NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F074610

Metagenome Family F074610

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074610
Family Type Metagenome
Number of Sequences 119
Average Sequence Length 40 residues
Representative Sequence TRAQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH
Number of Associated Samples 107
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.08 %
% of genes near scaffold ends (potentially truncated) 94.12 %
% of genes from short scaffolds (< 2000 bps) 94.12 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (63.866 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(29.412 % of family members)
Environment Ontology (ENVO) Unclassified
(26.050 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.697 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 29.85%    β-sheet: 0.00%    Coil/Unstructured: 70.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00230MIP 9.24
PF00381PTS-HPr 6.72
PF13738Pyr_redox_3 3.36
PF00296Bac_luciferase 2.52
PF13450NAD_binding_8 2.52
PF03747ADP_ribosyl_GH 2.52
PF00190Cupin_1 1.68
PF13556HTH_30 1.68
PF05721PhyH 1.68
PF02705K_trans 1.68
PF03435Sacchrp_dh_NADP 1.68
PF00406ADK 1.68
PF12704MacB_PCD 1.68
PF02687FtsX 1.68
PF12802MarR_2 0.84
PF08281Sigma70_r4_2 0.84
PF12680SnoaL_2 0.84
PF13483Lactamase_B_3 0.84
PF00903Glyoxalase 0.84
PF00440TetR_N 0.84
PF00486Trans_reg_C 0.84
PF13189Cytidylate_kin2 0.84
PF08327AHSA1 0.84
PF00005ABC_tran 0.84
PF07969Amidohydro_3 0.84
PF00248Aldo_ket_red 0.84
PF12762DDE_Tnp_IS1595 0.84
PF00753Lactamase_B 0.84
PF02518HATPase_c 0.84
PF09339HTH_IclR 0.84
PF08386Abhydrolase_4 0.84
PF00743FMO-like 0.84
PF03109ABC1 0.84
PF02733Dak1 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 9.24
COG1925HPr or related phosphotransfer proteinSignal transduction mechanisms [T] 6.72
COG1397ADP-ribosylglycohydrolasePosttranslational modification, protein turnover, chaperones [O] 2.52
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 2.52
COG0563Adenylate kinase or related kinaseNucleotide transport and metabolism [F] 1.68
COG3158K+ uptake protein KupInorganic ion transport and metabolism [P] 1.68
COG5285Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) familySecondary metabolites biosynthesis, transport and catabolism [Q] 1.68
COG0661Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB familySignal transduction mechanisms [T] 0.84
COG2072Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcDInorganic ion transport and metabolism [P] 0.84
COG2376Dihydroxyacetone kinaseCarbohydrate transport and metabolism [G] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms63.87 %
UnclassifiedrootN/A36.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005169|Ga0066810_10046544Not Available834Open in IMG/M
3300005172|Ga0066683_10722223All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300005177|Ga0066690_10183222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1388Open in IMG/M
3300005178|Ga0066688_10919784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria538Open in IMG/M
3300005434|Ga0070709_11789393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Klenkia → Klenkia taihuensis502Open in IMG/M
