NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F074947

Metagenome / Metatranscriptome Family F074947

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F074947
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 127 residues
Representative Sequence PRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Number of Associated Samples 105
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.81 %
% of genes near scaffold ends (potentially truncated) 84.03 %
% of genes from short scaffolds (< 2000 bps) 87.39 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (85.714 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(26.891 % of family members)
Environment Ontology (ENVO) Unclassified
(52.101 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(63.866 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.04%    β-sheet: 0.00%    Coil/Unstructured: 41.96%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.71 %
UnclassifiedrootN/A14.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003681|Ga0008457_1044511All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii646Open in IMG/M
3300004764|Ga0007754_1434682All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii562Open in IMG/M
3300004769|Ga0007748_10217457All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii857Open in IMG/M
3300004787|Ga0007755_1526313All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii515Open in IMG/M
3300004792|Ga0007761_11351281All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii603Open in IMG/M
3300004796|Ga0007763_11622922All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii556Open in IMG/M
3300004810|Ga0007757_11234891All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii558Open in IMG/M
3300005419|Ga0068883_1579336All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii604Open in IMG/M
3300006356|Ga0075487_1079836All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii645Open in IMG/M
3300006373|Ga0075483_1015701All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii508Open in IMG/M
3300006384|Ga0075516_1416930Not Available589Open in IMG/M
3300006394|Ga0075492_1514819All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii568Open in IMG/M
3300006396|Ga0075493_1570998All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii530Open in IMG/M
3300006602|Ga0075484_1019616All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii743Open in IMG/M
3300007520|Ga0105054_10020688All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii7491Open in IMG/M
3300007722|Ga0105051_10193659All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii1560Open in IMG/M
3300009592|Ga0115101_1419689All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii758Open in IMG/M
3300009606|Ga0115102_10836925All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii655Open in IMG/M
3300009608|Ga0115100_10206353All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii714Open in IMG/M
3300009608|Ga0115100_10659323All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii945Open in IMG/M
3300009608|Ga0115100_11253458All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii740Open in IMG/M
3300009677|Ga0115104_10812025All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii616Open in IMG/M
3300010306|Ga0129322_1105845All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii739Open in IMG/M
3300010404|Ga0129323_1048220All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii695Open in IMG/M
3300010885|Ga0133913_11234412All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii1914Open in IMG/M
3300012504|Ga0129347_1195123Not Available623Open in IMG/M
3300012522|Ga0129326_1329632All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii537Open in IMG/M
3300012709|Ga0157608_1069374All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii520Open in IMG/M
3300012720|Ga0157613_1003965All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii735Open in IMG/M
3300012723|Ga0157604_1119420All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii834Open in IMG/M
3300012966|Ga0129341_1039821All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii645Open in IMG/M
3300012966|Ga0129341_1118129All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii768Open in IMG/M
3300012970|Ga0129338_1592444All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii774Open in IMG/M
