Metagenome / Metatranscriptome Family F074596

Basic Information
Family ID	F074596
Family Type	Metagenome / Metatranscriptome
Number of Sequences	119
Average Sequence Length	42 residues
Representative Sequence	WVSDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF
Number of Associated Samples	101
Number of Associated Scaffolds	119

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	94.96 %
Associated GOLD sequencing projects	96
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.45

Most Common Taxonomy
Group	Bacteria (72.269 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (37.815 % of family members)
Environment Ontology (ENVO)	Unclassified (43.697 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (55.462 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 17.39% β-sheet: 0.00% Coil/Unstructured: 82.61%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 119 Family Scaffolds
PF12697	Abhydrolase_6	10.08
PF00296	Bac_luciferase	5.88
PF02515	CoA_transf_3	4.20
PF04376	ATE_N	3.36
PF04377	ATE_C	2.52
PF01790	LGT	1.68
PF16952	Gln-synt_N_2	1.68
PF02558	ApbA	1.68
PF00106	adh_short	0.84
PF06738	ThrE	0.84
PF12802	MarR_2	0.84
PF13610	DDE_Tnp_IS240	0.84
PF00732	GMC_oxred_N	0.84
PF01593	Amino_oxidase	0.84
PF16868	NMT1_3	0.84
PF02636	Methyltransf_28	0.84
PF13714	PEP_mutase	0.84
PF01149	Fapy_DNA_glyco	0.84
PF03548	LolA	0.84
PF01135	PCMT	0.84
PF01061	ABC2_membrane	0.84
PF04909	Amidohydro_2	0.84
PF02518	HATPase_c	0.84
PF02738	MoCoBD_1	0.84
PF12172	DUF35_N	0.84
PF02781	G6PD_C	0.84
PF01370	Epimerase	0.84

COG ID	Name	Functional Category	% Frequency in 119 Family Scaffolds
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	5.88
COG2935	Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferase	Posttranslational modification, protein turnover, chaperones [O]	5.88
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	4.20
COG0682	Prolipoprotein diacylglyceryltransferase	Cell wall/membrane/envelope biogenesis [M]	1.68
COG0266	Formamidopyrimidine-DNA glycosylase	Replication, recombination and repair [L]	0.84
COG0364	Glucose-6-phosphate 1-dehydrogenase	Carbohydrate transport and metabolism [G]	0.84
COG1565	SAM-dependent methyltransferase, MidA family	General function prediction only [R]	0.84
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	0.84
COG2303	Choline dehydrogenase or related flavoprotein	Lipid transport and metabolism [I]	0.84
COG2518	Protein-L-isoaspartate O-methyltransferase	Posttranslational modification, protein turnover, chaperones [O]	0.84
COG2519	tRNA A58 N-methylase Trm61	Translation, ribosomal structure and biogenesis [J]	0.84
COG2834	Outer membrane lipoprotein-sorting protein	Cell wall/membrane/envelope biogenesis [M]	0.84
COG2966	Uncharacterized membrane protein YjjP, DUF1212 family	Function unknown [S]	0.84
COG4122	tRNA 5-hydroxyU34 O-methylase TrmR/YrrM	Translation, ribosomal structure and biogenesis [J]	0.84

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	73.95 %
Unclassified	root	N/A	26.05 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	73.95 %
Unclassified	root	N/A	26.05 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	72.27 %
Unclassified	root	N/A	26.05 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	1.68 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	50.42 %
Unclassified	root	N/A	26.05 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.68 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1.68 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.84 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	29.41 %
Unclassified	root	N/A	26.05 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.68 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	1.68 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	4.20 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	3.36 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	1.68 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.84 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.84 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.68 %
Acetobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae	0.84 %
Corynebacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales	0.84 %
Hyphomicrobiales incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis	0.84 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.68 %
