Basic Information | |
---|---|
Family ID | F074530 |
Family Type | Metagenome |
Number of Sequences | 119 |
Average Sequence Length | 43 residues |
Representative Sequence | MSASHHPTDIHLRQHRAKKRNKLRARIAAAPATGRAALEA |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.16 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 97.48 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (59.664 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.126 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.092 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.664 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.59% β-sheet: 0.00% Coil/Unstructured: 54.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF00753 | Lactamase_B | 3.36 |
PF09957 | VapB_antitoxin | 2.52 |
PF03551 | PadR | 2.52 |
PF00270 | DEAD | 2.52 |
PF13564 | DoxX_2 | 1.68 |
PF01915 | Glyco_hydro_3_C | 1.68 |
PF01541 | GIY-YIG | 0.84 |
PF01564 | Spermine_synth | 0.84 |
PF04273 | BLH_phosphatase | 0.84 |
PF08281 | Sigma70_r4_2 | 0.84 |
PF13276 | HTH_21 | 0.84 |
PF00903 | Glyoxalase | 0.84 |
PF13602 | ADH_zinc_N_2 | 0.84 |
PF06983 | 3-dmu-9_3-mt | 0.84 |
PF01636 | APH | 0.84 |
PF13620 | CarboxypepD_reg | 0.84 |
PF13565 | HTH_32 | 0.84 |
PF14255 | Cys_rich_CPXG | 0.84 |
PF13360 | PQQ_2 | 0.84 |
PF00271 | Helicase_C | 0.84 |
PF01850 | PIN | 0.84 |
PF01381 | HTH_3 | 0.84 |
PF13883 | Pyrid_oxidase_2 | 0.84 |
PF12681 | Glyoxalase_2 | 0.84 |
PF13709 | DUF4159 | 0.84 |
PF13242 | Hydrolase_like | 0.84 |
PF00069 | Pkinase | 0.84 |
PF01548 | DEDD_Tnp_IS110 | 0.84 |
PF00857 | Isochorismatase | 0.84 |
PF07714 | PK_Tyr_Ser-Thr | 0.84 |
PF00171 | Aldedh | 0.84 |
PF01545 | Cation_efflux | 0.84 |
PF00326 | Peptidase_S9 | 0.84 |
PF03466 | LysR_substrate | 0.84 |
PF06439 | 3keto-disac_hyd | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 6.72 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.52 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.52 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.52 |
COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 1.68 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.84 |
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.84 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.84 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.84 |
COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.84 |
COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.84 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.84 |
COG3453 | Predicted phosphohydrolase, protein tyrosine phosphatase (PTP) superfamily, DUF442 family | General function prediction only [R] | 0.84 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.84 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.84 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.84 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 59.66 % |
Unclassified | root | N/A | 40.34 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459007|GJ61VE201EGW9A | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
2170459020|G1P06HT01E2546 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
3300000891|JGI10214J12806_13718141 | Not Available | 522 | Open in IMG/M |
3300000953|JGI11615J12901_10262451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Pseudoroseicyclus → Pseudoroseicyclus tamaricis | 579 | Open in IMG/M |