3300013295|Ga0170791_13780688All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii623Open in IMG/M
3300016731|Ga0182094_1110648All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii682Open in IMG/M
3300016740|Ga0182096_1345281All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii613Open in IMG/M
3300016740|Ga0182096_1347332All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii687Open in IMG/M
3300016766|Ga0182091_1073454All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii521Open in IMG/M
3300018601|Ga0188850_1015860All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii698Open in IMG/M
3300018622|Ga0188862_1017836All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii659Open in IMG/M
3300018742|Ga0193138_1052378All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii536Open in IMG/M
3300018781|Ga0193380_1041390All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii719Open in IMG/M
3300018825|Ga0193048_1051173All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii626Open in IMG/M
3300018825|Ga0193048_1059056All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii581Open in IMG/M
3300018836|Ga0192870_1079528All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii553Open in IMG/M
3300019032|Ga0192869_10203182All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii843Open in IMG/M
3300019032|Ga0192869_10281106All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii724Open in IMG/M
3300019032|Ga0192869_10507930All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii514Open in IMG/M
3300019045|Ga0193336_10516485All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii577Open in IMG/M
3300019083|Ga0188854_1008509All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii590Open in IMG/M
3300019095|Ga0188866_1024672All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii631Open in IMG/M
3300019149|Ga0188870_10063733All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii899Open in IMG/M
3300021312|Ga0210306_1068850All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii593Open in IMG/M
3300021350|Ga0206692_1674800All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii534Open in IMG/M
3300021847|Ga0210305_1054712All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii625Open in IMG/M
3300021897|Ga0063873_1014933All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii650Open in IMG/M
3300021897|Ga0063873_1033865All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii635Open in IMG/M
3300021897|Ga0063873_1052277All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii554Open in IMG/M
3300021899|Ga0063144_1031970All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii811Open in IMG/M
3300021905|Ga0063088_1045147All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii570Open in IMG/M
3300021910|Ga0063100_1065954All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii695Open in IMG/M
3300021913|Ga0063104_1049401All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii744Open in IMG/M
3300021921|Ga0063870_1009584All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii745Open in IMG/M
3300021922|Ga0063869_1007339All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii643Open in IMG/M
3300021923|Ga0063091_1013274All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii748Open in IMG/M
3300021924|Ga0063085_1043952All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii658Open in IMG/M
3300021924|Ga0063085_1049750All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii707Open in IMG/M
3300021925|Ga0063096_1069771All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii636Open in IMG/M
3300021926|Ga0063871_1009483All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii682Open in IMG/M
3300021930|Ga0063145_1035713All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii790Open in IMG/M
3300021930|Ga0063145_1083629All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii510Open in IMG/M
3300021932|Ga0063872_1028078All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii628Open in IMG/M
3300021937|Ga0063754_1021508All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii776Open in IMG/M
3300021939|Ga0063095_1145046All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii710Open in IMG/M
3300021940|Ga0063108_1072096All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii702Open in IMG/M
3300021941|Ga0063102_1108651All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii651Open in IMG/M