Crenalkalicoccus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %
Enhydrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter	0.84 %
Mycobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Neoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Endopterygota	cohort	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Diptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Brachycera	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Muscomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Eremoneura	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Cyclorrhapha	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Schizophora	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Calyptratae	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Hippoboscoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Glossinidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Glossina	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae → Glossina	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Glossina	subgenus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae → Glossina → Glossina	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Glossina morsitans	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae → Glossina → Glossina → Glossina morsitans	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	26.05 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	4.20 %
Glossina morsitans morsitans	subspecies	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae → Glossina → Glossina → Glossina morsitans → Glossina morsitans morsitans	1.68 %
Crenalkalicoccus roseus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	0.84 %
Hoyosella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	0.84 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	0.84 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	0.84 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459016\|G1P06HT02FOX6M	Not Available	545	Open in IMG/M
3300003219\|JGI26341J46601_10049189	All Organisms → cellular organisms → Bacteria → Proteobacteria	1321	Open in IMG/M
3300004635\|Ga0062388_102087087	All Organisms → cellular organisms → Bacteria	588	Open in IMG/M
3300005332\|Ga0066388_105916914	All Organisms → cellular organisms → Bacteria → Proteobacteria	618	Open in IMG/M
3300005363\|Ga0008090_13882259	Not Available	550	Open in IMG/M
3300005434\|Ga0070709_10582100	All Organisms → cellular organisms → Bacteria → Proteobacteria	860	Open in IMG/M
3300005436\|Ga0070713_102392336	Not Available	511	Open in IMG/M
3300005439\|Ga0070711_100345873	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1194	Open in IMG/M
3300005568\|Ga0066703_10340129	All Organisms → cellular organisms → Bacteria → Proteobacteria	903	Open in IMG/M
3300005602\|Ga0070762_10120629	All Organisms → cellular organisms → Bacteria → Proteobacteria	1540	Open in IMG/M
3300005952\|Ga0080026_10246517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	538	Open in IMG/M
3300006800\|Ga0066660_10774671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	782	Open in IMG/M
3300006954\|Ga0079219_12514945	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	501	Open in IMG/M
3300009523\|Ga0116221_1500835	Not Available	532	Open in IMG/M
3300010048\|Ga0126373_12115471	All Organisms → cellular organisms → Bacteria → Proteobacteria	625	Open in IMG/M
3300010341\|Ga0074045_10119905	All Organisms → cellular organisms → Bacteria	1806	Open in IMG/M
3300010358\|Ga0126370_10004622	All Organisms → cellular organisms → Bacteria	6826	Open in IMG/M
3300010360\|Ga0126372_10621978	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1040	Open in IMG/M
3300010361\|Ga0126378_11000511	All Organisms → cellular organisms → Bacteria	940	Open in IMG/M
3300010362\|Ga0126377_11243203	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	816	Open in IMG/M
3300010362\|Ga0126377_12754079	All Organisms → cellular organisms → Bacteria → Proteobacteria	566	Open in IMG/M
3300010398\|Ga0126383_12753715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	574	Open in IMG/M
3300012180\|Ga0153974_1037438	Not Available	1058	Open in IMG/M
3300012205\|Ga0137362_11303163	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	612	Open in IMG/M
3300012212\|Ga0150985_114592128	Not Available	565	Open in IMG/M