3300000956|JGI10216J12902_105571411 | All Organisms → cellular organisms → Bacteria | 1509 | Open in IMG/M |
3300001305|C688J14111_10271639 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300002155|JGI24033J26618_1046581 | Not Available | 615 | Open in IMG/M |
3300005293|Ga0065715_10768278 | Not Available | 623 | Open in IMG/M |
3300005294|Ga0065705_10372345 | Not Available | 922 | Open in IMG/M |
3300005444|Ga0070694_100475030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 991 | Open in IMG/M |
3300005444|Ga0070694_101318168 | Not Available | 608 | Open in IMG/M |
3300005455|Ga0070663_100594415 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
3300005456|Ga0070678_101904338 | Not Available | 562 | Open in IMG/M |
3300005518|Ga0070699_100816417 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 853 | Open in IMG/M |
3300005534|Ga0070735_10657052 | Not Available | 620 | Open in IMG/M |
3300005549|Ga0070704_101742012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
3300005566|Ga0066693_10356473 | Not Available | 590 | Open in IMG/M |
3300005617|Ga0068859_101887778 | Not Available | 660 | Open in IMG/M |
3300005840|Ga0068870_10123372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → unclassified Piscirickettsiaceae → Piscirickettsiaceae bacterium | 1495 | Open in IMG/M |
3300005844|Ga0068862_100808670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → unclassified Acidimicrobiia → Acidimicrobiia bacterium | 916 | Open in IMG/M |
3300006028|Ga0070717_10759103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
3300006042|Ga0075368_10133944 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
3300006046|Ga0066652_100666748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 987 | Open in IMG/M |
3300006047|Ga0075024_100353447 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira | 735 | Open in IMG/M |
3300006048|Ga0075363_100412106 | Not Available | 795 | Open in IMG/M |
3300006844|Ga0075428_102701983 | Not Available | 506 | Open in IMG/M |
3300006845|Ga0075421_101015741 | Not Available | 938 | Open in IMG/M |
3300006852|Ga0075433_10271591 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
3300006852|Ga0075433_11000797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 728 | Open in IMG/M |
3300006871|Ga0075434_100898810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_64_15 | 900 | Open in IMG/M |
3300006880|Ga0075429_101855329 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300006904|Ga0075424_101075057 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 857 | Open in IMG/M |
3300006918|Ga0079216_10248730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1014 | Open in IMG/M |
3300006954|Ga0079219_11392513 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300006969|Ga0075419_10588834 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 780 | Open in IMG/M |
3300009094|Ga0111539_12995910 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300009147|Ga0114129_12009306 | Not Available | 699 | Open in IMG/M |
3300009156|Ga0111538_14023895 | Not Available | 508 | Open in IMG/M |
3300009162|Ga0075423_10413378 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
3300009162|Ga0075423_11005040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 886 | Open in IMG/M |
3300009177|Ga0105248_13188106 | Not Available | 522 | Open in IMG/M |