3300005435|Ga0070714_102356952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300005542|Ga0070732_10250969All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300005561|Ga0066699_10458581All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300005591|Ga0070761_10266138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1027Open in IMG/M
3300005602|Ga0070762_10652297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia703Open in IMG/M
3300005764|Ga0066903_108397962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia527Open in IMG/M
3300006797|Ga0066659_11119971Not Available658Open in IMG/M
3300006804|Ga0079221_10794157Not Available677Open in IMG/M
3300006903|Ga0075426_11033131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia621Open in IMG/M
3300007982|Ga0102924_1079398All Organisms → cellular organisms → Bacteria1741Open in IMG/M
3300009012|Ga0066710_103716302Not Available574Open in IMG/M
3300009520|Ga0116214_1034332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1830Open in IMG/M
3300009525|Ga0116220_10118573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1127Open in IMG/M
3300009545|Ga0105237_11281972Not Available739Open in IMG/M
3300009551|Ga0105238_12236353Not Available582Open in IMG/M
3300010049|Ga0123356_10738083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1154Open in IMG/M
3300010321|Ga0134067_10118259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia921Open in IMG/M
3300010343|Ga0074044_10183643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1392Open in IMG/M
3300010360|Ga0126372_12815352Not Available538Open in IMG/M
3300010376|Ga0126381_102480224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria743Open in IMG/M
3300010379|Ga0136449_100797389All Organisms → cellular organisms → Bacteria → Terrabacteria group1561Open in IMG/M
3300012089|Ga0153924_1049585Not Available820Open in IMG/M
3300012198|Ga0137364_10400338All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300012349|Ga0137387_10380966Not Available1022Open in IMG/M
3300012971|Ga0126369_13590867Not Available508Open in IMG/M
3300015373|Ga0132257_101041188All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1031Open in IMG/M
3300016270|Ga0182036_10942543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia709Open in IMG/M
3300016270|Ga0182036_10996294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300016422|Ga0182039_11133209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia705Open in IMG/M
3300017821|Ga0187812_1205926Not Available628Open in IMG/M
3300017926|Ga0187807_1038162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1487Open in IMG/M
3300017928|Ga0187806_1140498Not Available792Open in IMG/M
3300017932|Ga0187814_10390376Not Available541Open in IMG/M
3300017942|Ga0187808_10199142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium890Open in IMG/M
3300017948|Ga0187847_10913420Not Available500Open in IMG/M
3300018001|Ga0187815_10316751All Organisms → cellular organisms → Bacteria → Terrabacteria group662Open in IMG/M
3300018007|Ga0187805_10035970All Organisms → cellular organisms → Bacteria → Terrabacteria group2213Open in IMG/M
3300018007|Ga0187805_10370968Not Available663Open in IMG/M
3300018012|Ga0187810_10065862All Organisms → cellular organisms → Bacteria1386Open in IMG/M
3300018034|Ga0187863_10125398Not Available1435Open in IMG/M
3300018042|Ga0187871_10476173Not Available691Open in IMG/M
3300018468|Ga0066662_11372785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales729Open in IMG/M