3300021943|Ga0063094_1123277All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii502Open in IMG/M
3300024863|Ga0255246_1144505All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii552Open in IMG/M
3300026434|Ga0247591_1076740Not Available627Open in IMG/M
3300026448|Ga0247594_1035702All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii844Open in IMG/M
3300026495|Ga0247571_1117983All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii620Open in IMG/M
3300027832|Ga0209491_10161337All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii1999Open in IMG/M
3300027983|Ga0209284_10316975All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii785Open in IMG/M
3300030671|Ga0307403_10557368All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii620Open in IMG/M
3300031752|Ga0307404_10257064All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii723Open in IMG/M
3300032463|Ga0314684_10524937All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii694Open in IMG/M
3300032492|Ga0314679_10294190All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii742Open in IMG/M
3300032519|Ga0314676_10088811All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii1502Open in IMG/M
3300032520|Ga0314667_10096881All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii1369Open in IMG/M
3300032521|Ga0314680_10461256All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii796Open in IMG/M
3300032540|Ga0314682_10608574All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii597Open in IMG/M
3300032616|Ga0314671_10124023All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii1304Open in IMG/M
3300032617|Ga0314683_10923151All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii519Open in IMG/M
3300032650|Ga0314673_10444527All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii668Open in IMG/M
3300032708|Ga0314669_10520574All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii655Open in IMG/M
3300032726|Ga0314698_10250649All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii807Open in IMG/M
3300032728|Ga0314696_10554680All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii588Open in IMG/M
3300032730|Ga0314699_10522812All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii533Open in IMG/M
3300032734|Ga0314706_10392273All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii672Open in IMG/M
3300032742|Ga0314710_10047332All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii1400Open in IMG/M
3300032744|Ga0314705_10477249All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii670Open in IMG/M
3300032745|Ga0314704_10506275All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii665Open in IMG/M
3300032748|Ga0314713_10068029All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii1314Open in IMG/M
3300032752|Ga0314700_10380749All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii749Open in IMG/M
3300032755|Ga0314709_10567975All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Cryptomonadales → Hemiselmidaceae → Hemiselmis → Hemiselmis andersenii689Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine26.89%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater17.65%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine13.45%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake10.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater5.04%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.20%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.36%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.52%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.68%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.68%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.84%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003681Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_48_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003712Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004764Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004787Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004796Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004810Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005419Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006373Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006602Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007520Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300007523Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03EnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010306Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012709Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012720Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012723Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016731Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018601Metatranscriptome