Basic Information | |
---|---|
Family ID | F074953 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 45 residues |
Representative Sequence | LKFVITRLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 5.88 % |
% of genes near scaffold ends (potentially truncated) | 86.55 % |
% of genes from short scaffolds (< 2000 bps) | 91.60 % |
Associated GOLD sequencing projects | 97 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.235 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.765 % of family members) |
Environment Ontology (ENVO) | Unclassified (36.134 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.017 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.17% β-sheet: 38.89% Coil/Unstructured: 56.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF07586 | HXXSHH | 31.09 |
PF00903 | Glyoxalase | 4.20 |
PF12681 | Glyoxalase_2 | 3.36 |
PF01872 | RibD_C | 3.36 |
PF04255 | DUF433 | 2.52 |
PF07631 | PSD4 | 1.68 |
PF06197 | DUF998 | 1.68 |
PF05711 | TylF | 1.68 |
PF13376 | OmdA | 0.84 |
PF00583 | Acetyltransf_1 | 0.84 |
PF13439 | Glyco_transf_4 | 0.84 |
PF13459 | Fer4_15 | 0.84 |
PF06983 | 3-dmu-9_3-mt | 0.84 |
PF00535 | Glycos_transf_2 | 0.84 |
PF08922 | DUF1905 | 0.84 |
PF07624 | PSD2 | 0.84 |
PF01258 | zf-dskA_traR | 0.84 |
PF01128 | IspD | 0.84 |
PF13673 | Acetyltransf_10 | 0.84 |
PF02452 | PemK_toxin | 0.84 |
PF01022 | HTH_5 | 0.84 |
PF08352 | oligo_HPY | 0.84 |
PF12850 | Metallophos_2 | 0.84 |
PF13442 | Cytochrome_CBB3 | 0.84 |
PF08274 | YjdM_Zn_Ribbon | 0.84 |
PF01676 | Metalloenzyme | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 3.36 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 3.36 |
COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 2.52 |
COG3371 | Uncharacterized membrane protein | Function unknown [S] | 1.68 |
COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.84 |
COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.84 |
COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 0.84 |
COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.84 |
COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 0.84 |
COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.84 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.84 |
COG2824 | Uncharacterized Zn-ribbon-containing protein | General function prediction only [R] | 0.84 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.24 % |
Unclassified | root | N/A | 11.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001213|JGIcombinedJ13530_105784729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 502 | Open in IMG/M |
3300004080|Ga0062385_10875460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 594 | Open in IMG/M |
3300005327|Ga0070658_10976322 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
3300005327|Ga0070658_11284822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300005328|Ga0070676_10145452 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
3300005356|Ga0070674_102041580 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300005439|Ga0070711_100881477 | Not Available | 763 | Open in IMG/M |
3300005532|Ga0070739_10510165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 541 | Open in IMG/M |
3300005534|Ga0070735_10245224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1087 | Open in IMG/M |
3300005535|Ga0070684_101178449 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300005545|Ga0070695_101072596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 658 | Open in IMG/M |
3300005563|Ga0068855_100190084 | All Organisms → cellular organisms → Bacteria | 2316 | Open in IMG/M |
3300005577|Ga0068857_100001676 | All Organisms → cellular organisms → Bacteria | 17806 | Open in IMG/M |
3300005617|Ga0068859_100535141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S156 | 1266 | Open in IMG/M |
3300005617|Ga0068859_102233865 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300005718|Ga0068866_10148479 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
3300005843|Ga0068860_102139832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium → unclassified Novosphingobium → Novosphingobium sp. Gsoil 351 | 581 | Open in IMG/M |
3300006059|Ga0075017_100624417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 825 | Open in IMG/M |
3300006354|Ga0075021_10621470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 691 | Open in IMG/M |
3300006354|Ga0075021_10867428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 585 | Open in IMG/M |
3300006638|Ga0075522_10000089 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 54214 | Open in IMG/M |
3300006638|Ga0075522_10057052 | All Organisms → cellular organisms → Bacteria | 2235 | Open in IMG/M |
3300006954|Ga0079219_10249082 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300009098|Ga0105245_11153683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 822 | Open in IMG/M |
3300009101|Ga0105247_10894717 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300009143|Ga0099792_11010603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 556 | Open in IMG/M |
3300009523|Ga0116221_1164452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 965 | Open in IMG/M |
3300009551|Ga0105238_10922768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 892 | Open in IMG/M |
3300009551|Ga0105238_11390898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 729 | Open in IMG/M |
3300009672|Ga0116215_1228473 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
3300009824|Ga0116219_10299524 | Not Available | 906 | Open in IMG/M |
