Basic Information | |
---|---|
Family ID | F074321 |
Family Type | Metagenome |
Number of Sequences | 119 |
Average Sequence Length | 47 residues |
Representative Sequence | ERRDDDHGDHGGAKIVGEGEPATVVIKTSKQQRIKHHSIETKP |
Number of Associated Samples | 71 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 17.86 % |
% of genes near scaffold ends (potentially truncated) | 77.31 % |
% of genes from short scaffolds (< 2000 bps) | 94.12 % |
Associated GOLD sequencing projects | 70 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (84.874 % of family members) |
Environment Ontology (ENVO) | Unclassified (87.395 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (85.714 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.76% β-sheet: 2.82% Coil/Unstructured: 70.42% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 84.87% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.04% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.20% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017681 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300021060 | Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG | Host-Associated | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0065712_107922231 | 3300005290 | Miscanthus Rhizosphere | MRDDDYGDHGGAKIVGEGEPATAVIKMSRQQQIKYYSIETKP* |
Ga0070675_1010948691 | 3300005354 | Miscanthus Rhizosphere | PVAHPERVEARSEVGEATERRDDDHGDHGGAKIVGEEEPATAVIKMSKQHRIKHHSIETKP* |
Ga0070678_1021122191 | 3300005456 | Miscanthus Rhizosphere | SDHYGELCGAKIVGEGEPATAVIKMSKQQLTKDYSIETKP* |
Ga0070672_1009258822 | 3300005543 | Miscanthus Rhizosphere | MRDDDYGDHGGAKIVGKGEPATAVIKMSRQQQIKYYSIETKP* |
Ga0105245_114831111 | 3300009098 | Miscanthus Rhizosphere | ELSDHYGELCGAKIVGEGEPATAVIKMSKQQLTKDYSIETKP* |
Ga0105243_114063811 | 3300009148 | Miscanthus Rhizosphere | DHYGEPSDHYGELCEAKIVGKGEPATAAIKMSKQQLTKDYSIETKP* |
Ga0105242_110458971 | 3300009176 | Miscanthus Rhizosphere | DHYGELSDHYGELCGAKIVGEGEPATAVIKMSKQQLTKDYSIETKP* |
Ga0105246_106421291 | 3300011119 | Miscanthus Rhizosphere | MRDDDYGDHGGAKIVGEGEPATTVIKMSRQQQIKYYSIETKP* |
Ga0157374_116588242 | 3300013296 | Miscanthus Rhizosphere | GGAKERRDDDYGDHGGAKIVGEGEPAATVIKTSKQQRIKHHSIETKP* |
Ga0157374_121444552 | 3300013296 | Miscanthus Rhizosphere | LEQTTVTRDDVHGDHGGAKIVGDGVPVTAVIKTSKQQRIKHHSIETKP* |
Ga0157378_121414431 | 3300013297 | Miscanthus Rhizosphere | ELSDHYGELSDHYGELCGAKIVGEGEPATAVIKMSKQQLTKYYSIETKP* |