3300020582|Ga0210395_10241020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia1358Open in IMG/M
3300020583|Ga0210401_10937714All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300021180|Ga0210396_10364375All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300021403|Ga0210397_10337367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso8991114Open in IMG/M
3300021405|Ga0210387_10514842All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1064Open in IMG/M
3300021405|Ga0210387_11272798Not Available636Open in IMG/M
3300021406|Ga0210386_11460599Not Available571Open in IMG/M
3300021406|Ga0210386_11576712Not Available545Open in IMG/M
3300021474|Ga0210390_11062084Not Available659Open in IMG/M
3300021479|Ga0210410_11243595Not Available636Open in IMG/M
3300021559|Ga0210409_10946502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241735Open in IMG/M
3300021559|Ga0210409_11716524Not Available504Open in IMG/M
3300021560|Ga0126371_13874104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300024288|Ga0179589_10358837Not Available663Open in IMG/M
3300025910|Ga0207684_10775851Not Available811Open in IMG/M
3300025914|Ga0207671_11574003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300025917|Ga0207660_10331581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1217Open in IMG/M
3300025924|Ga0207694_11410014Not Available589Open in IMG/M
3300025927|Ga0207687_10315418All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1264Open in IMG/M
3300025949|Ga0207667_11822330Not Available572Open in IMG/M
3300026078|Ga0207702_10824753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales917Open in IMG/M
3300026121|Ga0207683_10432492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1212Open in IMG/M
3300026327|Ga0209266_1266993Not Available543Open in IMG/M
3300026552|Ga0209577_10147982All Organisms → cellular organisms → Bacteria1850Open in IMG/M
3300027725|Ga0209178_1090440Not Available1014Open in IMG/M
3300027855|Ga0209693_10400653Not Available663Open in IMG/M
3300027905|Ga0209415_10288889All Organisms → cellular organisms → Bacteria1428Open in IMG/M
3300028808|Ga0302228_10243725Not Available812Open in IMG/M
3300028879|Ga0302229_10527675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Leisingera520Open in IMG/M
3300029943|Ga0311340_11202683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300029943|Ga0311340_11588718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Leisingera508Open in IMG/M
3300029999|Ga0311339_11590838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae577Open in IMG/M
3300030056|Ga0302181_10049528All Organisms → cellular organisms → Bacteria2220Open in IMG/M
3300030058|Ga0302179_10203152Not Available875Open in IMG/M
3300030058|Ga0302179_10524861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300030490|Ga0302184_10416239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae520Open in IMG/M
3300030503|Ga0311370_11213286All Organisms → cellular organisms → Bacteria → Proteobacteria816Open in IMG/M
3300030580|Ga0311355_10160126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2407Open in IMG/M
3300030580|Ga0311355_11882591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Leisingera505Open in IMG/M
3300030739|Ga0302311_10368823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia1019Open in IMG/M