3300012359\|Ga0137385_11507002	Not Available	536	Open in IMG/M
3300012362\|Ga0137361_10185518	All Organisms → cellular organisms → Bacteria → Proteobacteria	1877	Open in IMG/M
3300012469\|Ga0150984_105345452	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae → Glossina → Glossina → Glossina morsitans → Glossina morsitans morsitans	851	Open in IMG/M
3300012948\|Ga0126375_11256169	All Organisms → cellular organisms → Bacteria	620	Open in IMG/M
3300015264\|Ga0137403_10216729	All Organisms → cellular organisms → Bacteria	1839	Open in IMG/M
3300016270\|Ga0182036_10413473	Not Available	1053	Open in IMG/M
3300016319\|Ga0182033_11750487	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	563	Open in IMG/M
3300016341\|Ga0182035_10234962	Not Available	1471	Open in IMG/M
3300016341\|Ga0182035_10605876	Not Available	947	Open in IMG/M
3300016341\|Ga0182035_10659117	All Organisms → cellular organisms → Bacteria	909	Open in IMG/M
3300016371\|Ga0182034_10358959	All Organisms → cellular organisms → Bacteria	1185	Open in IMG/M
3300016371\|Ga0182034_10523954	All Organisms → cellular organisms → Bacteria → Proteobacteria	992	Open in IMG/M
3300016387\|Ga0182040_10032005	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3091	Open in IMG/M
3300016387\|Ga0182040_10496846	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	974	Open in IMG/M
3300016404\|Ga0182037_11531063	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300017961\|Ga0187778_10885102	Not Available	613	Open in IMG/M
3300018006\|Ga0187804_10268749	Not Available	738	Open in IMG/M
3300020579\|Ga0210407_10188473	All Organisms → cellular organisms → Bacteria → Proteobacteria	1600	Open in IMG/M
3300020579\|Ga0210407_10509969	All Organisms → cellular organisms → Bacteria	940	Open in IMG/M
3300020579\|Ga0210407_11289808	Not Available	546	Open in IMG/M
3300020583\|Ga0210401_10480916	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1104	Open in IMG/M
3300021168\|Ga0210406_10645659	All Organisms → cellular organisms → Bacteria → Proteobacteria	821	Open in IMG/M
3300021374\|Ga0213881_10024609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2508	Open in IMG/M
3300021401\|Ga0210393_11543829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	528	Open in IMG/M
3300021404\|Ga0210389_10581176	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Hippoboscoidea → Glossinidae → Glossina → Glossina → Glossina morsitans → Glossina morsitans morsitans	881	Open in IMG/M
3300021439\|Ga0213879_10181324	Not Available	621	Open in IMG/M
3300021475\|Ga0210392_10298261	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1154	Open in IMG/M
3300021560\|Ga0126371_11318437	Not Available	855	Open in IMG/M
3300021560\|Ga0126371_12021995	All Organisms → cellular organisms → Bacteria → Proteobacteria	693	Open in IMG/M
3300022531\|Ga0242660_1035873	All Organisms → cellular organisms → Bacteria → Proteobacteria	1023	Open in IMG/M
3300022533\|Ga0242662_10098138	Not Available	832	Open in IMG/M
3300022712\|Ga0242653_1027823	All Organisms → cellular organisms → Bacteria → Proteobacteria	830	Open in IMG/M
3300022715\|Ga0242678_1057920	All Organisms → cellular organisms → Bacteria	575	Open in IMG/M
3300025922\|Ga0207646_10603641	All Organisms → cellular organisms → Bacteria	985	Open in IMG/M
3300026078\|Ga0207702_11495562	Not Available	669	Open in IMG/M
3300026335\|Ga0209804_1065587	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1734	Open in IMG/M
3300026359\|Ga0257163_1069120	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	569	Open in IMG/M
3300026490\|Ga0257153_1095736	Not Available	591	Open in IMG/M
3300026548\|Ga0209161_10570599	All Organisms → cellular organisms → Bacteria → Proteobacteria	506	Open in IMG/M
3300027684\|Ga0209626_1127306	All Organisms → cellular organisms → Bacteria → Proteobacteria	668	Open in IMG/M
3300027727\|Ga0209328_10170990	Not Available	659	Open in IMG/M
3300027824\|Ga0209040_10166952	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1173	Open in IMG/M
3300027968\|Ga0209061_1048942	All Organisms → cellular organisms → Bacteria → Proteobacteria	1764	Open in IMG/M
3300028906\|Ga0308309_11268503	All Organisms → cellular organisms → Bacteria → Proteobacteria	634	Open in IMG/M
3300031231\|Ga0170824_124900386	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	735	Open in IMG/M