of marine microbial communities from Baltic Sea - GS679_3p0_dTEnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018781Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789655-ERR1719256)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019083Metatranscriptome of marine microbial communities from Baltic Sea - GS680_3p0_dTEnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021312Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021847Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1070 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021875Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S30 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021897Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021923Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-8M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021926Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 ARK-20-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021932Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021937Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 Euk ARK-20-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300024863Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027832Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0008457_104451113300003681SeawaterLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVADPHSAANSLFKQNDNFGYKARTQILAQEKPQVNVWKQIGAPEPKVAATQLMKQNDNFGY*
Ga0008276_10649613300003712MarineTQMLEQTAKGFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAEKSQNVNVWKQIGAQEPKAAAQQLMKQNDNFGY*
Ga0007754_143468213300004764Freshwater LakeKQNDNFGYKARPQMLEQKSANTFPSVWTQIGVEDPHSAANGLFKQNDNFGYKARPQMLAEKPQRVNVWNQIGAPEPKVAAAKLMKQNDNFGY*
Ga0007748_1021745723300004769Freshwater LakeVWQQIGAEQPQVAAQQLMKQNDNFGYKARPQMLEQKSANTFPSVWTQIGVEDPHSAANGLFKQNDNFGYKARPQMLAEKPQRVNVWNQIGAPEPKVAAAKLMKQNDNFGY*
Ga0007755_152631313300004787Freshwater LakeQLMKQNDNFGYKAPTQMLEQKSANTFPSVWTQIGVKDPHSAANALFKQNDNFGYKARPQMLAEKPQRVNVWQQIGATEPKVAAAKLMKQNDNFGY*
Ga0007761_1135128113300004792Freshwater LakeNVWQQIGAEQPQVAAQQLMKQNDNFGYKAPTQMLEQKSANTFPSVWTQIGVKDPHSAANALFKQNDNFGYKARPQMLAEKPQRVNVWQQIGATEPKVAAAKLMKQNDNFGY*
Ga0007763_1162292213300004796Freshwater LakeAAQQLMKQNDNFGYKARPQMLEQKSANTFPSVWTQIGVEDPHSAANGLFKQNDNFGYKARPQMLAEKPQRVNVWNQIGAPEPKVAAAKLMKQNDNFGY*
Ga0007757_1123489113300004810Freshwater LakeDNYGYKARKVMLAQRAAPKTVWQQIGAESPEAAAQSLMTKNDNFGYKAPTQMLEEKQAFPSVWQQIGVEDPHAAANGLFKQNDNFGYKAPTQMLAEVKPTVNVWKQIGAQEPKLAAKDVMKKNDNFGY*
Ga0068883_157933613300005419Freshwater LakeQNDNFGYKARPQMLEQKSANTFPSVWTQIGVEDPHSAANGLFKQNDNFGYKARPQMLAEKPQRVNVWNQIGAPEPKVAAAKLMKQNDNFGY*
Ga0075487_107983613300006356AqueousKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY*
Ga0075483_101570113300006373AqueousNVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY*
Ga0075516_141693013300006384AqueousVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY*
Ga0075492_151481913300006394AqueousPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY*
Ga0075493_157099813300006396AqueousGAPEPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY*
Ga0075484_101961613300006602AqueousNVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLTQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY*
Ga0105050_1043196313300007516FreshwaterGYKSRTQMLAQKKMQRPNVWTSIGAEEPKAAAAKLMKQNDNFGYKARPQMLAQKKMQRPNVWKSIGAEEPKAAAAKLMKQNDNFGYKSRTQMLEVRVVFCGVTV*
Ga0105054_1002068883300007520FreshwaterVSNRPVLKQTSVNVWQQIGAQEPSAAAASLMKQNDNFGYKSRTQMLSQGAPTVNVWQQIGAEEPHAAAAGLMKQNDNFGYKARPQMLAQKKMQRPNVWKSIGAEEPKAAAAKLMKQNDNFGYKSRTQMLEVRVAVCGVTV*
Ga0105052_1005820613300007523FreshwaterMLKQTQVNVWQQIGAQEPSAAAASLMKKNDNFGYKSRTQMLSQGAPTVNVWKQIGAEEPHAAAAGLMKQNDNFGYKSRTQMLAQKKMQRPNVWKSIGAEEPKAAAAKLMKQNDNFGYKARPQMLAQKKMQRPNVWKSIGAEEPKAAAAKLMKQNDNFGYKSRTQMLEVRVVFCGVTV*
Ga0105051_1019365913300007722FreshwaterMLKQTQVNVWQQIGAQEPSAAAASLMKKNDNFGYKSRTQMLSQGAPTVNVWKQIGAEEPHAAAAGLMKQNDNFGYKSRTQMLAQKKMQRPNVWTSIGAEEPKAAAAKLMKQNDNFGYKARPQMLAQKKMQRPNVWKSIGAEEPKAAAAKLMKQNDN