3300031640|Ga0318555_10033117All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2531Open in IMG/M
3300031668|Ga0318542_10446918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii670Open in IMG/M
3300031668|Ga0318542_10746546Not Available512Open in IMG/M
3300031680|Ga0318574_10051182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2174Open in IMG/M
3300031713|Ga0318496_10294858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales895Open in IMG/M
3300031747|Ga0318502_10290587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium960Open in IMG/M
3300031751|Ga0318494_10565325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii664Open in IMG/M
3300031770|Ga0318521_10755284Not Available592Open in IMG/M
3300031771|Ga0318546_10961250Not Available601Open in IMG/M
3300031778|Ga0318498_10079489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1478Open in IMG/M
3300031794|Ga0318503_10285135Not Available536Open in IMG/M
3300031798|Ga0318523_10380006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales702Open in IMG/M
3300031805|Ga0318497_10432929Not Available736Open in IMG/M
3300031846|Ga0318512_10293786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii807Open in IMG/M
3300031859|Ga0318527_10105077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1162Open in IMG/M
3300031860|Ga0318495_10264860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia768Open in IMG/M
3300031860|Ga0318495_10310826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia700Open in IMG/M
3300031912|Ga0306921_11900389All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia637Open in IMG/M
3300031941|Ga0310912_10610734Not Available848Open in IMG/M
3300031954|Ga0306926_12819928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300031959|Ga0318530_10455543Not Available531Open in IMG/M
3300032008|Ga0318562_10777908Not Available548Open in IMG/M
3300032054|Ga0318570_10208011Not Available884Open in IMG/M
3300032063|Ga0318504_10616728Not Available521Open in IMG/M
3300032066|Ga0318514_10368670All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii761Open in IMG/M
3300032076|Ga0306924_10075714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii3764Open in IMG/M
3300032076|Ga0306924_11792878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae640Open in IMG/M
3300032160|Ga0311301_10615019All Organisms → cellular organisms → Bacteria → Terrabacteria group1560Open in IMG/M
3300032261|Ga0306920_104380216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300033134|Ga0335073_11480206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300033828|Ga0334850_080501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil29.41%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa10.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment7.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.20%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.36%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.52%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.68%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.84%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.84%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.84%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.84%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.84%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012089Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028879Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033828Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066810_1004654413300005169SoilVLSGAVTRAQLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH*