3300010403|Ga0134123_12247578 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
3300011430|Ga0137423_1132336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300011437|Ga0137429_1114991 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
3300012212|Ga0150985_122985898 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300012228|Ga0137459_1208290 | Not Available | 570 | Open in IMG/M |
3300012582|Ga0137358_10548106 | Not Available | 778 | Open in IMG/M |
3300012898|Ga0157293_10174592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 627 | Open in IMG/M |
3300012898|Ga0157293_10281289 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300012899|Ga0157299_10069769 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 840 | Open in IMG/M |
3300012912|Ga0157306_10101714 | Not Available | 834 | Open in IMG/M |
3300014325|Ga0163163_12093486 | Not Available | 625 | Open in IMG/M |
3300014326|Ga0157380_11325574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
3300015371|Ga0132258_10982084 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
3300015371|Ga0132258_11375031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1784 | Open in IMG/M |
3300015372|Ga0132256_100858960 | Not Available | 1024 | Open in IMG/M |
3300015372|Ga0132256_101602240 | Not Available | 761 | Open in IMG/M |
3300015372|Ga0132256_101706451 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300015372|Ga0132256_102023526 | Not Available | 682 | Open in IMG/M |
3300015372|Ga0132256_103545706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300015373|Ga0132257_101258464 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
3300015373|Ga0132257_103250762 | Not Available | 592 | Open in IMG/M |
3300015374|Ga0132255_102955728 | Not Available | 726 | Open in IMG/M |
3300015374|Ga0132255_103830396 | Not Available | 639 | Open in IMG/M |
3300018073|Ga0184624_10060097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1560 | Open in IMG/M |
3300018422|Ga0190265_11145083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
3300018429|Ga0190272_11622920 | Not Available | 665 | Open in IMG/M |
3300018469|Ga0190270_10591091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1079 | Open in IMG/M |
3300018469|Ga0190270_12207715 | Not Available | 611 | Open in IMG/M |
3300018469|Ga0190270_12389791 | Not Available | 590 | Open in IMG/M |
3300018476|Ga0190274_12691845 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300018476|Ga0190274_12797523 | Not Available | 584 | Open in IMG/M |
3300019361|Ga0173482_10376596 | Not Available | 652 | Open in IMG/M |
3300019362|Ga0173479_10846099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 511 | Open in IMG/M |
3300019377|Ga0190264_11619227 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300021519|Ga0194048_10301726 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300022886|Ga0247746_1061914 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300023073|Ga0247744_1019418 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
3300023261|Ga0247796_1125893 | Not Available | 508 | Open in IMG/M |
3300025319|Ga0209520_10516946 | Not Available | 698 | Open in IMG/M |
3300025899|Ga0207642_11116695 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300025905|Ga0207685_10486951 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300025917|Ga0207660_10854062 | Not Available | 743 | Open in IMG/M |