3300031236\|Ga0302324_102584802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	617	Open in IMG/M
3300031474\|Ga0170818_115452652	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	689	Open in IMG/M
3300031545\|Ga0318541_10290248	Not Available	911	Open in IMG/M
3300031545\|Ga0318541_10635679	All Organisms → cellular organisms → Bacteria → Proteobacteria	597	Open in IMG/M
3300031573\|Ga0310915_11202949	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	524	Open in IMG/M
3300031668\|Ga0318542_10228161	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Hoyosella	943	Open in IMG/M
3300031680\|Ga0318574_10345054	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	868	Open in IMG/M
3300031719\|Ga0306917_11218272	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	584	Open in IMG/M
3300031744\|Ga0306918_10923198	All Organisms → cellular organisms → Bacteria	679	Open in IMG/M
3300031753\|Ga0307477_10397517	Not Available	944	Open in IMG/M
3300031753\|Ga0307477_10959209	Not Available	562	Open in IMG/M
3300031768\|Ga0318509_10037401	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2413	Open in IMG/M
3300031768\|Ga0318509_10605078	Not Available	610	Open in IMG/M
3300031770\|Ga0318521_10093193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1645	Open in IMG/M
3300031770\|Ga0318521_11045267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	501	Open in IMG/M
3300031771\|Ga0318546_10454716	Not Available	897	Open in IMG/M
3300031777\|Ga0318543_10290051	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	731	Open in IMG/M
3300031779\|Ga0318566_10383176	All Organisms → cellular organisms → Bacteria → Proteobacteria	693	Open in IMG/M
3300031793\|Ga0318548_10463830	Not Available	620	Open in IMG/M
3300031795\|Ga0318557_10248646	All Organisms → cellular organisms → Bacteria	814	Open in IMG/M
3300031819\|Ga0318568_11027704	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	509	Open in IMG/M
3300031821\|Ga0318567_10563307	All Organisms → cellular organisms → Bacteria	647	Open in IMG/M
3300031833\|Ga0310917_10334144	Not Available	1027	Open in IMG/M
3300031833\|Ga0310917_10809820	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	632	Open in IMG/M
3300031860\|Ga0318495_10431312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	579	Open in IMG/M
3300031880\|Ga0318544_10422395	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Crenalkalicoccus → Crenalkalicoccus roseus	519	Open in IMG/M
3300031893\|Ga0318536_10503283	All Organisms → cellular organisms → Bacteria → Proteobacteria	609	Open in IMG/M
3300031896\|Ga0318551_10406819	All Organisms → cellular organisms → Bacteria	774	Open in IMG/M
3300031897\|Ga0318520_10744137	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	614	Open in IMG/M
3300031910\|Ga0306923_10848806	All Organisms → cellular organisms → Bacteria	1004	Open in IMG/M
3300031910\|Ga0306923_11300916	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300031945\|Ga0310913_10511837	All Organisms → cellular organisms → Bacteria	852	Open in IMG/M
3300031954\|Ga0306926_11209300	All Organisms → cellular organisms → Bacteria	887	Open in IMG/M
3300031954\|Ga0306926_11520061	All Organisms → cellular organisms → Bacteria	772	Open in IMG/M
3300032001\|Ga0306922_10558366	Not Available	1216	Open in IMG/M
3300032035\|Ga0310911_10105842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1547	Open in IMG/M
3300032035\|Ga0310911_10259576	All Organisms → cellular organisms → Bacteria	996	Open in IMG/M
3300032039\|Ga0318559_10195356	Not Available	929	Open in IMG/M
3300032042\|Ga0318545_10215591	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	688	Open in IMG/M
3300032063\|Ga0318504_10222154	All Organisms → cellular organisms → Bacteria → Proteobacteria	885	Open in IMG/M
3300032067\|Ga0318524_10575322	Not Available	593	Open in IMG/M
3300032076\|Ga0306924_10987336	All Organisms → cellular organisms → Bacteria	925	Open in IMG/M
3300032091\|Ga0318577_10105605	All Organisms → cellular organisms → Bacteria → Proteobacteria	1321	Open in IMG/M
3300032160\|Ga0311301_10861266	All Organisms → cellular organisms → Bacteria → Proteobacteria	1230	Open in IMG/M
3300032180\|Ga0307471_100833114	Not Available	1090	Open in IMG/M