Ga0066683_1072222323300005172SoilGAVTSTQLEANLAALTVGQLSALRLAEPPDAYWAARAARPWH*
Ga0066690_1018322223300005177SoilVHAGFAGVTRAQLEENLAALTVGQLPELSPAEAPDAYWAERAARPWH*
Ga0066688_1091978423300005178SoilGAVTRAQLDQNLAALTVDQLPALSLAEAPDDYWAERAARPWH*
Ga0070709_1178939313300005434Corn, Switchgrass And Miscanthus RhizosphereVTRAQLDENLAALTVGQVPPLSLAEAPGAYWAERAARPWH*
Ga0070714_10235695223300005435Agricultural SoilVTRAQLEENLAALTVGQLPELSLAEAPDAYWAERAARPWR*
Ga0070732_1025096933300005542Surface SoilAVTRAQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH*
Ga0066699_1045858113300005561SoilVHAGFAGVTRAQLEENLAALTVGQLPELSPAEAPDAYWAERAAR
Ga0070761_1026613823300005591SoilVTRAQLDENLAALTVGQLPVLSLAESPDAYWTERAARPWH*
Ga0070762_1065229713300005602SoilAQLDENLAALAVGELPPLSLAEAPDAYWAERAARPWH*
Ga0066903_10839796223300005764Tropical Forest SoilAQLGQNLAALTVGGLPELDLAESPGAYWAARSARPWQ*
Ga0066659_1111997123300006797SoilVHAGFAGVTRAQLEENLAALTVGHIPELIPAEAPDAYWAERAARPWH*
Ga0079221_1079415723300006804Agricultural SoilSGAVTRAQLAENLAALTVGPLPALSLAEAPDAYWAERAARPWH*
Ga0075426_1103313113300006903Populus RhizosphereGAVTRPQLEANLAALTVGELPVLSLAEAPGTYWAARAARPWR*
Ga0102924_107939833300007982Iron-Sulfur Acid SpringVVSGAVTRAQLDENLTALTVGQLPALSLAEADGAYWAQRAARPWH*
Ga0066710_10371630223300009012Grasslands SoilCAWEVVHAGFAGVTRAQLEENLAALTVGHIPELIPAEAPDAYWAERAARPWH
Ga0116214_103433233300009520Peatlands SoilDENLAALTVGQLPALSLAEAPDAYWAERAARPWH*
Ga0116220_1011857333300009525Peatlands SoilGAVTRAQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH*
Ga0105237_1128197213300009545Corn RhizosphereDENLAALTVGQVPPLSLAEAPGAYWAERAARPWH*
Ga0105238_1223635313300009551Corn RhizosphereTRAQLDENLAALSVGQLPALGLAEAPGAYWAQRAARPWH*
Ga0123356_1073808323300010049Termite GutVLSGAVTRAQLGENLAALTVGELPALGLAEAPDAYWAQRAVRPWH*
Ga0134067_1011825913300010321Grasslands SoilVTRAQLDQNLAALTVGQLPALSLAEAPDAYWAERAARPWH*
Ga0074044_1018364313300010343Bog Forest SoilVVLSGAVTRAQLDENLAALSVGPLPALSLAEAPGAYWAQRAARPWH*
Ga0126372_1281535213300010360Tropical Forest SoilQLDENLAALTVGQLPELSLAEAPGAYWAERSARPWH*
Ga0126381_10248022423300010376Tropical Forest SoilVTGAQLDENLAALAVGRLPALSLAEAPDAYWAERAARPWH*
Ga0136449_10079738943300010379Peatlands SoilTRAQLDENLAALTVGQLPALNLAEAPDAYWAQRAARPWH*
Ga0153924_104958513300012089Attine Ant Fungus GardensRAQLAENLAALTVGQVLPLSLAEDPDAYWAERAARPWH*
Ga0137364_1040033813300012198Vadose Zone SoilVHAGFAGVTRAQLEENLAALTVGHIPELIPAEAPDAYWAERAAR
Ga0137387_1038096613300012349Vadose Zone SoilAQLDENLAALTVGQVPPLSLAEAPGAYWAERAARPWH*
Ga0126369_1359086723300012971Tropical Forest SoilVLSGAVTRAQLDENLAALTVGQLPELSLAEAPGAYWAERSARPWH*
Ga0132257_10104118823300015373Arabidopsis RhizosphereEENLAALTVGQLPELSPAEAPDAYWAERAARPWH*
Ga0182036_1094254313300016270SoilVLSGAVTRAQLDENLAALTVGPLPALSLAEAPDAYWAQRAARPWH
Ga0182036_1099629423300016270SoilLSGAVTRKQLDENLAALTVGQLPALGLTEAPDAYWAERAARPWH
Ga0182039_1113320913300016422SoilLDQNLAALTVGQLPALSLAEAPGAYWAERAARPWH
Ga0187812_120592623300017821Freshwater SedimentQLEQNLTALTVGPLPELSLAETPDTYWAERAARPWH
Ga0187807_103816243300017926Freshwater SedimentVTRAQLDENLAALTLSQLPSLRLAESPGSYWAERAARPWQ
Ga0187806_114049823300017928Freshwater SedimentVTRVQLDENLAALTVGEIPALSLAEAPDAYWAERAARPWR
