ga0182195_1021694 | Not Available | 1163 | Open in IMG/M |
3300017414|Ga0182195_1038871 | Not Available | 965 | Open in IMG/M |
3300017414|Ga0182195_1055272 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 856 | Open in IMG/M |
3300017414|Ga0182195_1071893 | Not Available | 780 | Open in IMG/M |
3300017414|Ga0182195_1148226 | Not Available | 593 | Open in IMG/M |
3300017414|Ga0182195_1223557 | Not Available | 501 | Open in IMG/M |
3300017422|Ga0182201_1033912 | Not Available | 817 | Open in IMG/M |
3300017432|Ga0182196_1067601 | Not Available | 672 | Open in IMG/M |
3300017439|Ga0182200_1093880 | Not Available | 613 | Open in IMG/M |
3300017694|Ga0182211_1046731 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 989 | Open in IMG/M |
3300026118|Ga0207675_101605553 | Not Available | 671 | Open in IMG/M |
3300028049|Ga0268322_1039729 | Not Available | 570 | Open in IMG/M |
3300028053|Ga0268346_1039604 | Not Available | 523 | Open in IMG/M |
3300028058|Ga0268332_1009837 | Not Available | 995 | Open in IMG/M |
3300028058|Ga0268332_1036761 | Not Available | 665 | Open in IMG/M |
3300028062|Ga0268342_1040501 | Not Available | 522 | Open in IMG/M |
3300028139|Ga0268355_1011754 | Not Available | 586 | Open in IMG/M |
3300028142|Ga0268347_1025364 | Not Available | 557 | Open in IMG/M |
3300028152|Ga0268336_1013805 | Not Available | 646 | Open in IMG/M |
3300028466|Ga0268321_103635 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 700 | Open in IMG/M |
3300028467|Ga0268333_1002854 | Not Available | 799 | Open in IMG/M |
3300032465|Ga0214493_1034897 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1154 | Open in IMG/M |
3300032490|Ga0214495_1083569 | Not Available | 742 | Open in IMG/M |
3300032502|Ga0214490_1118452 | Not Available | 603 | Open in IMG/M |
3300032502|Ga0214490_1124611 | Not Available | 586 | Open in IMG/M |
3300032590|Ga0214489_1007836 | Not Available | 1410 | Open in IMG/M |
3300032625|Ga0214501_1106531 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 894 | Open in IMG/M |
3300032625|Ga0214501_1141824 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 768 | Open in IMG/M |
3300032689|Ga0214497_1008114 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1856 | Open in IMG/M |
3300032697|Ga0214499_1287009 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 506 | Open in IMG/M |
3300032790|Ga0314731_1022834 | Not Available | 1030 | Open in IMG/M |