3300025918|Ga0207662_10629977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 748 | Open in IMG/M |
3300025920|Ga0207649_10312905 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1151 | Open in IMG/M |
3300025926|Ga0207659_10757933 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300025926|Ga0207659_11847404 | Not Available | 513 | Open in IMG/M |
3300025927|Ga0207687_11730923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
3300025928|Ga0207700_10819388 | Not Available | 833 | Open in IMG/M |
3300025930|Ga0207701_10808750 | Not Available | 789 | Open in IMG/M |
3300025936|Ga0207670_11751405 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300025942|Ga0207689_11000607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes | 705 | Open in IMG/M |
3300025942|Ga0207689_11167759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 648 | Open in IMG/M |
3300026041|Ga0207639_10652468 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300026088|Ga0207641_11052107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 812 | Open in IMG/M |
3300026089|Ga0207648_11603166 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300027252|Ga0209973_1040356 | Not Available | 683 | Open in IMG/M |
3300027866|Ga0209813_10472428 | Not Available | 516 | Open in IMG/M |
3300027876|Ga0209974_10257600 | Not Available | 658 | Open in IMG/M |
3300028065|Ga0247685_1032572 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
3300028608|Ga0247819_10834024 | Not Available | 573 | Open in IMG/M |
3300028803|Ga0307281_10242593 | Not Available | 660 | Open in IMG/M |
3300030339|Ga0311360_11223718 | Not Available | 590 | Open in IMG/M |
3300030620|Ga0302046_10923586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
3300031226|Ga0307497_10460933 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium RIFCSPLOWO2_12_FULL_64_8 | 620 | Open in IMG/M |
3300031455|Ga0307505_10022212 | All Organisms → cellular organisms → Bacteria | 2924 | Open in IMG/M |
3300031854|Ga0310904_10462414 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300031858|Ga0310892_10275686 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300031908|Ga0310900_10011003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4453 | Open in IMG/M |
3300031908|Ga0310900_11564076 | Not Available | 557 | Open in IMG/M |
3300031940|Ga0310901_10339021 | Not Available | 641 | Open in IMG/M |
3300031943|Ga0310885_10832983 | Not Available | 525 | Open in IMG/M |
3300032003|Ga0310897_10726560 | Not Available | 500 | Open in IMG/M |
3300032017|Ga0310899_10300474 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
3300032180|Ga0307471_101637797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_68_18 | 799 | Open in IMG/M |
3300032205|Ga0307472_101140999 | Not Available | 740 | Open in IMG/M |
3300033550|Ga0247829_10608730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 908 | Open in IMG/M |
3300034690|Ga0364923_0117019 | Not Available | 679 | Open in IMG/M |