Ga0187814_1039037613300017932Freshwater SedimentQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH
Ga0187808_1019914223300017942Freshwater SedimentSGAVTSTQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH
Ga0187847_1091342013300017948PeatlandLSGAVTRAQLDENLAALTVGQLPALSLAEDPGAYWAERTARPWH
Ga0187815_1031675123300018001Freshwater SedimentSGAVTRAQLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH
Ga0187805_1003597033300018007Freshwater SedimentVLSGAVTRAQLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH
Ga0187805_1037096813300018007Freshwater SedimentVTRAQLDENLAALTVGQLPALSLAEAPDAYWAQRAARPWH
Ga0187810_1006586233300018012Freshwater SedimentVLSGAVTPAQLEQKLTALTVGPLPELSLAETPDTYWAERAARPWH
Ga0187863_1012539813300018034PeatlandLDENLAALTVGQLPALSLAEDPGAYWAERTARPWH
Ga0187871_1047617323300018042PeatlandLDENLAALTVGQLPPLSLAEDPGAYWAQRAARPWH
Ga0066662_1137278523300018468Grasslands SoilVTRAQLEENLAALTVGQLPELSLAEAPDAYWAERAARPWH
Ga0210395_1024102033300020582SoilRAQLDENLAALTVGQLPALGLAEPPDAYWAERAARPWH
Ga0210401_1093771413300020583SoilLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH
Ga0210396_1036437513300021180SoilQLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH
Ga0210397_1033736733300021403SoilGQLQSNLAALAVTDLPPLDLAEPPGAYWAERAARPWQ
Ga0210387_1051484213300021405SoilAQLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH
Ga0210387_1127279823300021405SoilLSGAVTRAQLDENLAALTVGQLPALDLAEAPNAYWAERAARPWH
Ga0210386_1146059913300021406SoilSGAVTRGQLDENLAALTVGQLPALSLAEAPVAYWEERAARPWH
Ga0210386_1157671213300021406SoilTRAQLDENLAALTVGQLPALSLAEAPGAYWAERAARPWH
Ga0210390_1106208423300021474SoilVTRGQLDENLAALTVGQLPALSLAEAPVAYWEERAARPWH
Ga0210410_1124359523300021479SoilAVTRAQLDENLAALTVGQLPALDLAEAPDAYWAERAARPWH
Ga0210409_1094650223300021559SoilSGAVTRAQLDGNLAALTVGQLPPLSLAEAPDAYWAERAARPWH
Ga0210409_1171652413300021559SoilQLDENLAALTVGPLPALSLAEAPGAYWAERAARPWH
Ga0126371_1387410423300021560Tropical Forest SoilGAVTRAQLDQNLAALNAGQFPALSLAEIPDTYWAERAARPWH
Ga0179589_1035883713300024288Vadose Zone SoilAQLDENLAALTVGQVPPLSLAEAPGAYWAERAARPWH
Ga0207684_1009793913300025910Corn, Switchgrass And Miscanthus RhizospherePRQLQSNLAALAVSDLHDLDIAEPPGSYWASRAARPWQ
Ga0207684_1077585113300025910Corn, Switchgrass And Miscanthus RhizosphereAVTRAQLDENLAALTVGQVPPLGLAEAPGAYWAERAARPWH
Ga0207671_1157400313300025914Corn RhizosphereTRAQLDENLAALTVGQLPALSLAEAPGAYWAQRAARPWH
Ga0207660_1033158113300025917Corn RhizosphereSGAVTSTQLEANLAALRVGELPALRLAEPPDAYWAARAARPWH
Ga0207694_1141001423300025924Corn RhizosphereAVTRAQLDENLAALSVGQLPALGLAEAPGAYWAQRAARPWH
Ga0207687_1031541813300025927Miscanthus RhizosphereVVLSGAVTRALLDENLAALTVGQVPPLSLAEAPGAYWAERAARPWH
Ga0207667_1182233013300025949Corn RhizosphereAVTRAQLEENLAALTVGQLPELSPAEAPDAYWAERAARPWH
Ga0207702_1082475313300026078Corn RhizosphereRAQLEENLAALTVGQLPELSLAEAPDAYWAERAARPWH
Ga0207683_1043249233300026121Miscanthus RhizosphereTRSQLEANLAALTVGELPALRLAEPPDAYWAARAARPWH
Ga0209266_126699313300026327SoilVTSTQLEANLAALTVGQLSALRLAEPPDAYWAARAARPWH
Ga0209577_1014798223300026552SoilVHAGFAGVTRAQLEENLAALTVGHIPELIPAEAPDAYWAERAARPWH
Ga0209178_109044013300027725Agricultural SoilLEGNLAALTVGQVPTLSLAEAPDAYWAERAARPWH
Ga0209693_1040065313300027855SoilAQLDENLAALTVGQLPALSLAEAPGAYWAQRAARPWH
Ga0209415_1028888913300027905Peatlands SoilVTRAQLDENLAALTVGQLPALSLAEPPDAYWAERAARPWH