3300033535|Ga0314759_1209351 | Not Available | 620 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 79.83% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 8.40% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 5.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.52% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028062 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028152 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028466 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028467 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032790 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070666_112147941 | 3300005335 | Switchgrass Rhizosphere | MPPPGAIDAWPIWYRLMDLTGVFVSALAPVCAVARLASAWRRPRVPVIDAAGADVSH* |
Ga0070668_1019893281 | 3300005347 | Switchgrass Rhizosphere | VPPPGAIDAWPIWYRLMELTGAFVCALAPVCAVVRPASARRRPKVPVIVATGTDDSH* |
Ga0070669_1016885381 | 3300005353 | Switchgrass Rhizosphere | MPPPGAIDAWPIWYRLMDLTGAFVSALAPVCAVARLASARRRPRVPAIDVAGVDVSH* |
Ga0068860_1007354922 | 3300005843 | Switchgrass Rhizosphere | VPPPGAIDAWPIWYRLMELTGAFVSALAPVCAVARLASARRMPKVPAIDVAGADISH* |
Ga0068860_1017275952 | 3300005843 | Switchgrass Rhizosphere | WPIWYRFMELTGVFVCVLSPVCVVVCLASARRKPKVPAIVATGTDASH* |
Ga0105128_1101051 | 3300009976 | Switchgrass Associated | VPPPGDIDAWLIWYRLMDLTGAFVSVLALVCVVTRVACIWRRPRVLAIDATGADVFY* |
Ga0105133_1004401 | 3300009981 | Switchgrass Associated | VPPPGAIDAWPIWYRLMDLTGVFVSALAPVCAVACFANARRRPRVPAIDAAGADVSH* |
Ga0105131_1280331 | 3300009989 | Switchgrass Associated | PGAIDAWPIWYRLMELTGAFVSALAPVCAVARFARTRRWLRVPAIDAAGADVSH* |
Ga0105126_10421481 | 3300009994 | Switchgrass Associated | VPLPGAIDAWPIWYRLKALTGAFVSALASVCVVARFASARRRPKLPAIVATGTNASY* |
Ga0105126_10468181 | 3300009994 | Switchgrass Associated | MLHKYRVMPPPGAIDAWPIWYRLMDLIGAFVSALALVCAMAHLASARRWPRVPAIDAAGADVSH* |
Ga0105139_10546241 | 3300009995 | Switchgrass Associated | IDAWPIWYRLMELTGAFVSALAPVFAVVHLASARRMLRVPAIDAAGTDISH* |
Ga0134123_135191141 | 3300010403 | Terrestrial Soil | VPPPGAIDAWPIWYRLMDLTGVFVSALAPVCAVARLASAWRRPRVPVIDAAGADVSH* |
Ga0157379_120512531 | 3300014968 | Switchgrass Rhizosphere | VQPPGAIDAWPIWYRLMELTGAFVSALAPVFAVVHLASARRMLRVPAIDAAGADVSH* |
Ga0182183_10337291 | 3300015270 | Switchgrass Phyllosphere | HRVVPLPGAIDASSIWYRVMALTGDFVSALAPVCAVARFASARRRPRAPVIITAGADISH |
Ga0182099_10625581 | 3300015278 | Switchgrass Phyllosphere | VPPPGAIDASTIWYRLMALPGAFASALAPVCAVARLASARRRPIVPASVATGADGLH* |
Ga0182100_10417231 | 3300015280 | Switchgrass Phyllosphere | VPPPGAIDAWSIWYRLMDLTGVFVSALAPVCAVACFASTRCWPRVPAIDAAGADAFH* |