3300034819|Ga0373958_0112080 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.13% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.40% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.88% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 5.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.20% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.20% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 4.20% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.52% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.68% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.68% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.68% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.68% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.84% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.84% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.84% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.84% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.84% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
2170459020 | Litter degradation NP2 | Engineered | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006042 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
3300023073 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5 | Environmental | Open in IMG/M |
3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300028065 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK26 | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
L02_00771110 | 2170459007 | Grass Soil | MSASHHPTDTHLRQQRKKKRNKLRARIAAAPAAGRAVLEAKVQRTYSL |
2NP_02902390 | 2170459020 | Switchgrass, Maize And Mischanthus Litter | MSASHHPTDIHLRQQRKKKRNKLRARIAAAPAAGRAVLEAKVQRT |
JGI10214J12806_137181411 | 3300000891 | Soil | MSASHRRTDIHRRQHRVAKRKKLRARIAAAPATGAAFEAKLRRTYS |
JGI11615J12901_102624511 | 3300000953 | Soil | MSASHHPTDIHLRQHRAKKRNKLRARIAAAPAAGRAALEA |
JGI10216J12902_1055714111 | 3300000956 | Soil | MSASHHPTDIHRRQQRKNKRNRLRARIAAAPAFGFAALEAKLQRTY |
C688J14111_102716392 | 3300001305 | Soil | MSASHKATDTHLRQHRLKKRAKLRARIAAAPASGRPALEAKVQRTYS |
JGI24033J26618_10465812 | 3300002155 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASHRRTDIHRRQYRKAKRDKLRARIAAASVSATGRAAFEAKLQ |
Ga0065715_107682781 | 3300005293 | Miscanthus Rhizosphere | MSASHTPTDLHLRQHRAKKRNKLRARIAASPMVGRAALEAKVL |
Ga0065705_103723451 | 3300005294 | Switchgrass Rhizosphere | MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGRAALEAKVLRTYS |
Ga0070694_1004750302 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGRAALEAK |
Ga0070694_1013181683 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASHHPTDTHLRQHRLKKRNKLRARIAAAPATGRAALEAKVQR |
Ga0070663_1005944152 | 3300005455 | Corn Rhizosphere | MSASHHPTDVHLRQHRLKKRNKLRARIAAAPAHGRAALEAKVLKTFSPF |
Ga0070678_1019043381 | 3300005456 | Miscanthus Rhizosphere | MSASHHPTDVHLRQHRTKKRDKLRARIAASPMVGRAALEAKVQRTY |
Ga0070699_1008164172 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASHHPTDIHLRQHRAKKRNKLRARIAAASATGRAVLEAKLQR |
Ga0070735_106570521 | 3300005534 | Surface Soil | MSASHHPADIHRRQQRKKKRNKLRARIAAAPAVGRAALEAKVQR |
Ga0070704_1017420121 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASHHPTDMHLRQHRLKKRNKLRARIAAAPAAGRAALEAKVQR |
Ga0066693_103564731 | 3300005566 | Soil | MSASHHPTDIHRRQQRKKKRNKLRARIAAAPAVGRAALEAKVQRT |
Ga0068859_1018877784 | 3300005617 | Switchgrass Rhizosphere | MSASHHPTDIHLRQHRTKKRNKLRARIAAAPASGRAALEAKLQRTYSPFH |
Ga0068870_101233724 | 3300005840 | Miscanthus Rhizosphere | MIMSASHHPTDIHLRQHRSKKRDKLRARIAAAPATG |
Ga0068862_1008086701 | 3300005844 | Switchgrass Rhizosphere | MSASHHPTDTHLRQHRAKKRAKLRARIAAAPATGRAA |