3300032261\|Ga0306920_100171745	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3232	Open in IMG/M
3300032261\|Ga0306920_100353260	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2187	Open in IMG/M
3300032261\|Ga0306920_104177003	Not Available	521	Open in IMG/M
3300032782\|Ga0335082_11637857	All Organisms → cellular organisms → Bacteria → Proteobacteria	517	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	37.82%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	17.65%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	8.40%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.36%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.36%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.36%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	2.52%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.52%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.68%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.68%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.68%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.68%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.84%
Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil	0.84%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.84%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.84%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.84%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	0.84%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.84%
Permafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil	0.84%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.84%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	0.84%
Exposed Rock	Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock	0.84%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.84%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.84%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.84%
Attine Ant Fungus Gardens	Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens	0.84%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.84%
Tropical Rainforest Soil	Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil	0.84%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459016	Litter degradation ZMR2	Engineered	Open in IMG/M
3300003219	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3	Environmental	Open in IMG/M
3300004635	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005363	Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005952	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009523	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010341	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300012180	Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG	Host-Associated	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300015264	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300016270	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental	Open in IMG/M
3300016371	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental	Open in IMG/M
3300018006	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020583	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021374	Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08	Environmental	Open in IMG/M
3300021401	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O	Environmental	Open in IMG/M
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental	Open in IMG/M
3300021439	Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022531	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022533	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022712	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300022715	Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)	Environmental	Open in IMG/M
3300026359	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A	Environmental	Open in IMG/M
3300026490	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A	Environmental	Open in IMG/M
3300026548	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)	Environmental	Open in IMG/M
3300027684	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027727	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300027824	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)	Environmental	Open in IMG/M
3300027968	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031236	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031668	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23	Environmental	Open in IMG/M