Ga0182105_10167672 | 3300015290 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMELTGAFVSALAPVCAVARFATARRMPKVPAIDAAGADVSH* |
Ga0182105_11009061 | 3300015290 | Switchgrass Phyllosphere | MPPPGAIDAWPIWYRLMDLTDVFVSALAPVCAVARLASAWRRPRVPVIDTAGADVSH* |
Ga0182104_10030873 | 3300015297 | Switchgrass Phyllosphere | AIDAWPIWYGLMDLTGAFVSALAPVCTVARLASARRRPRVPAIDAAGADVSH* |
Ga0182184_10463791 | 3300015301 | Switchgrass Phyllosphere | VPPPGVIDAWLIWNRLMELTGAFVSALAPVFTVVHLASARRMLRVPAIDAAGADVSH* |
Ga0182184_10904172 | 3300015301 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMDLTGVFVSALAPVCAVARLASAWRRPRVPVIDAAGVDVSH* |
Ga0182180_10618591 | 3300015306 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMELTGVFVSALAPVFAVVHFASARRMLRVPA |
Ga0182180_10774411 | 3300015306 | Switchgrass Phyllosphere | MLHKHRVVQPPGAIDAWPIWYRLMELTGAFVSALAPVFAVVHLASARRMLRVPAIDAAGADVSH* |
Ga0182182_10460931 | 3300015311 | Switchgrass Phyllosphere | MPPPGAIDAWPIWYRLMELTGAFVSALAPVFAVVHLASALRMLRVSAIDAAGADVSH* |
Ga0182182_10876181 | 3300015311 | Switchgrass Phyllosphere | IWYRLMDLTGAFVSALAPVCAVARFASARRWPRVLAIDAVSADVSH* |
Ga0182168_10912231 | 3300015312 | Switchgrass Phyllosphere | AIDASSNWYRLMALTGTFVSALTPVCAVARLANARRRPKVLTIVAAGADVSY* |
Ga0182120_10858191 | 3300015315 | Switchgrass Phyllosphere | GAIDAWPIWYRLMDLTGALVNALAPVCAVARLASARRRPRVPAIDAAGADVSH* |
Ga0182120_10974152 | 3300015315 | Switchgrass Phyllosphere | VPLPDAIDASSIWYRVMALTGAFVSALAPVCAMARLASARRRPRVPVIVVAGADTSH* |
Ga0182120_11225281 | 3300015315 | Switchgrass Phyllosphere | MPPPGAIDAWPIWYRLMELTGAFVSALAPVFAMVHLASARRMLRVPAIDAAGADVSH* |
Ga0182136_10039562 | 3300015317 | Switchgrass Phyllosphere | VPPPGAIDVWPIWYRLMDLTGAFVSALAPVCTVARLASARRRPRVPAIDAAGANVSH* |
Ga0182136_10710521 | 3300015317 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMELTSAFVSALAPVFAVVHLASARRMLRVPAIDAAGADVSH* |
Ga0182181_10224201 | 3300015318 | Switchgrass Phyllosphere | VPSPGAIDAWPIWYRLMDLTGVFVSALAPVCAVARLASAWRRPRVPVIDTAGADVSH* |
Ga0182130_10504531 | 3300015319 | Switchgrass Phyllosphere | IDASIIWYRLMTLPGAFVSALAPVCAMTHLASARRRPIVPASVAAGADALY* |
Ga0182130_10842321 | 3300015319 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYGLMDLTGAFVSALAPVCAVARLASARRRPRVPAIDAAGADVSH* |
Ga0182130_11320141 | 3300015319 | Switchgrass Phyllosphere | RVVPPPGAIDAWPIWYGLMDLTGTFVSALAPVCAVMRLASARRRPRVPAIDVAGVDVSH* |
Ga0182134_10143211 | 3300015324 | Switchgrass Phyllosphere | MPPPGAIDAWPIWYQLMDLTSAFVDALAPVCAVARLASARRRPRVPAIDVAGVDVSH* |