Ga0157378_122244681 | 3300013297 | Miscanthus Rhizosphere | MSEVGEATERRDNDHGDHGGAKIVGEGEPATAVIKTSKQQRIKHHSIEMKP* |
Ga0157376_110597431 | 3300014969 | Miscanthus Rhizosphere | HPERVEIRREVGDATERRDDDHGDHGRAKIVGEEEPVTAVIKTSKQHRIKHHSIEMKP* |
Ga0157376_129047802 | 3300014969 | Miscanthus Rhizosphere | MRDDDYGDHGGAKIVGEGEPAAAVIKMSRQQQIKYYSIE |
Ga0182122_10172191 | 3300015267 | Miscanthus Phyllosphere | GDHGGAKIVGEGEPATAVIKMSRQQQIKYYSIETKP* |
Ga0182122_10273513 | 3300015267 | Miscanthus Phyllosphere | HYGELCGVKIVGEGEPATAVIKMSKQQLTKDYSIETKP* |
Ga0182154_10642651 | 3300015268 | Miscanthus Phyllosphere | MRDDDYGDHGGAKIVGEGEPATAVIKMSKQQLIKYYSIETKP* |
Ga0182113_10325191 | 3300015269 | Miscanthus Phyllosphere | ERRDDDHGDHGGAKIVGEGEPATVVIKTSKQQRIKHHSIETKP* |
Ga0182113_10945851 | 3300015269 | Miscanthus Phyllosphere | HDGAKIIGEGEPATAVIKTSKQQRIKHHSIEMKP* |
Ga0182188_10117951 | 3300015274 | Miscanthus Phyllosphere | RRDDDHGDHGGAEIVGEEEPATAVIKMNKQHRIKHHSIETKP* |
Ga0182170_10202901 | 3300015276 | Miscanthus Phyllosphere | SRVGGATEMRDDDYGDHGGAKIVGEGEPATAVIKMSRQQQIKYYSIETKP* |
Ga0182170_10368081 | 3300015276 | Miscanthus Phyllosphere | HPERVEARSEVGEAMERRDDDHGDHGGAKIVGEIEPATAVIKTSKQHRIKHYSIETKP* |
Ga0182170_10378501 | 3300015276 | Miscanthus Phyllosphere | EAPVAHPERVEARREVGDATERRDDDHGDHARAKIVGEEEPATAVIKTSKQHRIKHHSIETKP* |
Ga0182170_10477221 | 3300015276 | Miscanthus Phyllosphere | DHGDHGGAKIVGEEEPATAVIKTSKQHGIKHHSIETKP* |
Ga0182128_10135671 | 3300015277 | Miscanthus Phyllosphere | MRDDDYGDHGGAKIVGEGEPATAVIKMSRQQQSKYYSIKTKP* |
Ga0182128_10244642 | 3300015277 | Miscanthus Phyllosphere | SEVGEATERRDDDHGDHDGAKIVGEEEPVTAVIKTSKQHRIKHHNIETKP* |
Ga0182128_10348981 | 3300015277 | Miscanthus Phyllosphere | SVAHPERVEASSEVGGATERRDDDHGDHGRAKIVGEEEPATVVIKTSKQHRIKHHSIEMKP* |
Ga0182128_10525532 | 3300015277 | Miscanthus Phyllosphere | VEARSEVGEATERRDDDHGDHGGAKIVGEGEPATAVIKMSKQHRIKHHSIETKP* |
Ga0182128_10592041 | 3300015277 | Miscanthus Phyllosphere | VAHPERVGARSEVGEATERRDDDHGDHGRAKIVGEEEPVTTVVKMSNQLWIKY |
Ga0182174_10399741 | 3300015279 | Miscanthus Phyllosphere | EARSEIGEATERRDDVHSDHGGAKIIGDGVPATAVIKTSKQQRIKHHSIETKL* |
Ga0182160_10300881 | 3300015281 | Miscanthus Phyllosphere | RDDDHGDHGGAKIVGEEEPPTAVIKMSKQHRIKHHIIEMKP* |
Ga0182124_10465231 | 3300015282 | Miscanthus Phyllosphere | LSDHYGELCGAKIVGEGEPATAVIKMSKQQLTKYYSIETKP* |
Ga0182156_10179611 | 3300015283 | Miscanthus Phyllosphere | DHGDHGGAKIVGEEEPATVVIKTSKQHRIKHHNIETKP* |