3300031680	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22	Environmental	Open in IMG/M
3300031719	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)	Environmental	Open in IMG/M
3300031744	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031768	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22	Environmental	Open in IMG/M
3300031770	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17	Environmental	Open in IMG/M
3300031771	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19	Environmental	Open in IMG/M
3300031777	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24	Environmental	Open in IMG/M
3300031779	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22	Environmental	Open in IMG/M
3300031793	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21	Environmental	Open in IMG/M
3300031795	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19	Environmental	Open in IMG/M
3300031819	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21	Environmental	Open in IMG/M
3300031821	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031860	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25	Environmental	Open in IMG/M
3300031880	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25	Environmental	Open in IMG/M
3300031893	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28	Environmental	Open in IMG/M
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental	Open in IMG/M
3300031897	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16	Environmental	Open in IMG/M
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental	Open in IMG/M
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental	Open in IMG/M
3300031954	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental	Open in IMG/M
3300032039	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21	Environmental	Open in IMG/M
3300032042	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26	Environmental	Open in IMG/M
3300032063	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17	Environmental	Open in IMG/M
3300032067	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22	Environmental	Open in IMG/M
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental	Open in IMG/M
3300032091	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.45
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.45
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F074596

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
2ZMR_04053640	2170459016	Switchgrass, Maize And Mischanthus Litter	VLVRDGTVQLWISADEPPEKRQALRIAAETIPGVRGVEEHVMPAPLIPPL
JGI26341J46601_100491891	3300003219	Bog Forest Soil	DKIVHLWCSDDQSDEERQALRVAAENTPGVRGVEVHIVHRPRRDWW*
Ga0062388_1020870871	3300004635	Bog Forest Soil	WVSDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF*
Ga0066388_1059169141	3300005332	Tropical Forest Soil	LWFSDDRSGDERQALRVAAENISGVRKVEEHIVPAPVFPSF*
Ga0008090_138822591	3300005363	Tropical Rainforest Soil	VHFWISEDEPTEKRQALRVAAENISGVRGVEEHVVPAPLVPAF*
Ga0070709_105821002	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	VSDDRPEEERQALRVAAENVTGVRSVEEHIVPAPLIPPAF*
Ga0070713_1023923362	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	FWISEDEPGEKRQALRVAAETIPGVRGVEEHVVPAPVIPAF*
Ga0070711_1003458731	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	VHFWISEDEPSEKRQALRVAAETITGVRGVEEHVVPAPVVPAF*
Ga0066703_103401291	3300005568	Soil	WFSDDRSEEERQAVRVAAENIPGVQRVEEHIVPAPVIPSF*
Ga0070762_101206291	3300005602	Soil	IVRDGVVHFWLSSDEPEENKQALRVAAETTSGIRRVEEHVVPAPVFPAF*
Ga0080026_102465171	3300005952	Permafrost Soil	VKDQVAHLWMCDDRPADQRQALRIAAENTAGVRGVQEHIVPGSPMPAF*
Ga0066660_107746713	3300006800	Soil	GSVHLWISADESPEKRQALRVAAETIPGVRGVEEHVMPVALIPAL*
Ga0079219_125149452	3300006954	Agricultural Soil	HIWVSEDRPREERQALRVAAENVPGVLGVEEHIVPAPIIPPPF*
Ga0116221_15008351	3300009523	Peatlands Soil	WLSDDESGEKRDALRVAAESIIGVHGVEEHLLPAPLVPAF*
Ga0126373_121154713	3300010048	Tropical Forest Soil	DDRPREERQALRIAAENIPGVHAVEEHLVPAPMIPPPF*
Ga0074045_101199051	3300010341	Bog Forest Soil	DDQPEAERQAFRVAAENISGVKRVQEHIVPAPVIPSF*
Ga0126370_100046225	3300010358	Tropical Forest Soil	ISEDEPTENRRALRVAAETIPGVRGVQEHDVPAPVITAF*
Ga0126372_106219782	3300010360	Tropical Forest Soil	VHFWISEDEPGEKRQALRVAAEAITGVRGVEEHVVPAPLVPAF*