Ga0182166_10070961 | 3300015326 | Switchgrass Phyllosphere | IDAWPIWYRLMDLTCVFVSALAPVCAVARLASARRRPRVSAIDAAGADVSH* |
Ga0182114_10593142 | 3300015327 | Switchgrass Phyllosphere | VPPSGAIDAWPIWYRLMELTGAFVSALAPVCAVARLANARCMPRVPAIDAAGADVSH* |
Ga0182114_11335541 | 3300015327 | Switchgrass Phyllosphere | VPPPGAIDVWPIWYRLMELTGAFVCALAPVCAVVRPASARRRPKVPAIVATGTDASH* |
Ga0182153_10749781 | 3300015328 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMDLTGAFVSALAPVCAVARFANARRRPRVPAIDAAGADVSH* |
Ga0182153_11378181 | 3300015328 | Switchgrass Phyllosphere | VPLPGAIDASSIWYRVMALTGAFVNALAPVCAVALLASARRRPRVPVIIAADADTSH* |
Ga0182135_10106542 | 3300015329 | Switchgrass Phyllosphere | VPLPGAIDASFIWYQLMTLTGVFVSALAPVCAVARLTSAWRRPRVPVIDAAGADVSH* |
Ga0182135_10190362 | 3300015329 | Switchgrass Phyllosphere | DAWPIWYRLMALTGVFVSALASVCGVARLANAWRRPKVPAIVATGTNASY* |
Ga0182135_10704841 | 3300015329 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMDLTGVFVGANAPVCAVARLASARRRLRVPAIDAAGADVSH* |
Ga0182117_10688681 | 3300015332 | Switchgrass Phyllosphere | SIWYRLMDLTGAFVSALAPVYAVTHLASARRRPKVPVIDATDTDVSH* |
Ga0182117_10911311 | 3300015332 | Switchgrass Phyllosphere | MPPPGAVDAWPIWYRLMELTGAFVSALAPVCAVARLASARHMPRVPAIDAAGADVSH* |
Ga0182117_11318311 | 3300015332 | Switchgrass Phyllosphere | PPPGAIDAWPIWYRLMYLTGAFVSALALVCAMARLASACRRPRVPAIDAAGDDVSH* |
Ga0182147_10007653 | 3300015333 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMDLTGTFVSALAPVCAVAGLARARRRPRVPVIDAAGADVSH* |
Ga0182147_10425281 | 3300015333 | Switchgrass Phyllosphere | KHWVVPPPGAIDAWPIWYRLMDLTGAFVSALAPVCAVACFASVRCMPRVPGIDAAGADVSH* |
Ga0182147_10700931 | 3300015333 | Switchgrass Phyllosphere | MLHKHRVVPPPGAIDAWPIWYRLMELTGVFVSALAPVFAVVHFASARRMLRVPAIDAAGADISH* |
Ga0182147_11017211 | 3300015333 | Switchgrass Phyllosphere | GAIDASIIWYRLMTLPGAFVIALAPVCAMTHLASARRRLIVPASVAASADVLH* |
Ga0182132_10169061 | 3300015334 | Switchgrass Phyllosphere | GAIDAWPIWYRLMDLTGVFVSALAPVCAVTRLASARRRPRVPAIDAAGANVSH* |
Ga0182116_10001124 | 3300015335 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMDLTGDFVSALAPVCVVARFANARRRPRVPAIDAAGADVSH* |
Ga0182116_10264031 | 3300015335 | Switchgrass Phyllosphere | IDAWPIWYRLMELTGAFVSALAPVFAVVHLASARRMLRVPAIDAAGADVSH* |
Ga0182150_10251371 | 3300015336 | Switchgrass Phyllosphere | VQQPGAIDAWSIWYRLMELTGAFVSALAPVFAVVHLASALRMLRVPAIDAAGADVSH* |
Ga0182150_11030561 | 3300015336 | Switchgrass Phyllosphere | IDASSIWYRVMALTGAFVSALAPVCAVARLASARRRSRVPVIIAAGADTSH* |
Ga0182151_10249852 | 3300015337 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMELTGAFVSALAPVCAVARLASAWRMQRVPAIDAAGADVSH* |