Ga0182156_10338563 | 3300015283 | Miscanthus Phyllosphere | HYGELCEAKIVGEGEPATAVIKMSKQQLTKDYSIKTKPQEH* |
Ga0182176_10253561 | 3300015286 | Miscanthus Phyllosphere | ETMERRDDDHGDHGGAKIVGEGESATAVIKMSKQQRIKHHSNETKP* |
Ga0182176_10591291 | 3300015286 | Miscanthus Phyllosphere | ATSRVGEATEMRDDDYGDHGGAKIVGEGEPATTVIKTSKQHRIKHHCIKTKP* |
Ga0182173_10086781 | 3300015288 | Miscanthus Phyllosphere | MRDDDYGDHDGAKIVGEGEPATAVIKMSRQQQIKYYSIETKP* |
Ga0182173_10113062 | 3300015288 | Miscanthus Phyllosphere | VAHPEHVEARSEVGEATERRDDDHGDHGGAKIVGEGEPATVVIKTSKQQWIKYYSIKTKP |
Ga0182138_10411962 | 3300015289 | Miscanthus Phyllosphere | DHGGAKIVGEGEPAIAVIKMSKQQLTKYYSIETKP* |
Ga0182125_10844742 | 3300015291 | Miscanthus Phyllosphere | DHGGAKIVGEGEPATAVIKMSKQQRIKHHSIEMKP* |
Ga0182141_10364431 | 3300015292 | Miscanthus Phyllosphere | ARREVGDATERRDDDHSDHGRAKIVGEEEPATVVIKTSKQHRIKHHSIETKS* |
Ga0182175_10262581 | 3300015295 | Miscanthus Phyllosphere | GATERRDDDHGDHGGAKVVGDGEPATAVIKTSKQQRIKYYSIKTKP* |
Ga0182175_10326571 | 3300015295 | Miscanthus Phyllosphere | VAHPERVEARSEVGEATERRDDDHGDHSGAKIVGEEEPATAVIKMSKQHRIKHHSIETKP |
Ga0182106_10335881 | 3300015298 | Miscanthus Phyllosphere | ERVEARSEVGEATERRDDDHGDHGGAKIIGEEEPATAVIKTSKQHRIRHHSIETKP* |
Ga0182106_10368531 | 3300015298 | Miscanthus Phyllosphere | GEATERRDDDHGDHGGAKIVGEEESATAVIKTSKQHRIKHHSIETKP* |
Ga0182106_10391932 | 3300015298 | Miscanthus Phyllosphere | RRDDDHGYHGGAKIVSEKESVTAVIKTSKQHRIKHHSIETKP* |
Ga0182106_10625681 | 3300015298 | Miscanthus Phyllosphere | HDRATSRVGGATERHDNNYGDHGRAKIIGEGEPATAVIKMSKQQLTKYYSIERKP* |
Ga0182108_10715332 | 3300015300 | Miscanthus Phyllosphere | GEATERRDDDHGDHGGAKIVSEEESATAVIKTSKQHRIKHHSIEMKP* |
Ga0182143_10366331 | 3300015302 | Miscanthus Phyllosphere | GGATEMRDDDYGDHGGAKIVGEGEPATAVIKMSRQQQIKYYSIETKP* |
Ga0182143_10480582 | 3300015302 | Miscanthus Phyllosphere | EVGEATERHDDDHGDHGGAKIVGEEEPVTAVIKTSKQHRIKHHSIETKP* |
Ga0182143_10594923 | 3300015302 | Miscanthus Phyllosphere | DHGDHSGAKIVGEGEPATAVIKTSKQHRIKHHSIEMKP* |
Ga0182143_11009011 | 3300015302 | Miscanthus Phyllosphere | DDDYGDHGGAKIVGEGEPATTVIKMSRQQQIKYYSIETKP* |
Ga0182123_10244231 | 3300015303 | Miscanthus Phyllosphere | RSEVEEATERRDDDHGDHDGAKIIGEGEPATAVIKTSKQQRIKHHNIEMKS* |
Ga0182123_10842671 | 3300015303 | Miscanthus Phyllosphere | RSEVGEATERRDDGHGDHSKAKIVDEGEPASAVIKTSKQQRIKHRSI* |