Ga0115101_141890713300009592MarineQEKPQVNVWKQIGAPEPKVAATQLMKQNDNFGYKSRTQMLAQGKPQVNVWQQIGAQEPHAAASSLMKQNDNFGYKAPTQKLFMTRSKKNSKQARPNVWTSIGAPTPEQAARALFKQNDNYGYKARPQMLAQKQSPQVNVWQQIGAQEPQAAAASLMKQNDNFGYKARKTILAQEKPQVNVWKQIGAPEPKVAATQLMKQNDNFGYKSRTQML
Ga0115101_141968913300009592MarineQEKPQVNVWKQIGAPEPKVAATQLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVADPHSAANSLFKQNDNFGYKARTQILAQEKPQVNVWKQIGAPEPKVAATQLMKQNDNFGY*
Ga0115102_1083692513300009606MarineQQLMKQNDNFGYKAPTQMLEQTAKGFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAEKSQNVNVWKQIGAQEPKAAAQQLMKQNDNFGY*
Ga0115100_1020635313300009608MarineQVNVWQQIGAQEPKAAAQQLMKQNDNFGYKAPTQMLEQTAKGFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAEKSQNVNVWKQIGAQEPKAAAQQLMKQNDNFGY*
Ga0115100_1065932313300009608MarineYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY*
Ga0115100_1125345813300009608MarineQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY*
Ga0115104_1081202513300009677MarineLAQKAAGVNVWNQIGAPEPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY*
Ga0129322_110584513300010306AqueousQIGAQEPHSAAAQVMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY*
Ga0129323_104822013300010404AqueousAAQVMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY*
Ga0133913_1123441213300010885Freshwater LakeMTKNDNFGYKAPTQMLEEKQAFPSVWQQIGVEDPHAAANGLFKQNDNFGYKAPTQMLAEVKPTVNVWKQIGAQEPKLAAKDVMKKNDNFGY*
Ga0129347_119512313300012504AqueousVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY*
Ga0129326_132963213300012522AqueousQMLAQKSAGVNVWNQIGAPEPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAQQLMKQNDNFGYKAPTQMLEQKGNAFPSVWQQIGVQDPHNAANSLFKQNDNFGYKARPQMLAQKTRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY*
Ga0157608_106937413300012709FreshwaterRKQILAQTSPQVNVWQQIGAEQPQVAAQQLMKQNDNFGYKAPTQMLEQKSANTFPSVWTQIGVKDPHSAANALFKQNDNFGYKARPQMLAEKPQRVNVWQQIGATEPKVAAAKLMKQNDNFGY*
Ga0157613_100396513300012720FreshwaterMKQNDNFGYKAPTQMLEQKSANTFPSVWTQIGVKDPHSAANALFKQNDNFGYKARPQMLAEKPQRVNVWQQIGATEPKVAAAKLMKQNDNFGY*
Ga0157604_111942013300012723FreshwaterVNVWQQIGAEQPQVAAQQLMKQNDNFGYKAPTQMLEQKSANTFPSVWTQIGVKDPHSAANALFKQNDNFGYKARPQMLAEKPQRVNVWQQIGATEPKVAAAKLMKQNDNFGY*
Ga0129341_103982113300012966AqueousQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAQQLMKQNDNFGYKAPTQMLEQKGNAFPSVWQQIGVQDPHNAANSLFKQNDNFGYKARPQMLAQKTRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY*
Ga0129341_111812913300012966AqueousKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLTQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY*
Ga0129338_159244413300012970AqueousKVAAAKLMKQNDNFGYKARKTILAQQSPQVNVWQQIGAQEPKAAAQQLMKQNDNFGYKAPTQMLEETSKTFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAEKSQNVNVWKQIGAEEPKAAAQQLMKQNDNFGY*
Ga0170791_1378068813300013295FreshwaterQRAAPKTVWQQIGAESPEAAAQSLMTKNDNFGYKAPTQMLEEKQAFPSVWQQIGVEDPHAAANGLFKQNDNFGYKAPTQMLAEVKPTVNVWKQIGAQEPKLAAKDVMKKNDNFGY*
Ga0182085_132666713300016723Salt MarshRTQMLEEKAKFPSVWQQIGVADPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0182094_111064813300016731Salt MarshAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0182096_134528113300016740Salt MarshNVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAPAQLMKQNDNFGY
Ga0182096_134733213300016740Salt MarshQIGAQEPKAAAQQLMKQNDNFGYKAPTQMLEQTAKGFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAEKSQNVNVWKQIGAQEPKAAAQQLMKQNDNFGY
Ga0182091_107345413300016766Salt MarshMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQHIGAQEPKAAAAQLMKQNDNFGY
Ga0188850_101586013300018601Freshwater LakeKLMKQNDNFGYKSRTQMLTQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKTKFPSVWQQIGVSDPHSAANSLFKQNDNFGYKAPTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0188862_101783613300018622Freshwater LakeGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0193138_105237813300018742MarineDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0193380_104139013300018781MarineVWQQIGVKDPHAAANALFSQNDNFGYKARPQMLAQMQKPVSVWQQIGAPEPKVAAQQLMKQNDNFGYRARPQMLEQKSSSYPSVWQQIGVKDPHAAANALFSQNDNFGYKARPQMLAQKAPSANVWQQIGAPEPKAAAQQLMKQNDNFGY
Ga0193048_105117313300018825MarineKMARPNVWKSIGAPTPEDAAKALFKQNDNYGYKARPQMLAQKAAGVNVWNQIGAPEPKVAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0193048_105905613300018825MarineVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAPEPKAAAAQLMKQNDNFGY
Ga0192870_107952813300018836MarineATQLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVADPHSAANSLFKQNDNFGYKARTQILAQEKPQVNVWKQIGAPEPKVAATQLMKQNDNFGY