Ga0182151_10944591 | 3300015337 | Switchgrass Phyllosphere | LLHKHRVMPLPGAIDASSIWYRFMALTGAFVSALAPVCAMARLASARRMPRVPVIVVAGADISH* |
Ga0182137_11476151 | 3300015338 | Switchgrass Phyllosphere | MPPPSAVDAWPIWYRLMDLTGVFVSALAPVCAVARLASAWRRPRVPVIDTAGADVSH* |
Ga0182149_10600352 | 3300015339 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMDLTGAFVSALALVCAVARLASARRRPRVPAIDAAGADVSH* |
Ga0182149_10810221 | 3300015339 | Switchgrass Phyllosphere | PIWYRLMDLTGAFVSVLAPVCAVARLTSARRRPRVPAIDAAGADVSH* |
Ga0182149_11433991 | 3300015339 | Switchgrass Phyllosphere | PPGAIDAWPIWYRLIELIGAFVSALAPVCAVVRLASARRRPRVPTIDAASADVSH* |
Ga0182133_10007102 | 3300015340 | Switchgrass Phyllosphere | VPPSGAIDAWPIWYGLMDLTGAFVSALAPVCAVARLASARRRPRVPAIDVAGVDVSH* |
Ga0182133_10285261 | 3300015340 | Switchgrass Phyllosphere | MPPPGAVDAWSIWYRLMDLTGAFVSALAPVCAVACFANARRRSRVPAIDAAGADVSH* |
Ga0182115_10698381 | 3300015348 | Switchgrass Phyllosphere | IDAWPIWYRLMDLTGVFVSALAPVCAMARLASAQRRPRVPAIDAAGADVSH* |
Ga0182115_11483681 | 3300015348 | Switchgrass Phyllosphere | DAWPIWYRLMELTGAFVSALAPVFAVVHLASARRMLRVPVIDAAGADVSY* |
Ga0182185_12708012 | 3300015349 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMDLTGVFVSVLAPVYAVACFASTRCWPRVPAIDAAGADVFH* |
Ga0182163_10961721 | 3300015350 | Switchgrass Phyllosphere | SAIDAWPIWYRLMELTGVFVSALAPVFAVVHLASARRMLRVPAIDAAGADVSH* |
Ga0182163_12294541 | 3300015350 | Switchgrass Phyllosphere | PGAIDAWPIWYRLIELTGAFVSALAPVCAMARLASARRRQRVPTIDAAGADVSH* |
Ga0182169_11349161 | 3300015352 | Switchgrass Phyllosphere | MPPPGAIDAWPIWYRLMDLTGAFVSALAPVCAMARHASARRRPIVPAIDAASADVSH* |
Ga0182169_12299351 | 3300015352 | Switchgrass Phyllosphere | HRFMPPPGAIDAWPIWYRLMDLTGVFVSALAPVCAVARLASAWRRPRVPVIDTAGADVSH |
Ga0182179_10794251 | 3300015353 | Switchgrass Phyllosphere | WPIWYRLMDLTGVFVSALAPVCAVARLASARRRPRVPAIDVAGVDVSH* |
Ga0182179_10838101 | 3300015353 | Switchgrass Phyllosphere | LPGAIDASSIWYRVMALTGAFVSALALVCAVARLASARRRSRVPVIIAAGADTSH* |
Ga0182179_12038531 | 3300015353 | Switchgrass Phyllosphere | WPIWYRLMDLTGVFVSALAPVCAVARLVSAWRRPRVPVIDTAGADVSH* |
Ga0182179_12186351 | 3300015353 | Switchgrass Phyllosphere | WPIWYRLMDLTGVFVSALAPVCAVARLASAWRRPRVPVIDAAGADVSH* |
Ga0182179_12319982 | 3300015353 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMELTGAFVCALAPVCAVARLASTRRRPKVPAIVATGTHASH* |
Ga0182179_12918251 | 3300015353 | Switchgrass Phyllosphere | LLHKHRVVPPPGAIDAWPIWYRLIKLTGVFVCVLASVCAVARLASARRRPKVPAIVATGTHASH* |