Ga0070717_107591033 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASHHPTDIHRRQHRRKKRNKLRARIAAAPAVGRAALE |
Ga0075368_101339441 | 3300006042 | Populus Endosphere | MSASHRPTDIHLRQHRAKKRNKLLARIAAAPASGRAALEARVQRTYSP |
Ga0066652_1006667481 | 3300006046 | Soil | MSASHHPTDTHLRQHRAKKRAKLRARLAAAPPAGRAALE |
Ga0075024_1003534471 | 3300006047 | Watersheds | MSASHHPTDVHLRQHRAKKRDNLRARIAAAPTTGRAALEAKVQRTY |
Ga0075363_1004121061 | 3300006048 | Populus Endosphere | MSASHRPTDIHLRQHRAKKRGKLRARIAAAPAAGRTALEARVRRTYSPFH |
Ga0075428_1027019831 | 3300006844 | Populus Rhizosphere | MSASHRRTDIHRRQQRTKKRNKLRARIAAAPATGLDALEAKVQRTYSP |
Ga0075421_1010157413 | 3300006845 | Populus Rhizosphere | MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGRAALEAKVQR |
Ga0075433_102715913 | 3300006852 | Populus Rhizosphere | MSASHHPTDIHLRQHRTKKRDKLRARIAAAPATGRAALEAKVQR |
Ga0075433_110007972 | 3300006852 | Populus Rhizosphere | MSASHHPTDIHLRRQRKKKRNKLRARIAAAPAAGRAV |
Ga0075434_1008988102 | 3300006871 | Populus Rhizosphere | MSASHHPTDIHLRQHRAKKRNKLRARIAAASATGRAVLEAKLQRTYS |
Ga0075429_1018553292 | 3300006880 | Populus Rhizosphere | MSASHRPTDIHLRQHRAKKRNKLRARIAAAPATGRAA |
Ga0075424_1010750571 | 3300006904 | Populus Rhizosphere | MSASHHPTDIHLRQHRAKKRNKLRARIAAASATGRAVLEA |
Ga0079216_102487303 | 3300006918 | Agricultural Soil | MSASHRPTDIHLRQHRAKKRGKLRARIAAAPETGRAALEAKVQR |
Ga0079219_113925132 | 3300006954 | Agricultural Soil | MSASHHPTDIHLRQHRAKKRNKLRARIAAAPATGRAALE |
Ga0075419_105888343 | 3300006969 | Populus Rhizosphere | MSASRRPTDTHLRQHRAKKRNKLRARIAAAPATGRAA |
Ga0111539_129959102 | 3300009094 | Populus Rhizosphere | MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGR |
Ga0114129_120093063 | 3300009147 | Populus Rhizosphere | MSASHRPTDIHRRQHRVAKRNKLRARIAAEPTKRAALEAKLQRTYS |
Ga0111538_140238952 | 3300009156 | Populus Rhizosphere | MSASHHPTDIHLRQHRAKKRNKLRARIAAAPPTGRAALEA |
Ga0075423_104133782 | 3300009162 | Populus Rhizosphere | MSASHHPTDIHLRRHRAKKRNKLRARIAAAPATGRAALEA |
Ga0075423_110050402 | 3300009162 | Populus Rhizosphere | MSASHHPTDVHLRQHRAKKRNKLRARIAAAPTTGRAALEAKV |
Ga0105248_131881061 | 3300009177 | Switchgrass Rhizosphere | MSASHHPTDIHLRQHRLKKRNKLRARIAAAPASGRA |
Ga0134123_122475782 | 3300010403 | Terrestrial Soil | MSASHHPTDIHLRRHRAKKRNKLRARIAAAPATGRAALEAK |
Ga0137423_11323363 | 3300011430 | Soil | MIMSASHKPTDTHLRQHRVKKRNKLRARIAAAPATGRAALEAKV |
Ga0137429_11149913 | 3300011437 | Soil | MIMSASHKPTDTHLRQHRVKKRNKLRARIAAAPATGRAALEAKL |
Ga0150985_1229858983 | 3300012212 | Avena Fatua Rhizosphere | MSASHRRTDIHRRQQRIKKRKKLQARIAAAPPTGRAALEARVLKTYSVF |
Ga0137459_12082902 | 3300012228 | Soil | MSASHRPTDIHLRQHRAKKRDKLRGRIAAAPASGRAALEA |
Ga0137358_105481062 | 3300012582 | Vadose Zone Soil | MIMSASHKPTDTHLRQHRAKKRNKLRARIAAAPATGRAALEAKVQRTYSPS |
Ga0157293_101745922 | 3300012898 | Soil | MSASHRPTDIHLRQHRLKKRNKLRGRIAAAPANGRAALE |
Ga0157293_102812891 | 3300012898 | Soil | MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATGRAVLEAKVLRT |
Ga0157299_100697691 | 3300012899 | Soil | MSESHHPTDIHLRQNRAKKRDKLRARIAAAPATGRAV |
Ga0157306_101017142 | 3300012912 | Soil | MIMSASHHPTDIHLRQHRLKKREKLRARIAAAPATGRAALEA |
Ga0163163_120934861 | 3300014325 | Switchgrass Rhizosphere | MSASHRPTDIHLRQHREKKRNKLRARIAAAPAAGRAALEARVLRT |
Ga0157380_113255741 | 3300014326 | Switchgrass Rhizosphere | MIMSASHKPTDTHLRQHRVKKRNKLRARIAAAPATGRAAL |
Ga0132258_109820841 | 3300015371 | Arabidopsis Rhizosphere | MSQSHRPTDIHLRQHRLKKRNKLRARIAAAPATGRAALEARVLRTYS |
Ga0132258_113750311 | 3300015371 | Arabidopsis Rhizosphere | MIMSASHHPTDIHLRQHRAKKRNKLRARIAAAPAT |
Ga0132256_1008589602 | 3300015372 | Arabidopsis Rhizosphere | MSASHRPTDIHLRQHRTKKRNKLRARIAAAPATGRAALEA |
Ga0132256_1016022401 | 3300015372 | Arabidopsis Rhizosphere | MSASHHPTDIHLRQHRAKKRNKLRARIAAAPATGR |
Ga0132256_1017064512 | 3300015372 | Arabidopsis Rhizosphere | MSASHHPTDVHLRQHRAKKRAKLRARIAAGPASGRAALEARVLR |
Ga0132256_1020235262 | 3300015372 | Arabidopsis Rhizosphere | MIMSASHHPTDIHLRQHRAKKRDKLRARIAAAPATARAALEAKVQRTYS |
Ga0132256_1035457062 | 3300015372 | Arabidopsis Rhizosphere | MSASHHPTDIHLRQHRAKKRHKLRARIAAAPTTGRAAL |
Ga0132257_1012584642 | 3300015373 | Arabidopsis Rhizosphere | MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATGRAALEAKLLRTYS |
Ga0132257_1032507621 | 3300015373 | Arabidopsis Rhizosphere | MSASHRRTDIHRRQHRLAKRNKLRARIAAAPATGRAASEAKLQRTYSP |
Ga0132255_1029557281 | 3300015374 | Arabidopsis Rhizosphere | MSASHHPTDTHLRQHPARKRNKLRARIAAAPAAGRAAL |
Ga0132255_1038303961 | 3300015374 | Arabidopsis Rhizosphere | MSASHHPTDIHLRRHRAKKRNKLRARIAAAPATGRAALEAKVQRTYS |
Ga0184624_100600974 | 3300018073 | Groundwater Sediment | MSASHRPTDIHLRQYRVKKRNKLRARIAAAPATERAALE |
Ga0190265_111450832 | 3300018422 | Soil | MSASHRPTDIHLRQHRTKKRDKLRARIAAAPATGRAALEA |
Ga0190272_116229201 | 3300018429 | Soil | MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATGRAAL |
Ga0190270_105910911 | 3300018469 | Soil | SHHPTDIHLRQHRAKKRNKLRARIAAAPAAGRAALEAKVQRTY |
Ga0190270_122077151 | 3300018469 | Soil | MSASHRPTDIHRRQHRVKKRNKLRARIAAAPVGRAALEAKVQRTY |
Ga0190270_123897911 | 3300018469 | Soil | MSASHHPTDIHLRQHRTKKRNKLRARIAAAPATGRAALEAR |
Ga0190274_126918451 | 3300018476 | Soil | MSASHHPTDIHLRQHRAKKRSKLLARIAAAPASGRAALEA |
Ga0190274_127975231 | 3300018476 | Soil | MSASHRPTDIHRRQHRVKKRNKLRARIAAAPATGRTAFEAKLQRTYS |
Ga0173482_103765962 | 3300019361 | Soil | MSASHRPTDIHLRQHRTKKRNKLRARIAAAPATGRAALEARVLR |
Ga0173479_108460991 | 3300019362 | Soil | MSASHRPTDIHLRQHRLKKRNKLRGRIAAAPANGRAALEARVL |
Ga0190264_116192272 | 3300019377 | Soil | MSASHHPNDIHLRQHRAKKRDKLRARIAAAPATGRAALE |
Ga0194048_103017262 | 3300021519 | Anoxic Zone Freshwater | MSASRIHNYLHLSRHRAKKRAKLKARIAAAPIAERAALEARVLR |
Ga0247746_10619141 | 3300022886 | Soil | MSASHHPTDIHLRQHRAKKRDKLLARIAAAPATGRAVLEAKVLRTYSPF |
Ga0247744_10194181 | 3300023073 | Soil | MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATGRAVLEAKVLRTYSPF |
Ga0247796_11258932 | 3300023261 | Soil | MSASHHPTDIHLRQHRLKKREKLRARIAAAPATGRAALEAKVQRTY |
Ga0209520_105169461 | 3300025319 | Soil | MSASHHPTDTHLRQHRAKKRDKLRARIAAAPATARAALEAKL |
Ga0207642_111166952 | 3300025899 | Miscanthus Rhizosphere | MSASHRPTDIHRRQHRVKKRNKLRARIAAAPATGRTTFEAKLLRTYSR |
Ga0207685_104869511 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASHHPTDIHLRQHRAKKRNKLRARIAAASATGRAALEAKVQRTYSP |
Ga0207660_108540621 | 3300025917 | Corn Rhizosphere | MSASHHPTDIHLRQHRAKKRNKLRARIAAAPASGRAALEAKLQRT |
Ga0207662_106299771 | 3300025918 | Switchgrass Rhizosphere | MSASHRRTDIHLRQHREKKRNKLRARIAAAPATGRAALEVKV |
Ga0207649_103129051 | 3300025920 | Corn Rhizosphere | MSASHRRTDIHLRQHREKKRNKLRARIAAAPATGRA |
Ga0207659_107579331 | 3300025926 | Miscanthus Rhizosphere | MSASHHPTDIHLRQHRAKKRNKLRARIAAAPPTGR |