Ga0126378_110005112	3300010361	Tropical Forest Soil	VVHVWVSDDSAPHERQALRVAAENTPGVRGVEEHLVPAPLIPPAF*
Ga0126377_112432032	3300010362	Tropical Forest Soil	VRDGVVHIWVGDDRPQAEKEALRIAAENIAGVRGVEEHLVPAPMIPPAF*
Ga0126377_127540791	3300010362	Tropical Forest Soil	RVVHLWFSDDRSEDERQAVRVAAENIPGVQRVEEHIVPAPVIPSF*
Ga0126383_127537152	3300010398	Tropical Forest Soil	VVHLWFSDDRSEDERQAVRVAAENIPGVRQVQEHIVPAAVFPAF*
Ga0153974_10374382	3300012180	Attine Ant Fungus Gardens	EPEEKRQALRVAAEAIAGVRGVQEHIMPAAYFPAF*
Ga0137362_113031631	3300012205	Vadose Zone Soil	HLWFSDDRSEEERQAVRVAAENIPGVQRVEEHIVPAPIIPSF*
Ga0150985_1145921282	3300012212	Avena Fatua Rhizosphere	AHIWVSDDRPEEERQALRVAAENVTGGRGVEEHLVPAPLIPPAF*
Ga0137385_115070022	3300012359	Vadose Zone Soil	QPEEERQAIRVAAENIPGVREVEQHITPAPLIPSF*
Ga0137361_101855183	3300012362	Vadose Zone Soil	VHLWFSDDRSEEERQAVRVAAENIPGVQRVEEHIVPAPIIPSF*
Ga0150984_1053454522	3300012469	Avena Fatua Rhizosphere	DDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF*
Ga0126375_112561691	3300012948	Tropical Forest Soil	LSKDQTEEERRALRVAAENIPGVRRVEEHIIPAV*
Ga0137403_102167291	3300015264	Vadose Zone Soil	WFSDDQPLEERLTFRVAAENIAGVRGVEEHIVAPPGVPPGGGGGKR*
Ga0182036_104134731	3300016270	Soil	SEDEPPEKRQALRVAAETIPGVRGIEEHVVPAPLVPAF
Ga0182033_117504872	3300016319	Soil	IVHFWISEDEPNERKQALRVAAETIAGVRGVEEHVVPAPVMPAF
Ga0182035_102349621	3300016341	Soil	DEPTEKRQALRVAAETIPGVRGIEEHVLLAPLVPAF
Ga0182035_106058762	3300016341	Soil	SDDRSEAERQAVRVAAENIPGVRQVEEHIVPAPALPAF
Ga0182035_106591172	3300016341	Soil	VHIWVSDDRSLEEREALRVAAENIPGVRGVEEHLVPAPLIPAAF
Ga0182034_103589593	3300016371	Soil	RDRVVHLWFSDDRSDEERQAVRIAAENIPGVRQVEEHIVPVPAFPAF
Ga0182034_105239542	3300016371	Soil	GVVHIWVSDDRPREERQALRVAAENIPGVHGVEEHLVPAPMIPPPF
Ga0182040_100320054	3300016387	Soil	SDDRSEEERQAVRVAAENIPGVRQVEEHIVPAPVFPSF
Ga0182040_104968464	3300016387	Soil	WFSDDRSEDERQALRVAAENISGVRKVEEHIVPAPVFPSF
Ga0182037_115310632	3300016404	Soil	RDRVVHLWFSDDRSEDERQAVRIAAENIAGVRQVQEHIVPAAVFPAF
Ga0187778_108851021	3300017961	Tropical Peatland	SADESDAERQAVRVAAENVAGVRKVEEHIVPAPVFPAF
Ga0187804_102687492	3300018006	Freshwater Sediment	VHVWMADDQPEAEKQALRVAAENIPGVRRVEEHIVPAPAIPAF
Ga0210407_101884733	3300020579	Soil	DGVVHIWVSDDRPEEEQRALRVAAENIPGVHGVEEHIVPAPMIPPAF
Ga0210407_105099692	3300020579	Soil	PPEERQAMRVAAENIPGVQGVEEHLVPAPIVLPAF
Ga0210407_112898081	3300020579	Soil	HFWISEDEPSEKRLALRVAAETITGVRGIEEHVVPAPVVPAF
Ga0210401_104809162	3300020583	Soil	IVHFWISEDEPSEKRLALRVAAETITGVRGIEEHVVPAPVVPAF
Ga0210406_106456592	3300021168	Soil	WVSDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF
Ga0213881_100246094	3300021374	Exposed Rock	KFVRDGVVHFWISADEPTEKRQALRVAAETIAGVRGVEEHLVPAPMIPAF
Ga0210393_115438292	3300021401	Soil	FWLSSDEPDEKKQALRVAAETIPGVRGVEEHAVPAPSIPAF
Ga0210389_105811761	3300021404	Soil	SDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF
Ga0213879_101813242	3300021439	Bulk Soil	HFWVSEDEPSEKRQALRVAAETIPGVRGVEEHDVPGAVITAF
Ga0210392_102982611	3300021475	Soil	RSEEERQAVRVAAENIPGVQRVEEHIVPAPVIPSF
Ga0126371_113184371	3300021560	Tropical Forest Soil	EPSGKRQALRVAAETITGVRGVEEHVVPAPMIPAF
Ga0126371_120219951	3300021560	Tropical Forest Soil	LWVSDDRLQEERQALRVAAEDIPGVRGVEEHLVPAPMIPPPF
Ga0242660_10358731	3300022531	Soil	SDDRPEEERQALRVAAENIPGVHGVEEHIVPAPMIPPAF
Ga0242662_100981381	3300022533	Soil	DDRPDGERQALRVAAENIPGVRGVEEHIVPAPMVPPAF
Ga0242653_10278232	3300022712	Soil	VVHIWVSDDRPEEERQALRVAAENIPGVHGVEEHIVPAPMIPPAF
Ga0242678_10579202	3300022715	Soil	SDDRSEDERQALRIAAENIPGVRQVQEHIVPAAVFPAF
Ga0207646_106036412	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	RDRAVHIWVSDDRPPEERQALRIAAENIPGVRTVEEHLVPAPLIPPAF
Ga0207702_114955621	3300026078	Corn Rhizosphere	IVSDSVVHLWFSSDEPEEKRQAVRIAAENIPGVRGVEEYVVPAPLIPTF
Ga0209804_10655873	3300026335	Soil	PDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF
Ga0257163_10691201	3300026359	Soil	DRPPEERQAMRVAAENIPGVQGVEEHLVPAPLVPPAF
Ga0257153_10957361	3300026490	Soil	WVSDDRPPEERQAMRVAAENIPGVQGVEEHLVPAPLVPPAF
Ga0209161_105705992	3300026548	Soil	VHIWVSDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF
Ga0209626_11273061	3300027684	Forest Soil	DRPEEERQALRVAAENIPGVRGVEEHIVPAPLIPPAF
Ga0209328_101709901	3300027727	Forest Soil	VVHLWVSDDRPPEERQAMRVAAENIPGVQGVEEHLVPAPIVLPAF
Ga0209040_101669523	3300027824	Bog Forest Soil	DGIVHFWISEDEPNEKRQALRVAAETITGVRGVEEHLVPAAVIPAF