Ga0182167_10224103 | 3300015354 | Switchgrass Phyllosphere | VPPPDAIDAWPIWYRLMELTGAFVSALAPVCAVAHLTSARRMPRVPAIDAAGADVSH* |
Ga0182167_10232671 | 3300015354 | Switchgrass Phyllosphere | VPPPGAIDARPIWYRLMDLTGAFVSALAPVCAVARFGNARRRPRVPAIDVAGADVSH* |
Ga0182167_10313782 | 3300015354 | Switchgrass Phyllosphere | AWPIWYRLMELTGAFVSALAPVFAVVHLASARRMLRVPAIDAAGADVSH* |
Ga0182167_10389452 | 3300015354 | Switchgrass Phyllosphere | VPAPSAIDAWPIWYRLMDLTGVFVSALAPVCAVARLASAWRRPRVPVIDAAGADVSH* |
Ga0182167_10483221 | 3300015354 | Switchgrass Phyllosphere | AWTIWYRLMDLTGAFVSALVLVCAVARLASARRRPKVSAIDAAGADVSH* |
Ga0182167_11198671 | 3300015354 | Switchgrass Phyllosphere | AIDAPSIWYRLMALTGAFVSALAPVCAVPRLASARRRPIVPAIDAAGADVSH* |
Ga0182167_12142161 | 3300015354 | Switchgrass Phyllosphere | PYAIDAWPFWYRLKELTGAFVSALAPVCAVERLASARRRPRVPAIDVAGADVSY* |
Ga0182199_10444362 | 3300017412 | Switchgrass Phyllosphere | LHKHRVVPPPGVIDAWPIWYRLIELTGAFVSALAPVFAVVHLASARRMLRVPAIDAASADVPH |
Ga0182199_11001721 | 3300017412 | Switchgrass Phyllosphere | DTWPFWYRLKELTGAFVSALAPVCAVARLASARRRPRVPAIDAAGANVSH |
Ga0182199_11419791 | 3300017412 | Switchgrass Phyllosphere | VPPPGAIDASSIWYRLMALTGAFVSALAPVCAVARLASARRRPRVAAIVATGTNTLYQYRTGWCSGWYF |
Ga0182195_10216941 | 3300017414 | Switchgrass Phyllosphere | HKHRVVPPPGAIDAWPIWYQLMDLTGAFVSALAPVCAVARFASARRWPRVPAIDAAGADVSH |
Ga0182195_10388711 | 3300017414 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMELTGAFVSALAPVFAVVHLASARRMLRVPAIDAAGTDISH |
Ga0182195_10552721 | 3300017414 | Switchgrass Phyllosphere | MPPPGAVDVWPIWYRLMDLTGVFVSALAPVCAVARLASAWRRPRVPVIDAISADVS |
Ga0182195_10718931 | 3300017414 | Switchgrass Phyllosphere | VPLPDAIDASSIWYRVMALTGDFVSALAPVCAMARLASARRMPRVPVIVVAGADISH |
Ga0182195_11482262 | 3300017414 | Switchgrass Phyllosphere | PPGANDAWLIWYRLMDLTGVFVSALAPVCAVVRLASARRRPRVPVIDAAGADVSH |
Ga0182195_12235571 | 3300017414 | Switchgrass Phyllosphere | VPPPGAIDAWSIWYRLMESTGAFVCALAPVCTMACLASARCRPRVPAIVATGTDAL |
Ga0182201_10339121 | 3300017422 | Switchgrass Phyllosphere | PPGAINVWPIWYGLMDLTGAFVSALALVCAVARLASTRRRPRVPAIDAAGADVSH |
Ga0182196_10676011 | 3300017432 | Switchgrass Phyllosphere | CLLHLHRVVPLPDAIDASSIWYRVMALTGDFVSALAPVCAVARFASARRRPRAPVIITAGADISH |
Ga0182200_10938801 | 3300017439 | Switchgrass Phyllosphere | VPSPGAIDAWPIWYRLMELTGAFVCALAPVCAVARLASARRRPKVPAIVASGTHASH |
Ga0182211_10467311 | 3300017694 | Switchgrass Phyllosphere | VPPSGAIDAWPIWYRLMDLTGAFVSALAPVCAVARLASARRRPRVPAIDAAGADVSH |
Ga0207675_1016055531 | 3300026118 | Switchgrass Rhizosphere | VPPPGAIDVWPIWYRLMELTGAFVCALAPVCAVVRLASARRRPKVPAIIATGTDALH |