Ga0192869_1020318213300019032MarineMGLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVADPHSAANSLFKQNDNFGYKARTQILAQEKPQVNVWKQIGAPEPKVAATQLMKQNDNFGY
Ga0192869_1028110613300019032MarineMGLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0192869_1050793013300019032MarineHGAPKANVWQQIGAPEPKVAAAQLMKQNDNFGYKAPTQMLEQQAKSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0193336_1051648513300019045MarineGYKARPQMLAEKKTRTNVWKQIGAPEPKVAAKQLMKQNDNFGYKARKTILAQTAPKANVWQQIGAPEPKLAAKQLMKQNDNFGYKAPTQMLEQKGNAFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQTSPGVNVWKQIGAPEPKVAAQQLMTQNDNFGY
Ga0188854_100850913300019083Freshwater LakePKAAAQQLMKQNDNFGYKAPTQMLEQTTKGFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAEKSQNVNVWKQIGAQEPKAAAQQLMKQNDNFGY
Ga0188866_102467213300019095Freshwater LakeKPQVNVWKQIGAPEPKVAATQLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0188870_1006373313300019149Freshwater LakeQNDNFGYKSRTQMLAQGQPQVNVWQQIGAQEPHAAAASLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVADPHSAANSLFKQNDNFGYKARTQILAQEKPQVNVWKQIGAPEPKVAATQLMKQNDNFGY
Ga0210306_106885013300021312EstuarineVNVWQQIGAEQPQVAAQQLMKQNDNFGYKARPQMLEQKSANTFPSVWTQIGVEDPHSAANGLFKQNDNFGYKARPQMLAEKPQRVNVWNQIGAPEPKVAAAKLMKQNDNFGY
Ga0206692_167480013300021350SeawaterQLMKQNDNFGYKAPTQMLEQKGNAFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAEKSQNVNVWKQIGAQEPKAAAQQLMKQNDNFGY
Ga0210305_105471213300021847EstuarineQVNVWQQIGAEQPQVAAQQLMKQNDNFGYKARPQMLEQKSANTFPSVWTQIGVEDPHSAANGLFKQNDNFGYKARPQMLAEKPQRVNVWNQIGAPEPKVAAAKLMKQNDNFGY
Ga0063146_11690413300021875MarineQIGAPEPGAAAQQLMKQNDNFGYKSRTQMLAQGSPQVNVWQQIGAPEPKVAAAQLMKQNDNFGYKAPTQKLFMVRNKKNAKMARPNVWKSIGAPTPEDAAKALFKNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVW
Ga0063105_103718613300021887MarineGYKAPTQMLEEKKSFPSVWQQIGVSDPHSAANSLFSQNDNFGYKARPQMLAEKPQRVNVWKQIGAQEPKKAAAKLMKQNDNFGY
Ga0063089_105343513300021889MarineSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063090_104666613300021890MarineKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063873_101493313300021897MarineARPQMLAQKAAGVNVWNQIGAPEPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0063873_103386513300021897MarinePRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063873_105227713300021897MarineNDNFGYKARKQILAQTAPKVNVWQQIGAAEPKAAAQQLMTQNDNFGYKAPTQMLEEKKSFPSVWQQIGVSDPHSAANSLFSQNDNFGYKARPQMLAEKPQRVNVWKQIGAQEPKKAAAKLMKQNDNFGY
Ga0063144_103197013300021899MarineEKAPSTVWQQIGAADPKTAAQQLMTQNDNFGYKAPTQMLEQEDAKQFPSVWQQIGVKDPHAAANSLFQQNDNFGYKARPQMLAQKSPTSTVWQQIGAENPQAAAQQLMKQNDNFGY
Ga0063086_104611013300021902MarineDNFGYKAPTQMLEQEDAKQFPSVWQQIGVKDPHAAANSLFQQNDNFGYKARPQMLAQKSPTSTVWQQIGAENPQAAAQQLMKQNDNFGY
Ga0063088_104514713300021905MarinePEPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0063100_106595413300021910MarineWQQIGAAEPKAAAQQLMTQNDNFGYKAPTQMLEEKKSFPSVWQQIGVSDPHSAANSLFSQNDNFGYKARPQMLAEKPQRVNVWKQIGAQEPKKAAAKLMKQNDNFGY
Ga0063104_104940113300021913MarineRKQILAQTAPKVNVWQQIGAAEPKAAAQQLMTQNDNFGYKAPTQMLEEKKSFPSVWQQIGVSDPHSAANSLFSQNDNFGYKARPQMLAEKPQRVNVWKQIGAQEPKKAAAKLMKQNDNFG
Ga0063870_100958413300021921MarineANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063869_100733913300021922MarineKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063869_100844713300021922MarineNDNFGYKSRTQMLAQGSPQVNVWQQIGAPEPKVAAAQLMKQNDNFGYKAPTQKLFMVRNKKNAKMARPNVWKSIGAPTPEDAAKALFKQNDNYGYKARPQMLAQKAAGVNVWNQIGAPEPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYK
Ga0063091_101327413300021923MarineIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063085_104395213300021924MarineQMLAQKAAGVNVWKQIGAPEPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0063085_104975013300021924MarineMLAQGQPQVNVWQQIGAQEPHAAAASLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063096_106977113300021925MarineKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063871_100948313300021926MarineYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063145_103571313300021930MarineKAPSTVWQQIGAADPKTAAQQLMTQNDNFGYKAPTQMLEQEDAKQFPSVWQQIGVKDPHAAANSLFQQNDNFGYKARPQMLAQKSPTSTVWQQIGAENPQAAAQQLMKQNDNFGY
Ga0063145_108362913300021930MarineRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063872_102807813300021932MarineQIGAAEPKAAAQQLMTQNDNFGYKAPTQMLEEKKSFPSVWQQIGVSDPHSAANSLFSQNDNFGYKARPQMLAEKPQRVNVWKQIGAQEPKKAAAKLMKQNDNFGY