Ga0209061_10489423	3300027968	Surface Soil	DRSEDERAALRVAAENVPGVRRVEEHLVPVPVIPGF
Ga0308309_112685032	3300028906	Soil	IWVSDDRPEEERQALRVAAENIPGVRGVEEHIVPAPMIPPAF
Ga0170824_1249003862	3300031231	Forest Soil	DRVVHLWFSDDRSEEERQAVRVAAENITGVQRVEEHIVPAPVIPVF
Ga0302324_1025848022	3300031236	Palsa	RDGTVHFWLSDDEHEEKRQALRVAAETIAGVRSVEEHFLPAPAVPAF
Ga0170818_1154526522	3300031474	Forest Soil	LWFSDDRSEDERQALRVAAENIPGVRQVQEHIVPAAVFPAF
Ga0318541_102902481	3300031545	Soil	LWFSDEQPREERLTFRVAAENIPGVRRVEEHIVTVPAITSA
Ga0318541_106356792	3300031545	Soil	VVHIWVSDDRPGEERQALRVAAENIPGVHGVEEHLVPAPMIPPPF
Ga0310915_112029491	3300031573	Soil	GIVHFWISEDEPNERKQALRVAAETIAGVRGVEEHVVPAPVMPAF
Ga0318542_102281613	3300031668	Soil	RDGIVHFWVSEDELSEKRQALRVAAETILGVRGVEEHTVPARVIPAF
Ga0318574_103450542	3300031680	Soil	DRVVHLWFSDDQPREERLTFRVAAENIPGVRRVEEHIVAPPAPDRGEGQR
Ga0306917_112182722	3300031719	Soil	FWISEDEPTGKRQALRVAAETIPGVRGVEEHVVPAPLVPAF
Ga0306918_109231982	3300031744	Soil	DDRPEEERRALRVAAENIPGVRGVEEHIVPAPIVPAF
Ga0307477_103975171	3300031753	Hardwood Forest Soil	KVVHVWMADDQPEAEKQALRIAAENIPGVRRVEEHIVPAPVIPAF
Ga0307477_109592091	3300031753	Hardwood Forest Soil	ISEDEPSEKRHALRVAAETITGVRGIEEHVVPAPVVPAF
Ga0318509_100374011	3300031768	Soil	RVVHLWFSDDQPREERLTFRVAAENIPGVRRVEEHIVAPPAPDRGEGQR
Ga0318509_106050782	3300031768	Soil	VRDRIVHLWFSDDRSEDERQALRVAAENISGVRKVEEHIVPAPVFPSF
Ga0318521_100931931	3300031770	Soil	RDRVVHLWFSDDRSEEERQALRVAAENIPGVRQVEEHVVPAPVFPSF
Ga0318521_110452671	3300031770	Soil	LWFSDDRSEEERQALRIAAENIPGVRQVQEHIVPAPVFPSF
Ga0318546_104547161	3300031771	Soil	VRDRVVYLWFSDEQPREERLTFRVAAENIPGVRRVEEHIVTVPAITSA
Ga0318543_102900511	3300031777	Soil	LWFSDDRSEEERQALRVAAENIPGVRQVEEHVVPAPVFPSF
Ga0318566_103831762	3300031779	Soil	DRVVHLWFSDDRSEEERQALRIAAENIPGVRQVQEHIVPAPVFPSF
Ga0318548_104638302	3300031793	Soil	WFSDDRSDEERQAVRIAAENIPGVRQVQEHIVPVPAFPAF
Ga0318557_102486463	3300031795	Soil	FWVSEDELSEKRQALRVAAETILGVRGVEEHTVPAPVIPAF
Ga0318568_110277041	3300031819	Soil	DRVVHLWFSDDRSDEERQAVRIAAENIPGVRQVQEHIVPVPAFPAF
Ga0318567_105633072	3300031821	Soil	LWFSDDRSEEERQAVRVAAENIPGVRQVEEHIVPVPVFPSF
Ga0310917_103341441	3300031833	Soil	VVHLWFSDDRSEAERQAVRVAAENIPGVRQVEEHIVPAPALPAF
Ga0310917_108098202	3300031833	Soil	SDDRSEDERQALRVAAENISGVRKVEEHIVPAPVFPSF
Ga0318495_104313121	3300031860	Soil	VHVWVSDDRSPEERQALRIAAENIPGVRSVEEHLVPAPLIPPAF
Ga0318544_104223952	3300031880	Soil	RSPEERQALRIAAENIPGVRSVEEHLVPAPLIPPAF
Ga0318536_105032831	3300031893	Soil	VVHLWFSDDRSEEERQALRVAAENIPGVRQVQEHIVPAPVFPSF
Ga0318551_104068191	3300031896	Soil	LWFSDDRSEEERQAVRVAAENIPGVRQVEEHIVPAPVFPSF
Ga0318520_107441371	3300031897	Soil	SDDRSDEERQAVRIAAENIPGVRQVQEHIVPVPAFPAF
Ga0306923_108488061	3300031910	Soil	HIWVSDDRSLEEREALRVAAENIPGVRGVEEHLVPAPLIPAAF
Ga0306923_113009163	3300031910	Soil	HFWLSNDQSEEERLALRVAAENIAGVRGVEEHMIPAP
Ga0310913_105118372	3300031945	Soil	HIWISEDEPVEKREALRVAAETTPGVRGVEEHAVPAPLIPAF
Ga0306926_112093001	3300031954	Soil	RSDEERQAVRIAAENIPGVRQVQEHIVPVPAFPAF
Ga0306926_115200611	3300031954	Soil	LWFSDDRSEDERQAVRIAAENIAGVRQVQEHIVPAAVFPAF
Ga0306922_105583664	3300032001	Soil	VHFWISEDEPTEKRQALRVAAETIPGVRGIEEHVLLAPLVPAF
Ga0310911_101058421	3300032035	Soil	DDRSEEERQALRVAAENVPGVRQVEEHVVPAPVFPSF
Ga0310911_102595761	3300032035	Soil	FSDDRSDEERQAVRIAAENIPGVRQVQEHIVPVPAFPAF
Ga0318559_101953562	3300032039	Soil	WFSDDRSEEERQALRVAAENVPGVRQVEEHVVPAPVFPSF
Ga0318545_102155911	3300032042	Soil	ADIIVRDRIVHLWFSDDRSEDERQALRVAAENISGVRKVEEHIVPAPVFPSF
Ga0318504_102221542	3300032063	Soil	VRDGVVHIWVGDDRPPAEKEALRVAAENIAGVRGVEEHLVPAPMIPPAF
Ga0318524_105753221	3300032067	Soil	MVRDKVVHIWMSDDQPMAERDALRVAAENISGVRRVEEHIVPAAVVPAF
Ga0306924_109873362	3300032076	Soil	RPEEERRALRVAAENIPGVRGVEEHIVPAPIVPAF
Ga0318577_101056053	3300032091	Soil	IIVRDGIVHFWISADEPSEKRQALRVAAETIAGVRSVEEHVVSAPVIPAF
Ga0311301_108612662	3300032160	Peatlands Soil	MVRDKVVHVWLSDDQPIAERDALRVAAENIPGVRRVEEHIVPAPVVPAF
Ga0307471_1008331141	3300032180	Hardwood Forest Soil	DDRSEDERQALRVAAENIPGVRQVQEHIVPAAVFPAF
Ga0306920_1001717453	3300032261	Soil	PEEKRQALRVAAETIPGVRGVEEHILPAVSVPGTFA
Ga0306920_1003532603	3300032261	Soil	RSEDERQAVRIAAENIAGVRQVQEHIVPAAVFPAF
Ga0306920_1041770032	3300032261	Soil	ESDAERQAVRVAAENVAGVRKVEEHIVPAPVFPAF
Ga0335082_116378571	3300032782	Soil	RVVHLWFSDDRSEDERQAVRVAAENIPGVQRVEEHIVPAPVIPAF

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign