NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074916

Metagenome / Metatranscriptome Family F074916

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074916
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 182 residues
Representative Sequence KYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Number of Associated Samples 95
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.84 %
% of genes near scaffold ends (potentially truncated) 88.24 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater
(44.538 % of family members)
Environment Ontology (ENVO) Unclassified
(79.832 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(52.941 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 7.07%    β-sheet: 26.63%    Coil/Unstructured: 66.30%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003683|Ga0008459J53047_1059468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani628Open in IMG/M
3300006382|Ga0075494_1402847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani506Open in IMG/M
3300006419|Ga0075496_1432674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani560Open in IMG/M
3300008958|Ga0104259_1024703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani612Open in IMG/M
3300008993|Ga0104258_1106954All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani523Open in IMG/M
3300009071|Ga0115566_10378986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani819Open in IMG/M
3300009071|Ga0115566_10431011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani756Open in IMG/M
3300009440|Ga0115561_1200295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani760Open in IMG/M
3300009442|Ga0115563_1185361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani809Open in IMG/M
3300009445|Ga0115553_1243227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300009495|Ga0115571_1176693All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani883Open in IMG/M
3300009505|Ga0115564_10232710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani946Open in IMG/M
3300009592|Ga0115101_1757374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani700Open in IMG/M
3300009599|Ga0115103_1549391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300009606|Ga0115102_10471105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani707Open in IMG/M
3300009606|Ga0115102_10825009All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300009677|Ga0115104_11004534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani536Open in IMG/M
3300010404|Ga0129323_1042043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani717Open in IMG/M
3300012470|Ga0129329_1030185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300012472|Ga0129328_1124420All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani603Open in IMG/M
3300012504|Ga0129347_1115162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani723Open in IMG/M
3300012516|Ga0129325_1274339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani774Open in IMG/M
3300012520|Ga0129344_1234811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300012522|Ga0129326_1223717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani631Open in IMG/M
3300012523|Ga0129350_1163600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani795Open in IMG/M
3300012524|Ga0129331_1270805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani652Open in IMG/M
3300012525|Ga0129353_1862440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani519Open in IMG/M
3300012528|Ga0129352_10257398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300012782|Ga0138268_1516409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani653Open in IMG/M
3300012963|Ga0129340_1329251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300012965|Ga0129346_1039253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani816Open in IMG/M
3300016732|Ga0182057_1053937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani620Open in IMG/M
3300018418|Ga0181567_10623360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300018599|Ga0188834_1026889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300018692|Ga0192944_1035094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani727Open in IMG/M
3300018825|Ga0193048_1050380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani632Open in IMG/M
3300018846|Ga0193253_1108644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani638Open in IMG/M
3300018874|Ga0192977_1081709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani651Open in IMG/M
3300018899|Ga0193090_1082479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani743Open in IMG/M
3300018974|Ga0192873_10309048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani670Open in IMG/M
3300018982|Ga0192947_10125552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani856Open in IMG/M
3300019021|Ga0192982_10290208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300019036|Ga0192945_10120984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani834Open in IMG/M
3300019036|Ga0192945_10172658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300019081|Ga0188838_107595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani708Open in IMG/M
3300019081|Ga0188838_110723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani609Open in IMG/M
3300019095|Ga0188866_1024048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani640Open in IMG/M
3300019095|Ga0188866_1024449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani634Open in IMG/M
3300019103|Ga0192946_1052753All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani602Open in IMG/M
3300019131|Ga0193249_1141251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani520Open in IMG/M
3300019149|Ga0188870_10117439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani627Open in IMG/M
3300019272|Ga0182059_1318140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani528Open in IMG/M
3300021350|Ga0206692_1898253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300021353|Ga0206693_1846435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani659Open in IMG/M
3300021365|Ga0206123_10201669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani884Open in IMG/M
3300021872|Ga0063132_139881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani557Open in IMG/M
3300021954|Ga0063755_1140310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani522Open in IMG/M
3300025897|Ga0209425_10512461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani549Open in IMG/M
3300026495|Ga0247571_1083561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani736Open in IMG/M
3300028137|Ga0256412_1209134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani720Open in IMG/M
3300028137|Ga0256412_1265934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani632Open in IMG/M
3300028282|Ga0256413_1205304All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani706Open in IMG/M
3300028334|Ga0247597_1036015All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani661Open in IMG/M
3300030709|Ga0307400_10706365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani626Open in IMG/M
3300031579|Ga0308134_1101126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani658Open in IMG/M
3300032463|Ga0314684_10512332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani703Open in IMG/M
3300032463|Ga0314684_10533488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani687Open in IMG/M
3300032470|Ga0314670_10328870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani797Open in IMG/M
3300032470|Ga0314670_10341172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300032470|Ga0314670_10428164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani693Open in IMG/M
3300032481|Ga0314668_10413575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300032481|Ga0314668_10436131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani674Open in IMG/M
3300032492|Ga0314679_10260614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani793Open in IMG/M
3300032492|Ga0314679_10382265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani639Open in IMG/M
3300032517|Ga0314688_10409354All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300032517|Ga0314688_10697095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300032520|Ga0314667_10472615All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300032521|Ga0314680_10540086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani735Open in IMG/M
3300032521|Ga0314680_10819884All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300032540|Ga0314682_10338878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani826Open in IMG/M
3300032616|Ga0314671_10458904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani695Open in IMG/M
3300032617|Ga0314683_10510544All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300032617|Ga0314683_10735920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300032650|Ga0314673_10495519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300032650|Ga0314673_10590878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani572Open in IMG/M
3300032651|Ga0314685_10413631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani747Open in IMG/M
3300032651|Ga0314685_10497151All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300032651|Ga0314685_10514974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300032651|Ga0314685_10565836All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani621Open in IMG/M
3300032666|Ga0314678_10346023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani671Open in IMG/M
3300032707|Ga0314687_10592824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani618Open in IMG/M
3300032708|Ga0314669_10462829All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300032708|Ga0314669_10483820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani681Open in IMG/M
3300032709|Ga0314672_1307966All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300032711|Ga0314681_10531309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani659Open in IMG/M
3300032713|Ga0314690_10395565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani686Open in IMG/M
3300032713|Ga0314690_10418979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani665Open in IMG/M
3300032723|Ga0314703_10235663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani759Open in IMG/M
3300032724|Ga0314695_1258438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani667Open in IMG/M
3300032725|Ga0314702_1248707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani679Open in IMG/M
3300032726|Ga0314698_10343528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani678Open in IMG/M
3300032728|Ga0314696_10379460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani732Open in IMG/M
3300032732|Ga0314711_10383644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani728Open in IMG/M
3300032732|Ga0314711_10413546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300032732|Ga0314711_10517538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani611Open in IMG/M
3300032734|Ga0314706_10568751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani543Open in IMG/M
3300032742|Ga0314710_10301515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300032742|Ga0314710_10374912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani592Open in IMG/M
3300032742|Ga0314710_10397881All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300032743|Ga0314707_10426669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani692Open in IMG/M
3300032745|Ga0314704_10788450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani503Open in IMG/M
3300032746|Ga0314701_10468429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300032747|Ga0314712_10426551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani630Open in IMG/M
3300032748|Ga0314713_10243988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani762Open in IMG/M
3300032750|Ga0314708_10322004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani759Open in IMG/M
3300032751|Ga0314694_10344828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani637Open in IMG/M
3300032754|Ga0314692_10110680All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina1368Open in IMG/M
3300032755|Ga0314709_10852845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani533Open in IMG/M
3300033572|Ga0307390_10749189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani614Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater44.54%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine14.29%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.61%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.88%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake5.04%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.20%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.20%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.52%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh2.52%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.68%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.84%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.84%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019081Metatranscriptome of marine microbial communities from Baltic Sea - GS676_3p0_dTEnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032750Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0008459J53047_105946813300003683SeawaterGEADDEVLAREEPTDKGYKWENPNSWHDDGENDDWVIVQVAQEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQYFDTHFLYGGTDDPALAAAQAQNAHLES*
Ga0075494_140284713300006382AqueousVIALIGQASAIHLGYAESEGPTKADYGEADGTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSK
Ga0075496_143267413300006419AqueousEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSKE*
Ga0104259_102470313300008958Ocean WaterAVLALLGHVSAINLSYAEAEGPTKADYGEADDTVLAREEADSKDYKWVNPNSVHDDGADDDWVVVQVASEDVTLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE*
Ga0104258_110695413300008993Ocean WaterAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNVFGDAGDDTHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQYFDTHFLYGGTDDPALA
Ga0115566_1037898613300009071Pelagic MarineMKFIYTTAVLALLGHVSAINLSYAEAEGPTKADYGEADDTVLAREEADSKDYKWVNPNSVHDDGADDDWVVVQVASEDVTLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDRFYYPNQYGDAGDDIHNTHHGNLPGHLQLENYETPPREHKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN*
Ga0115566_1043101113300009071Pelagic MarineLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSKE*
Ga0115561_120029523300009440Pelagic MarineMKFIYTSAVIALLGQASAINLKYAESEGPTKSDYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN*
Ga0115563_118536113300009442Pelagic MarineNVAVIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPEHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSKE*
Ga0115553_124322713300009445Pelagic MarineMKFIYTTAVLALLGHVSAINLSYAEAEGPTKADYGEADDTVLAREDADSKDYKWVNPNSVHDDGADDDWVVVQVASEDVTLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDRFYYPNQYGDAGDDIHNTHHGNLPGHLQLENYETPPREHKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN*
Ga0115571_117669313300009495Pelagic MarineMKFNVAVIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHRNLPGHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSKE*
Ga0115564_1023271013300009505Pelagic MarineMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE*
Ga0115101_175737413300009592MarineFIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE*
Ga0115103_154939113300009599MarineKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE*
Ga0115102_1047110513300009606MarineAVLALLGHVSAINLSYAEAEGPTKADYGEADDTVLAREEADSKDYKWVNPNSVHDDGADDDWVVVQVASEDVTLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDRFYYPNQYGDAGDDIHNTHHGNLPGHLQLENYETPPREHKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN*
Ga0115102_1082500913300009606MarineMKFNVAVIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRQIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPTQVKLYKFNKD*
Ga0115104_1100453413300009677MarineSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHPPTQVKMYKFQPDQKFDTHYLYGGSQE*
Ga0129323_104204313300010404AqueousKFNVAVIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSKE*
Ga0129329_103018513300012470AqueousFNVAVIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSKE*
Ga0129328_112442013300012472AqueousIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSKE*
Ga0129347_111516213300012504AqueousKFIYTSAVVALLGQASAITLKYAEAEGPTKADYGEADDLVVPRQEPDDKDYKWKNPLGFHDDGTDDDWVVVQVAEEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDIHNTHHGNLPGHLRLEEYEYPPKDHNLYKFQTASYFDTHFLYGGSDDPALKAAQEANAHLEV*
Ga0129325_127433913300012516AqueousFIMKFNVAVIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRQIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSKECKN
Ga0129344_123481113300012520AqueousIYTSAVVALLGQASAITLKYAEAEGPTKADYGEADDLVVPRQEPDDKDYKWKNPLGFHDDGTDDDWVVVQVAEEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDIHNTHHGNLPGHLRLEEYEYPPKDHNLYKFQTASYFDTHFLYGGSDDPALKAAQEANAHLEV*
Ga0129326_122371713300012522AqueousMKFNVAVIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSKE*
Ga0129350_116360023300012523AqueousIMKFIYTSAVVALLGQASAITLKYAEAEGPTKADYGEADDLVVPRQEPDDKDYKWKNPLGFHDDGTDDDWVVVQVAEEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDIHNTHHGNLPGHLRLEEYEYPPKDHNLYKFQTASYFDTHFLYGGSDDPALKAAQEANAHLEV*
Ga0129331_127080513300012524AqueousFIMKFNVAVIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSKE*
Ga0129353_186244013300012525AqueousSAVVALLGQASAITLKYAEAEGPTKADYGEADDLVVPRQEPDDKDYKWKNPLGFHDDGTDDDWVVVQVAEEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDIHNTHHGNLPGHLRLDEYEYPPKDHNLYKFQTASYFDTHFLYGGSDDP
Ga0129352_1025739813300012528AqueousGICIMKFIYTSAVVALLGQASAITLKYAEAEGPTKADYGEADDLVVPRQEPDDKDYKWKNPLGFHDDGTDDDWVVVQVAEEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDIHNTHHGNLPGHLRLEEYEYPPKDHNLYKFQTASYFDTHFLYGGSDDPALKAAQEANAHLEV*
Ga0138268_151640913300012782Polar MarineSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGGDDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDVYNTHHGNLPGHLRLEEYETAPTQVNLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE*
Ga0129340_132925113300012963AqueousSAVVALLGQASAITLKYAEAEGPTKADYGEADDLVVPRQEPDDKDYKWKNPLGFHDDGTDDDWVVVQVAEEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDIHNTHHGNLPGHLRLEEYEYPPKDHNLYKFQTASYFDTHFLYGGSDDPALKAAQEANAHLEV*
Ga0129346_103925313300012965AqueousMKFIYTSAVVALLGQASAITLKYAEAEGPTKADYGEADDLVVPRQEPDDKDYKWKNPLGFHDDGTDDDWVVVQVAEEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDIHNTHHGNLPGHLRLEEYEYPPKDHNLYKFQTASYFDTHFLYGGSDDPALKAAQEANAHLEV*
Ga0182057_105393713300016732Salt MarshIYTSAVVALLGQASAITLKYAEAEGPTKADYGEADDLVVPRQEPDDKDYKWKNPLGFHDDGTDDDWVVVQVAEEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDIHNTHHGNLPGHLRLEEYEYPPKDHNLYKFQTASYFDTHFLYGGSDDPALKAAQEANAHLEV
Ga0181567_1062336013300018418Salt MarshMKFIYTSAVVALLGQASAITLKYAEAEGPTKADYGEADDLVVPRQEPDDKDYKWKNPLGFHDDGTDDDWVVVQVAEEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDIHNTHHGNLPGHLRLEEYEYPPKDHNLYKFQTASYFDTHFLYGGSDDPALKAAQEANAHLEV
Ga0188834_102688913300018599Freshwater LakePTKADYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDEVQNTHHGNLPGHLSLEEYETPPKEHKLYDFAPSQFHDTHSLYGGTDDPALAAAQAENAHLN
Ga0192944_103509413300018692MarineMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0193048_105038013300018825MarineFAVIALLGQAAAINLQYAVSEGPTKADYGEADDTVLPRDDRDTSGWVNPLSLHDDGADDDWVVVQVAQEDVSLLQLSAKKDLYGKRRIYDLDGDGVEDNVKRSRDELDDFYYPNRFGDSGDDVYNTHHGNLPGHLRLEEYEYPPKDRKLYKFAPDQKFDTHYLFGGSKGVNAE
Ga0193253_110864413300018846MarineSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0192977_108170913300018874MarineKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGGDDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDVYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0193090_108247913300018899MarineMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGGDDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDVYNTHHGNLPGHLRLEEYETAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0192873_1030904813300018974MarineMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLSRDDRETSGWVNPLSVHDDGADDDWVVVQVSQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0192947_1012555213300018982MarineMGIIILIMKFIYTTAVLALLGHVSAINLSYVEAEGPTKADYGEADDTVLAREEADSKDYKWVNPNSVHDDGADDDWVVVQVASEDVTLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDRFYYPNQYGDAGDDIHNTHHGNLPGHLQLENYETPPREHKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN
Ga0192982_1029020813300019021MarineINLQYAVSEGPTKADYGEADDTILPRDDRSTSGWVNPNSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRRIYDLDGDGVEDNVKRSRDELDDFYYPNRFGDSGDDVYNTHHGNLPGHVRLEEYEMPPKDGKLYKFAPDQKFDTHALFGGSKKA