Ga0207659_118474042 | 3300025926 | Miscanthus Rhizosphere | MSASHHPTDIHLRQHRANKRAKLLARIAAAPAAGRAALEARVQRTYS |
Ga0207687_117309232 | 3300025927 | Miscanthus Rhizosphere | MSASHHPTDIHLRQHRAKKRNKLRARIAAAPAVAVAALEARV |
Ga0207700_108193881 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASHHPTDIHLRQKRKKKRDNLRARIAAAPAAGRAALEAKVQ |
Ga0207701_108087501 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MSASHRPTDIHLRQHRAKKRDKLRARIAAAPATGRAALEAKLQRTYSPF |
Ga0207670_117514052 | 3300025936 | Switchgrass Rhizosphere | MSASHRPTDIHRRQHRVKKRNKLRARIAAAPATGRTTFEAKL |
Ga0207689_110006071 | 3300025942 | Miscanthus Rhizosphere | MSASHHPTDIHLRQHRAKKRNKLRARIAAAPASGRAALEAKVQ |
Ga0207689_111677591 | 3300025942 | Miscanthus Rhizosphere | MSASHHPTDIHLRQHRAKKRDKLRALIAAAPTTGRAALEA |
Ga0207639_106524681 | 3300026041 | Corn Rhizosphere | MSASHHPTDVHLRQHRAKKRAKLRARIAAGPASVRAALEARVLRTYSPFH |
Ga0207641_110521071 | 3300026088 | Switchgrass Rhizosphere | MSASHHPTDIHLRQHRLEKRNKLRARLAAAPATGRAALEARLQRTYSPF |
Ga0207648_116031661 | 3300026089 | Miscanthus Rhizosphere | MSASHHPTDMHLRQHRLKKRNKLRARIAAAPAAGRAALEARVL |
Ga0209973_10403562 | 3300027252 | Arabidopsis Thaliana Rhizosphere | MSASHHPTDIHLRQHRAKKRKKLRARIAAAPATGRASLEAKLQR |
Ga0209813_104724282 | 3300027866 | Populus Endosphere | MSASHRPTDIHLRQHRTKKREKLRARIAAAPATGRAALEARVR |
Ga0209974_102576001 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MSASHRPTDIHLRQHRLKKRNKLRARIAAASAAGRPA |
Ga0247685_10325723 | 3300028065 | Soil | MSASHHPTDVHLRQHRTKKRDKLRARIAASPMVGRA |
Ga0247819_108340241 | 3300028608 | Soil | MSASHRRTDIHRRQYRKAKRDKLRARIATASVSATGRAAFEAKLQRTYSP |
Ga0307281_102425931 | 3300028803 | Soil | MSASHRPTDIHLRQHRAKKRDKLLARIAAAPATGRAALEARVQ |
Ga0311360_112237181 | 3300030339 | Bog | MSASHTPTDLHLRQHRIKKRNKLRARIAAAPASGRAALEAKVLRT |
Ga0302046_109235861 | 3300030620 | Soil | MSASHRRTDIHLRQHRTKKRDKLRARIAAAPAIERAPLEAKVQRTYSA |
Ga0307497_104609332 | 3300031226 | Soil | MSASHHPTDQHLRQHRAEKRAKLRARIAAAPTTGR |
Ga0307505_100222125 | 3300031455 | Soil | MSASHRPTDIHLRQHRVKKRKKLLARIAAGPATARAALEARVLRTF |
Ga0310904_104624142 | 3300031854 | Soil | MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGRA |
Ga0310892_102756861 | 3300031858 | Soil | MSASHHPTDIHLRQHRAKKRNKLRARIAAAPATGRAALEA |
Ga0310900_100110031 | 3300031908 | Soil | MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATERAALEARVQRTYSP |
Ga0310900_115640763 | 3300031908 | Soil | MSASHHPTDVHLRQHRTKKRDKLRARIAASPMVGRAAL |
Ga0310901_103390212 | 3300031940 | Soil | MSASHRPTDIHRRQHRLKKRNKLRARIAAAPATGRAAFEAKLK |
Ga0310885_108329831 | 3300031943 | Soil | VSASHHPTDIHLRQHRAKKRNKLRARIAAAPATGRAALEAKLQRTYSPSH |
Ga0310897_107265601 | 3300032003 | Soil | LSASHHPTDIHLRQHRLKKRNKLRARIAAAPVTGRAALEAKV |
Ga0310899_103004741 | 3300032017 | Soil | MSQSQHPTVVHLRRHRAKKRNKLRARIAAAPASTGRAALEA |
Ga0307471_1016377972 | 3300032180 | Hardwood Forest Soil | MSASHHPTDIHLRQHRVKKRNKLRARIAAAPASGR |
Ga0307472_1011409991 | 3300032205 | Hardwood Forest Soil | MSASHHPTDIHLRQHRAKKRDKLRARIAAAPATGRAALEARMQRTYSPF |
Ga0247829_106087302 | 3300033550 | Soil | MSASHRPTDIHLRQHRAKKRNKLRARIAAAPATGRAALEAKVQRTYSPFH |
Ga0364923_0117019_537_677 | 3300034690 | Sediment | MSASHKPTDTHLRQHRVKKRNKLRARIAAAPATGRAALEAKVQRTYS |
Ga0373958_0112080_3_116 | 3300034819 | Rhizosphere Soil | MSASHHPTDVHLRQHRAKKRNKLRARIAAAPATGRAAL |
⦗Top⦘ |