Ga0182112_10481331 | 3300015304 | Miscanthus Phyllosphere | RRDDDYGDHGGAKIVGEGEPATAVIKRSKQQLIKYYSIETKL* |
Ga0182112_10622141 | 3300015304 | Miscanthus Phyllosphere | PERVEARREVRDATERRDDDHGDHDGAKIVSEEEPATAVIKMSKQHRIKHHSIETKP* |
Ga0182112_10905551 | 3300015304 | Miscanthus Phyllosphere | DHGGAKIVGEEEPATALIKTSKQHRIKHHSIKMKP* |
Ga0182144_10576591 | 3300015307 | Miscanthus Phyllosphere | VTRDDVHGDHGRGKIVGDVVLATAMGKTTKQQGIKHHGIETKPKVHRSR |
Ga0182144_10823472 | 3300015307 | Miscanthus Phyllosphere | ATERCDDDNGDHGGAKVVSDGEPATAVVKTSKQQQIKYYSIKTKP* |
Ga0182144_10897531 | 3300015307 | Miscanthus Phyllosphere | ATERRDDVHGDHGGANIVDDGVPATAVIKTSKQQRIKHHSIETKP* |
Ga0182142_10387311 | 3300015308 | Miscanthus Phyllosphere | IQEAPVAHPERVEARNEVGEATKRCDDDHGDHGGAKIVGEGEPATAVIKMSKQQWIKYYSIDMKP* |
Ga0182140_10322671 | 3300015314 | Miscanthus Phyllosphere | DHGGAKIVGEEEPVTAVIRTSKQHRIKPHSIEMKP* |
Ga0182140_11020551 | 3300015314 | Miscanthus Phyllosphere | DDHGDHSGAKIVGEEEPATAVIKTSKQHRIKHHSIETKP* |
Ga0182127_10501521 | 3300015321 | Miscanthus Phyllosphere | LKQGIQEAPVAHPERVEARSEIGEATERRDDVHSDHGGAKIIGDGVPATAVIKTSKQQRIKHHSIETKP* |
Ga0182110_10292581 | 3300015322 | Miscanthus Phyllosphere | ELSDHYGELSNHYGDHGGAKIVGEGEPATAVIKMSKQQLIKYYSIETKP* |
Ga0182129_10522861 | 3300015323 | Miscanthus Phyllosphere | VETRREVEDATERRDDDHGDHGGAKIVGEEEPTTVVIKTSKQHGIKHHSIETKP* |
Ga0182129_10747491 | 3300015323 | Miscanthus Phyllosphere | PERVEARREIRDATERRDNDHGDHGGAKIVGEEEPATAVIKTSKQHRIKHHCIKTKP* |
Ga0182129_11146141 | 3300015323 | Miscanthus Phyllosphere | RSEVGEAKERRDDDHGDHGGAKIAGEEEPGTAVIKMSKQHRIKHHSIETKP* |
Ga0182187_10951111 | 3300015341 | Miscanthus Phyllosphere | CVEAKNKAGKATERRDDDHGDHSEAKIIGEGEQATAAIKTSNQQRIKHHNIETKP* |
Ga0182187_11060313 | 3300015341 | Miscanthus Phyllosphere | ATERRDDDHGDHGGVKIFSEKEPMTAVIKTSKQHRIKHHSIEMKP* |
Ga0182109_10676281 | 3300015342 | Miscanthus Phyllosphere | MHDDDYGDHGGAKIVGKGEPATAVIKMSRQQQIKYYSIETKP* |
Ga0182109_11908602 | 3300015342 | Miscanthus Phyllosphere | DHYGELCGAKIVGEGEPATAVIKMSKQQLTKYYSIKTKS* |
Ga0182155_10940521 | 3300015343 | Miscanthus Phyllosphere | DDYGDHGRAKIVGEGEPVTAVIKMSKQQLTKYYSIETKP* |
Ga0182111_11269141 | 3300015345 | Miscanthus Phyllosphere | DHGDHGGAKIVGEEEPATTVIKTSKQHRIKHHSIETKP* |
Ga0182111_11896951 | 3300015345 | Miscanthus Phyllosphere | HGGAKIVGEEEPATTVIKTSKQHRIKHHSIEMKP* |
Ga0182111_12028032 | 3300015345 | Miscanthus Phyllosphere | VTRDDVHDDHGGAKIIGEGVPATAVGKTTKQQWIKHHSIETKL* |