Ga0268322_10397291 | 3300028049 | Phyllosphere | KNRVVPLPGAIDAWPILYRLMALTGAFVSALSSVCAVARLASARRRPKVPAIVATGTDAS |
Ga0268346_10396041 | 3300028053 | Phyllosphere | MPPPGAIDAWPIWYQLMDLTSAFVDALAPVCAVARLASARRMPRVPVIVVAGADISH |
Ga0268332_10098371 | 3300028058 | Phyllosphere | LPPPGAIDAWPIWYRLIDLTGAFVSAFVPVCAVARLASAWRRPRVPVIDAAGADVSH |
Ga0268332_10367611 | 3300028058 | Phyllosphere | VPPPGAIDAWPIWYRLMDLTGVFVSALAPVCAVARLASARRMPRVPAIDAADVDVSH |
Ga0268342_10405011 | 3300028062 | Phyllosphere | MPPPGAIDAWPIWYRLMDLTGAFVSALAPVCAVTCFISARSRPRVPIIDAAGADVSD |
Ga0268355_10117541 | 3300028139 | Phyllosphere | HRVVPLPDAIDASSIWYRVMALTGDFVSALAPVCAMARLASARRMPRVPVIVVAGADISH |
Ga0268347_10253641 | 3300028142 | Phyllosphere | RFMPPPGAVDAWPIWYRLMDLTGVFVSALAPVCAVARLASAWRRPRVPVIDAAGADVSH |
Ga0268336_10138051 | 3300028152 | Phyllosphere | MPPPGAIDAWPIWYRLMDLTGAFVSALSPVCAVARFACARRWPRVPAIDAAGADVSH |
Ga0268321_1036352 | 3300028466 | Phyllosphere | VPPPGAIDAWPIWYRLMELTGAFVSALAPVFAVVHLASARRMLRVPAIDAAGADVSH |
Ga0268333_10028541 | 3300028467 | Phyllosphere | VPPPGAIDASSIWYRLMALTGAFVSALVPVCAVARLASARRRPRVPTIVAAGADASH |
Ga0214493_10348971 | 3300032465 | Switchgrass Phyllosphere | MPPPGAIDAWPIWYRLMDLTGAFVSALAPVCAVARFASARRWPRVPAIDAAGADVSH |
Ga0214495_10835691 | 3300032490 | Switchgrass Phyllosphere | VPPPGAIDAWANWYRLMDLTGAFVSALAPVCAVARLASARRRPRVPAIDAAGADVSH |
Ga0214490_11184521 | 3300032502 | Switchgrass Phyllosphere | YWVMPPPGAIDAWPIWYRLMDLTSAFVSALAPVCAVRHASARRRPIVPAIDAAGADVSH |
Ga0214490_11246111 | 3300032502 | Switchgrass Phyllosphere | VPPPGAIDASTIWYRLMALSGAFVSALAPVCAVARLASARRRPIVPASVATSVDVLR |
Ga0214489_10078361 | 3300032590 | Switchgrass Phyllosphere | MPPPGAIDAWPIWYRLMDLTGVFVSALAPVCAVARLASAWRRPRVPVIDTAGADVSH |
Ga0214501_11065313 | 3300032625 | Switchgrass Phyllosphere | MPPPGAIDAWSIWYRLMDLTGVFVSVLAPVCAVARLASARRRPRVTAIDAAGADVSH |
Ga0214501_11418242 | 3300032625 | Switchgrass Phyllosphere | VSPPGAIDAWPIWYRLMDLTGAFVSVLAPVCAVARLASARRRLRIPAIDAAGADVSH |
Ga0214497_10081142 | 3300032689 | Switchgrass Phyllosphere | VPPPGAIDAWRIWYRLMDLTGAFVSALAPVCAVARLASARCRPRVPAIDAAGADVSH |
Ga0214499_12870091 | 3300032697 | Switchgrass Phyllosphere | PPPGAIDAWPIWYRLMDLTGVIVSALAPVCAMARLASARRRPRVPAIDAAGADVSH |
Ga0314731_10228342 | 3300032790 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMDLTGAFVSALAPVCAVARLASARCRPRVPAIDAAGADVSH |
Ga0314759_12093512 | 3300033535 | Switchgrass Phyllosphere | VPPPGAIDAWPIWYRLMELTGAFVSALAPVFAMVHLASARRMLRVPAIDTAGADVSH |
⦗Top⦘ |