Ga0192945_1012098413300019036MarineLLFALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0192945_1017265813300019036MarineLSYAEAEGPTKADYGEADDTVLAREEADSKDYKWVNPNSVHDDGADDDWVVVQVASEDVTLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDRFYYPNQYGDAGDDIHNTHHGNLPGHLQLENYETPPKERKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN
Ga0188838_10759513300019081Freshwater LakeTSAVIALLGQASAINLKYAESEGPTKADYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGYAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0188838_11072313300019081Freshwater LakeESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDEVQNTHHGNLPGHLSLEEYETPPKEHKLYDFAPSQFHDTHSLYGGTDDPALAAAQAENAHLN
Ga0188866_102404813300019095Freshwater LakeMKFAVIALLGQAAAINLQYAESEGPTKADYGEADDVVLPRDDRETSGWVNPLSLHDDGADDDWVVVQVAQEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNRFGDAGDDVYNTHHGNLPGHLRLEEYEYPPKDHKLYKFAPNTFHDTHFLFGGSK
Ga0188866_102444913300019095Freshwater LakeFIMKFNVAVIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRQIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPAQVKLYKFNKDQFHDTHYLFGGSGSKE
Ga0192946_105275313300019103MarineAINLSYAEAEGPTKADYGEADDTVLAREEADSKDYKWVNPNSVHDDGADDDWVVVQVASEDVTLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDRFYYPNQYGDAGDDIHNTHHGNLPGHLQLENYETPPREHKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN
Ga0193249_114125113300019131MarineGQAAAINLQYAVSEGPTKADYGEADDTVLPRDDRDTSGWVNPLSLHDDGADDDWVVVQVAQEDVSLLQLSAKKDLYGKRRIYDLDGDGVEDNVKRSRDELDDFYYPNRFGDSGDDVYNTHHGNLPGHLRLEEYEYPPKDRKLYKFAPDQKFDTHYLFGGSKGVNAE
Ga0188870_1011743913300019149Freshwater LakeMKFNVAVIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRQIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPAQVKLYKFNKDQFHDTHYLFGGSGSKE
Ga0182059_131814013300019272Salt MarshMKFIYTSAVVALLGQASAITLKYAEAEGPTKADYGEADDLVVPRQEPDDKDYKWKNPLGFHDDGTDDDWVVVQVAEEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDIHNTHHGNLPGHLRLEEYEYPPKDHNLYKFQTASYFDTHFLYGGSD
Ga0206692_189825313300021350SeawaterTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0206693_184643513300021353SeawaterKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0206123_1020166913300021365SeawaterMKFNVAVIALIGQASAIHLGYAESEGPTKADYGEADDTVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEMPPTQVKLYKFNKDQFHDTHYLFGGSGSKE
Ga0063132_13988113300021872MarineAFRLQYAESEGPTKADYGEADETVVPRADRFSSESTWVNPLSLHDDGADDDWVVVQVDAEDVSLLQLSSKKDLYGKRRIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEYPPKQIKLYDFAKDQFFDTHYLFGGSKK
Ga0063755_114031013300021954MarineMKFISNVAVIALIGQASAINLQYAVSEGPTKADYGEADDTVLARADRSTSGWTNPLSVHDDGADDDWVVVQVAEEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNIKRSRDELDDFYYPNRFGDAGDDTYNTHHGNLPGHVRLEEYEMPPKQNNLYKHDAE
Ga0209425_1051246113300025897Pelagic MarineMKFIYTTAVLALLGHVSAINLSYAEAEGPTKADYGEADDTVLAREEADSKDYKWVNPNSVHDDGADDDWVVVQVASEDVTLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDRFYYPNQYGDAGDDIHNTHHGNLPGHLQLENYETPPREHKL
Ga0247571_108356113300026495SeawaterIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0256412_120913413300028137SeawaterFIYTTAVLALLGHVSAINLSYAEAEGPTKADYGEADDTVLAREEADSKDYKWVNPNSVHDDGADDDWVVVQVASEDVTLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDRFYYPNQYGDAGDDIHNTHHGNLPGHLQLENYETPPREHKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN
Ga0256412_126593413300028137SeawaterFAVIALLGQAAAINLQYATSEGPTKADYGEADDTVLPRDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLSAKKDLYGKRKIYDLDGDGVEDNVKRTRDELDDFYYPNRFGDAGDDVYNTHHGNLPGHLRLEEYEFPPKDRNLYRFQENSHFDTHFLYGGGEKVVNK
Ga0256413_120530413300028282SeawaterKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYSNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0247597_103601513300028334SeawaterAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKV
Ga0307400_1070636513300030709MarineKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGGDDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDVYNTHHGNLPGHLRLEEYETAPTQVKLYKFAPDQFFDTHYLFGGSDPAIVKAKKAVKVE
Ga0308134_110112613300031579MarineMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDVYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314684_1051233213300032463SeawaterIMKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314684_1053348813300032463SeawaterFIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314670_1032887013300032470SeawaterVIALLGQASAINLKYAESEGPTKADYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314670_1034117223300032470SeawaterMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314670_1042816413300032470SeawaterIMKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN
Ga0314668_1041357513300032481SeawaterMKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314668_1043613113300032481SeawaterIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314679_1026061413300032492SeawaterVIYTSAVIALLGQASAINLKYAESEGPTKADYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314679_1038226513300032492SeawaterKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314688_1040935413300032517SeawaterKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314688_1069709513300032517SeawaterFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPAL
Ga0314667_1047261513300032520SeawaterMKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN
Ga0314680_1054008613300032521SeawaterFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKESKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314680_1081988413300032521SeawaterMKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314682_1033887813300032540SeawaterIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314671_1045890413300032616SeawaterLFIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314683_1051054413300032617SeawaterFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314683_1073592013300032617SeawaterEPRQFRASCSKNRQLQKVLTQDIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALV
Ga0314673_1049551913300032650SeawaterLFIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTEVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314673_1059087813300032650SeawaterFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314685_1041363113300032651SeawaterQRYRVFIEGYVQRLLGGQQIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVFLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN
Ga0314685_1049715113300032651SeawaterGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314685_1051497413300032651SeawaterLFIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314685_1056583613300032651SeawaterHKFKVSMHTPNLTLPSASEIIILSKPKASAINLKYAESEGPTKADYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314678_1034602313300032666SeawaterIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314687_1059282413300032707SeawaterKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314669_1046282913300032708SeawaterKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN
Ga0314669_1048382013300032708SeawaterKFTYSSAVIALLGQALAINLKYAESEGPTKADYGEADDLVLPREAGESDDYKWVNPNSVHDDGADDEWVIVQVDQEDVSLIQLESSALKNLYGKRAIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPWEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314672_130796613300032709SeawaterSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314681_1053130913300032711SeawaterFIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314690_1039556513300032713SeawaterKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSHFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314690_1041897913300032713SeawaterMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314703_1023566313300032723SeawaterLIMKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLIKLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314695_125843813300032724SeawaterVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314702_124870713300032725SeawaterAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGSDDPALAAAQSENAHLN
Ga0314698_1034352813300032726SeawaterKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGSDDPALAAAQAENAHLN
Ga0314696_1037946013300032728SeawaterQPVRAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314711_1038364413300032732SeawaterIMKFICTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314711_1041354613300032732SeawaterKADYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314711_1051753813300032732SeawaterAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKV
Ga0314706_1056875113300032734SeawaterLFIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVK
Ga0314710_1030151513300032742SeawaterFIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314710_1037491213300032742SeawaterMKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314710_1039788113300032742SeawaterQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314707_1042666913300032743SeawaterFIMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWVNPLSVHDDGADDDWVVVQVAQEDVSLLQLESKKDLYGKRRIYDLDGDGVEDNVKRSRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314704_1078845013300032745SeawaterKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPPQFH
Ga0314701_1046842913300032746SeawaterKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPALAAAQAEN
Ga0314712_1042655113300032747SeawaterKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYNFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314713_1024398813300032748SeawaterALLGQASAINLKYAESEGPTKADYGEADDEVLAREESTDKGYKWENPLSWHDDGENDDWVIVQVQQEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYERPPKEHKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHL
Ga0314708_1032200413300032750SeawaterYIMKFIYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314694_1034482813300032751SeawaterKMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVKAKKEAKVE
Ga0314692_1011068013300032754SeawaterLAQCRERVPRSMSRGRSFSELACAVWCCGAYTSAVIALLGQASAINLKYAESEGPTKADYGEADESVVGRDVTNDQALDGKWVNPNSVHDDGADDDWVVVQVASEDVSLLQLESKKDLYGKRQIYDLDGDGVEDNVKRSRDELDRFYYPNQFGDAGDDVHNTHHGNLPGHLRLEEYEKPPKERKLYDFAPSQFHDTHFLYGGTDDPALAAAQAENAHLN
Ga0314709_1085284513300032755SeawaterMKYSAVVIALIGQASAINLQYAESEGPTKADYGEADDSVLARDDRETSGWINPLAVHDDGADDDWVVVQVEQEDVSLLQLESKKDLYGKRKIYDLDGDGVEDNVKRNRDELDDFYYPNQFGDAGDDIYNTHHGNLPGHLRLEEYEHAPTQVKLYKFAPDQFFDTHYLFGGSDPALVK
Ga0307390_1074918913300033572MarineIYTMKFAVIALLASNAAAINLQYAVSEGPTKADYGEADDTVLPRDDRSTSGWVNPNSVHDDGADDDWVVVQVAAEDVSLLQLSAKKDLYGKRRIYDLDGDGVEDNVKRSRDELDDFYYPNRFGDSGDDVYNTHHGNLPGHVRLEEYEMPPKDGKLYKFAPDQKFDTHALFGGSKKA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.