Ga0063754_102150813300021937MarineQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063095_114504613300021939MarineKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063108_107209613300021940MarinePKVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0063102_110865113300021941MarineAAAQQLMTQNDNFGYKAPTQMLEEKKSFPSVWQQIGVSDPHSAANSLFSQNDNFGYKARPQMLAEKPQRVNVWKQIGAQEPKKAAAKLMKQNDNFGY
Ga0063094_112327713300021943MarineQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0255246_114450513300024863FreshwaterQQIGAEQPQVAAQQLMKQNDNFGYKAPTQMLEQKSANTFPSVWTQIGVKAPHSAANALFKQNDNFGYKARPQMLAEKPQRVNVWNQIGAPEPKVAAAKLMKQNDNFGY
Ga0247591_107674013300026434SeawaterQNDNFGYRARPQMLEQKSSSYPSVWQQIGVKDPHAAANALFSQNDNFGYKARPQMLVQKAPSANVWQQIGAPEPKAAAQQLMKQNDNFGY
Ga0247594_103570213300026448SeawaterILAQEKPQVNVWKQIGAPEPKVAATQLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVADPHSAANSLFKQNDNFGYKARTQILAQEKPQVNVWKQIGAPEPKVAATQLMKQNDNFGY
Ga0247571_111798313300026495SeawaterVNVWKQIGAPEPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0209491_1016133713300027832FreshwaterVSNRPVLKQTSVNVWQQIGAQEPSAAAASLMKQNDNFGYKSRTQMLSQGAPTVNVWQQIGAEEPHAAAAGLMKQNDNFGYKARPQMLAQKKMQRPNVWKSIGAEEPKAAAAKLMKQNDNFGYKARPQMLAQ
Ga0209284_1031697513300027983FreshwaterKQIGAEEPHAAAAGLMKQNDNFGYKSRTQMLAQKKMQRPNVWTSIGAEEPKAAAAKLMKQNDNFGYKARPQMLAQKKMQRPNVWKSIGAEEPKAAAAKLMKQNDNFGYKSRTQMLEVRVVFCGVTV
Ga0247572_114851013300028290SeawaterKSRTQMLEEKAKFPSVWQQIGVADPHSAANSLFKQNDNFGYKARTQILAQEKPQVNVWKQIGAPEPKVAATQLMKQNDNFGY
Ga0307402_1043288313300030653MarineYKALPLLLAHNMQRPNVGKQIGDPEPNVAAAKLMKQNDNFGYKARPQMLEEKAGFPSVWTQIGVQDPHAAANGLFKQNDNFGYKARPQMLAQKMQRPNVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQGAPTVNVWQQIGAQEPHAAAAGLMKQNDNFGY
Ga0307403_1055736813300030671MarineQMLAQKGGPTVNVWQQIGAEEPHAAAAGLMKQNDNFGYKARPQMLAQKMQRPNVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQGAPTVNVWQQIGAQEPHAAAAGLMKQNDNFGY
Ga0307404_1025706413300031752MarineAAAKLMKQNDNFGYKARPQMLEEKAGFPSVWTQIGVQDPHAAANGLFKQNDNFGYKARPQMLAQKMQRPNVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQGAPTVNVWQQIGAQEPHAAAAGLMKQNDNFGY
Ga0314684_1052493713300032463SeawaterYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0314679_1029419013300032492SeawaterPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0314676_1008881123300032519SeawaterGYKARPQMLAQKAAGVNVWKQIGAPEPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0314676_1075041213300032519SeawaterGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0314667_1009688133300032520SeawaterWNQIGAPEPKVAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0314680_1046125613300032521SeawaterMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0314682_1060857413300032540SeawaterNVGYQSRTQMLAQKKAPRANVWKQIGAPEPKVAAALEMKQNDNFGYKSRTQMLAQKKAPRAYVWKQIGAHEPKGAAAKLMKQNVNCGYKSRTPMLEEKAKFPSGWQQIGVQDPHSAANSLFKQNDNFGYKSRSQMLAQQATQVNVWQQIGAQEPKAAAAQLMKQNDNKGYKAEREMVADTSYNRLK
Ga0314671_1012402323300032616SeawaterDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0314683_1092315113300032617SeawaterQLMKQNDNFGYKARKQILAQNSPKVNVWQQIGANEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0314673_1044452713300032650SeawaterLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0314669_1052057413300032708SeawaterFKQNDNYGYKARPQMLAQKAAGVNVWNQIGAPEPKVAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0314698_1025064913300032726SeawaterSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0314696_1055468013300032728SeawaterAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0314699_1052281213300032730SeawaterNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0314706_1039227313300032734SeawaterQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0314710_1004733233300032742SeawaterLAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0314705_1047724913300032744SeawaterYGYKARPQMLAQKAAGVNVWNQIGAPEPKVAAAQLMKQNDNFGYKARKQILAQTSPKVNVWQQIGATEPKLAAAQLMKQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0314704_1050627513300032745SeawaterKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY
Ga0314713_1006802913300032748SeawaterNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0314700_1038074913300032752SeawaterQNDNFGYKAPTQMLEQKGNSFPSVWQQIGVQDPHSAANSLFKQNDNFGYKARPQMLAQKSRNVNVWKQIGAPEPKVAAAKLMKQNDNFGY
Ga0314709_1056797513300032755SeawaterQNDNFGYKSRTQMLAQKKAPRANVWKQIGAPEPKVAAAKLMKQNDNFGYKSRTQMLEEKAKFPSVWQQIGVQDPHSAANSLFKQNDNFGYKSRTQMLAQQAPQVNVWQQIGAQEPKAAAAQLMKQNDNFGY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.