Ga0302228_1024372523300028808PalsaQLDENLAALTVGQLPELSLAEDPSAYWAERAARPWH
Ga0302229_1052767523300028879PalsaLSGAVTRAQLDENLAALTVGQLPGLSLAEDPGAYWAERAARPWH
Ga0311340_1120268323300029943PalsaLAENLTALTVGQLPALSLAEDPAAYWQERAARPWH
Ga0311340_1158871813300029943PalsaRAQLDENLAALTVGQLPGLSLAEDPGAYWAERAARPWH
Ga0311339_1159083813300029999PalsaSGAVTRAQLDENLAALTVGQLPGLSLAEDPGAYWAERAARPWH
Ga0302181_1004952843300030056PalsaVTRAQLDENLAALTVGQLPGLSLAEDPGAYWAERAARPWH
Ga0302179_1020315213300030058PalsaVTRAQLDENLAALTVGPLPELSLAEDPGAYWAERAARPWH
Ga0302179_1052486113300030058PalsaAVTSGQLHANLAALAVGRLPRLDLAEPPDAYWRARSARPWR
Ga0302184_1041623913300030490PalsaRAQLDENLAALTVGQLPELSLAEDPGAYWAERAARPWH
Ga0311370_1121328623300030503PalsaSGAVTRAQLDENLAALTVGQLPELSLAEDPGAYWAERAARPWH
Ga0311355_1016012613300030580PalsaGAVTRAQLDENLAALTVGQLPELSLAEDPSAYWAERAARPWH
Ga0311355_1188259123300030580PalsaTRAQLDENLAALTVGQLPGLSLAEDPGAYWAERAARPWH
Ga0302311_1036882333300030739PalsaTRAQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH
Ga0318555_1003311713300031640SoilQQLDANLAALTVGELPGLDLAESPAGYWAARSARPWR
Ga0318542_1044691813300031668SoilRRQLGANLAALTVGELPGLDLAESPAGYWAARSARPWR
Ga0318542_1074654613300031668SoilVLSGAVTRAQLEENLAALTVGRLPALSLAEAPGAYWAQRAARPWR
Ga0318574_1005118213300031680SoilRAQLEENLAALTVGRLPALSLAEAPGAYWAQRAARPWR
Ga0318496_1029485813300031713SoilSMQLEANLAALRVGGLPALSLAESPDAYWAARAARPWH
Ga0318502_1029058723300031747SoilAVTSRQLGANLAALTVGELPGLDLAESPAGYWAARSARPWR
Ga0318494_1056532513300031751SoilVTRRQLGANLAALTVGELPGLDLAESPAGYWAARSARPWR
Ga0318521_1075528413300031770SoilLNENLAALTVGPLPAPSLAEAPDAYWAGRAARPWH
Ga0318546_1096125013300031771SoilVLSGAVTRAQLNENLAALTVGPLPALSLAEAPDAYWAGRAARPWH
Ga0318498_1007948913300031778SoilVLSGAVTSMQLQANLAALTVGELPALRLAEPPDAYWAARAARPWH
Ga0318503_1028513513300031794SoilTRTQLEENLAALTVGQLPELSLAEAPDAYWTERAARPWH
Ga0318523_1038000613300031798SoilVTSTQLEANLAALTVGELPALRLAEPPDAYRAARAARPWH
Ga0318497_1043292913300031805SoilSGAVTRTQLDENLAALTVGQLPALGLTEAPDAYWAERAARPWH
Ga0318512_1029378623300031846SoilSGAVTRAQLDENLAALTVGQLPALSLAEAPDAYWAERAARPWH
Ga0318527_1010507713300031859SoilRAQLEENLAALTVGQLPALSLAEAPDAYWAERAARPWH
Ga0318495_1026486013300031860SoilVLSGAVTRAQLDENLAALTVGPLPALSLAEAPDAYWVERAARPWH
Ga0318495_1031082613300031860SoilVVLSGAVTRTQLEENLAALTVGQLPELSLAEAPDAYWTERAARPWH
Ga0306921_1190038923300031912SoilSGAVTRAQLGENLAALAVGPLPALSLAEAPGAYWAERAGRPWH
Ga0310912_1061073423300031941SoilLEENLAALTVGRLPALSLAEAPGAYWAQRAARPWR
Ga0306926_1281992813300031954SoilQLDENLAALTVGPLPALSLAEAPDAYWAQRAARPWH
Ga0318530_1045554313300031959SoilRTQLDENLAALTVGQLPALGLTEAPDAYWAERAARPWH
Ga0318562_1077790823300032008SoilVTRAQLGENLAALAVGPLPALSLAEAPGAYWSERAGRPWH
Ga0318570_1020801113300032054SoilVTRTQLDENLAALTVGQLPALGLTEAPDAYWAERAARPWH
Ga0318504_1061672813300032063SoilRKQLDENLAALTVGQLPALGLTEAPDAYWAERAARPWH
Ga0318514_1036867023300032066SoilGSPRRQLGANLAALTVGELPGLDLAESPAGYWAARSARPWR
Ga0306924_1007571413300032076SoilRQQLDANLAALTVGELPGLDLAESPAGYWAARSARPWR
Ga0306924_1179287813300032076SoilRAQLEENLAALTVGELPALSLAEAPVAYWAERAARPWH
Ga0311301_1061501943300032160Peatlands SoilTRAQLDENLAALTVGQLPALNLAEAPDAYWAQRAARPWH
Ga0306920_10438021613300032261SoilVTRAQLDENLAALGVGQLPALSLAEAPDAYWAERAARPWH
Ga0335073_1148020613300033134SoilVTRPELDENLAALTVGQPPALNLAEAPDAYWAERAARPWH
Ga0334850_080501_3_1193300033828SoilSRQLHANLAALAVGELPRLDLAEPPAAYWQARSARPWR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.