Ga0182111_12189001 | 3300015345 | Miscanthus Phyllosphere | RDDVHGDHGGAKIVGDGVPATAGGKMTKQQGIKHHGIETKP* |
Ga0182139_10574901 | 3300015346 | Miscanthus Phyllosphere | SEVGEATERRDDDHGDHGGAKIVGEGEPATTVIKTSKQHRIKHHNIETKP* |
Ga0182177_11121061 | 3300015347 | Miscanthus Phyllosphere | VEARSEVGEATERRDDDHGDHGGAKIVGEGEPTTAVIKMSKQQRIKHHSIETKP* |
Ga0182177_11150651 | 3300015347 | Miscanthus Phyllosphere | ERRDDDHGDHGGAKIVGEEEPTTTVIQTSKQHRIKHHSIETKP* |
Ga0182161_11253081 | 3300015351 | Miscanthus Phyllosphere | RDDDHGDHGGAKIVGEEEPATAVIKTSKQHKIKHHSIETKP* |
Ga0182161_11800202 | 3300015351 | Miscanthus Phyllosphere | HKARGATERRDDDQSDHGRAKIIGEEEPVTTVIKMSKQQRIKYYSIKTKP* |
Ga0182159_13322492 | 3300015355 | Miscanthus Phyllosphere | ARSEVGEATESRDDDHGDHGGAKIVDEGEPASAVIKTSKQQRIKHRSI* |
Ga0182145_10734052 | 3300015361 | Miscanthus Phyllosphere | ASSKVGEGTERRDDDHGDHSGAKIVGEGEPATAVIKMSKQHRIKHHSIEMKL* |
Ga0182145_11752171 | 3300015361 | Miscanthus Phyllosphere | ARSEVGEATERRDDDHGDHGGAKIVGDEEPATAVIKTSKQHRIKHHSIETKP* |
Ga0182203_10978601 | 3300017404 | Miscanthus Phyllosphere | HPERVKARSEIEEATERRDDVHGDHGGEKIVGDGVPATAVIKTSKQHRIKHHSIETKP |
Ga0182220_10370911 | 3300017407 | Miscanthus Phyllosphere | TERRDNDHGDHGGAKIIGEEEPATAVIKTNKQHRIKHHSIETKP |
Ga0182204_10882581 | 3300017409 | Miscanthus Phyllosphere | YGDHGGAKIVGEGEPATAVIKMSRQQQIKYYSIETKP |
Ga0182204_11022612 | 3300017409 | Miscanthus Phyllosphere | VEGDGQAGGTTERRVDVHGGHGEAEIVDDGEPVTAVGKMTKQQRIKYHSIETKP |
Ga0182207_10868511 | 3300017410 | Miscanthus Phyllosphere | MERRDDDYGDHGGAKIVGEGEPATAVIKTSKQQLTKYYSIETKP |
Ga0182207_11558171 | 3300017410 | Miscanthus Phyllosphere | HSDHGGAKIVGEEEPATAVIKTSKQHRVKHHSIETKP |
Ga0182208_11251941 | 3300017411 | Miscanthus Phyllosphere | ERRDDDHGDHGGAKIVGEEEPTTTVIKMSKQHRIKHHSIETKP |
Ga0182202_10681472 | 3300017415 | Miscanthus Phyllosphere | VAHPERVEARSEVGEATERRDDDHGDHDGAKIVGEEEPATAVIKTSKQHRIKHHSIETKP |
Ga0182202_10970592 | 3300017415 | Miscanthus Phyllosphere | GARSEVGETTERRVDYHGDHGGAEIVDEEEPATAVIKTSKQHRIKHYSIETKS |
Ga0182230_10976921 | 3300017417 | Miscanthus Phyllosphere | MRDDDYGDHGGAKIVGEGEPATAVIKMSKQQLIKYYSIETKP |
Ga0182228_11281181 | 3300017420 | Miscanthus Phyllosphere | DHGDHGGAKIVGEEEPVTAVIKTSKQHRIQHHSIETKP |
Ga0182219_10799732 | 3300017424 | Miscanthus Phyllosphere | DDHGDHGGAKIVGEEEPVTAVIKTSKQHRIKHHSIETKP |
Ga0182224_10986571 | 3300017425 | Miscanthus Phyllosphere | QEAPVAHPERVEARSEVGEATERHDDDHGYHGGAKIVGEGEPATTVIKTSKQHRIKHHCIKTKP |
Ga0182224_11046292 | 3300017425 | Miscanthus Phyllosphere | MERRDDDYGDHGRAKIIGEGEPATAVIKMSKQQLIKYYSIETKP |
Ga0182190_10867942 | 3300017427 | Miscanthus Phyllosphere | VAHPERVEASSEVGEATERRDDDHGDHGGAKIVGEEEPATAVIKTSKQHRIKHHSIETKP |
Ga0182190_11547951 | 3300017427 | Miscanthus Phyllosphere | EARSEVGEATERRDDDHGDHGGAKIVGEEEPATAVIKTSKQHRIKHHSIETKP |
Ga0182206_10971531 | 3300017433 | Miscanthus Phyllosphere | VEARSEVGEATERRDDDHGDHGGAKIVGEGEPATAAIKTHKQQWIKYYSIETKS |
Ga0182206_11050423 | 3300017433 | Miscanthus Phyllosphere | DHGGAEIVGEEEPATAVIKTSKQHRIKHYSIKMKP |
Ga0182209_11275131 | 3300017436 | Miscanthus Phyllosphere | SDHYGELSDHYGELCGAKIVGEGEPATTVIKTSKQHRIKHDSIETKL |
Ga0182209_11707471 | 3300017436 | Miscanthus Phyllosphere | ATVTRDDVHDDHGGAKIIGEGVPATAVGKTTKQQWIKHHSIETKL |
Ga0182191_10632913 | 3300017438 | Miscanthus Phyllosphere | VAHPERVEARSEVGEAMERRDDDHGDHGGAKIVGEIEPATAVIKTSKQHRIKHYSIETKP |
Ga0182191_11228731 | 3300017438 | Miscanthus Phyllosphere | ETGEATVTRDDVHGDHGGAKIVGDGVPATAVGKTTKQHWIKHHSIETKP |
Ga0182221_10447922 | 3300017442 | Miscanthus Phyllosphere | EAPVAHPERVEARSEVGEATERRDDDHGDHGGAKIVSEEEPATTVIKTSKQHRIKHHSIETKP |
Ga0182221_10762411 | 3300017442 | Miscanthus Phyllosphere | DHGGAKIVGEGEPATVVIKTSKQQRIKHHSIETKP |
Ga0182221_11507991 | 3300017442 | Miscanthus Phyllosphere | ARSEVGEATEKRDDDHGDHGGAEIVGEEEPATAVIKTSKQHRIKHYSIETRP |
Ga0182233_10933982 | 3300017680 | Miscanthus Phyllosphere | VAHPERVEARSEVGEATERRDDDHGDHGGAKIVGEEEPATVVIKTSKQHRIKHHSIETKP |
Ga0182226_10823891 | 3300017681 | Miscanthus Phyllosphere | YGELSDHYGKLCGAKIVGEGEPATAVIKMSKQQLTKDYSIETKP |
Ga0182229_10600241 | 3300017682 | Miscanthus Phyllosphere | MERRDDNYGDHGGAKIVGEGEPATVVIKMSKQQLIKYYSIETKP |
Ga0182218_10558021 | 3300017683 | Miscanthus Phyllosphere | ERRDDDHGAHDGAKIVGEGEPVTAVIKTSKQHRIKHHSIETKP |
Ga0182225_11137762 | 3300017684 | Miscanthus Phyllosphere | GEATERRDDDHGDHGGAKIIGEGESATAVIKTSKQQRIKHHSIETKP |
Ga0182232_10227301 | 3300021060 | Phyllosphere | MRDDDYGDHGGAKIVGEGEPATAVIKMSRQQQIKYYSIETKP |
Ga0207688_104560341 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDDNYGDHGGAKIVGEGEPATAVIKMSKQQLTKDYSIETKP |
Ga0207643_110092721 | 3300025908 | Miscanthus Rhizosphere | EVGDATERRDDDHGDHGKAKIVGEEEPATVVIKTSKQHRIKHHSIEMKP |
Ga0207709_115411151 | 3300025935 | Miscanthus Rhizosphere | MRDDDYGDHGGAKIVGKGEPATAVIKMSRQQQIKYYSIETKP |
⦗Top⦘ |