3300010048|Ga0126373_11485266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 743 | Open in IMG/M |
3300010361|Ga0126378_13316931 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300010373|Ga0134128_11300179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 802 | Open in IMG/M |
3300010376|Ga0126381_101367201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1024 | Open in IMG/M |
3300010399|Ga0134127_10652378 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
3300010400|Ga0134122_10052803 | All Organisms → cellular organisms → Bacteria | 3123 | Open in IMG/M |
3300011120|Ga0150983_11003846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 574 | Open in IMG/M |
3300011120|Ga0150983_11022678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 560 | Open in IMG/M |
3300011120|Ga0150983_12812230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
3300011120|Ga0150983_15759121 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300011120|Ga0150983_16612244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 917 | Open in IMG/M |
3300012210|Ga0137378_11059556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 725 | Open in IMG/M |
3300012212|Ga0150985_110090156 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
3300012357|Ga0137384_10899775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
3300012971|Ga0126369_12142415 | Not Available | 647 | Open in IMG/M |
3300013105|Ga0157369_10285062 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
3300013307|Ga0157372_10843809 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
3300014968|Ga0157379_11469394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 662 | Open in IMG/M |
3300016728|Ga0181500_1424137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 555 | Open in IMG/M |
3300016750|Ga0181505_10264969 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 655 | Open in IMG/M |
3300017948|Ga0187847_10848872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 518 | Open in IMG/M |
3300017955|Ga0187817_10754150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
3300017959|Ga0187779_10133955 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
3300017961|Ga0187778_10439968 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300018026|Ga0187857_10192099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 955 | Open in IMG/M |
3300018085|Ga0187772_10507795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 850 | Open in IMG/M |
3300019182|Ga0184598_117181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 503 | Open in IMG/M |
3300019256|Ga0181508_1585339 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300019260|Ga0181506_1409747 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 776 | Open in IMG/M |
3300020069|Ga0197907_11123569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 519 | Open in IMG/M |
3300020579|Ga0210407_11312785 | Not Available | 540 | Open in IMG/M |
3300020581|Ga0210399_11240754 | Not Available | 590 | Open in IMG/M |
3300021181|Ga0210388_10805472 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300021433|Ga0210391_10076338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2648 | Open in IMG/M |
3300021433|Ga0210391_10579679 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
3300022512|Ga0242676_1027996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 621 | Open in IMG/M |
3300022525|Ga0242656_1078670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 616 | Open in IMG/M |
3300022714|Ga0242671_1040937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 738 | Open in IMG/M |
3300022714|Ga0242671_1046943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 706 | Open in IMG/M |
3300022724|Ga0242665_10387116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 508 | Open in IMG/M |
3300022873|Ga0224550_1023258 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
3300025862|Ga0209483_1000042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 138431 | Open in IMG/M |
3300025909|Ga0207705_11225110 | Not Available | 575 | Open in IMG/M |
3300025911|Ga0207654_10453113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 900 | Open in IMG/M |
3300025912|Ga0207707_10574961 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
3300025914|Ga0207671_10845514 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300025916|Ga0207663_11053983 | Not Available | 653 | Open in IMG/M |
3300025920|Ga0207649_10989946 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300025924|Ga0207694_10303211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 1315 | Open in IMG/M |
3300025924|Ga0207694_10816167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 788 | Open in IMG/M |
3300025927|Ga0207687_10857254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 776 | Open in IMG/M |
3300025929|Ga0207664_10107098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2319 | Open in IMG/M |
3300025945|Ga0207679_10500392 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
3300025961|Ga0207712_10675666 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300026088|Ga0207641_10847222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 906 | Open in IMG/M |
3300026088|Ga0207641_11189932 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300026095|Ga0207676_10936882 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300027727|Ga0209328_10018010 | All Organisms → cellular organisms → Bacteria | 2150 | Open in IMG/M |
3300027773|Ga0209810_1349322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 541 | Open in IMG/M |
3300027854|Ga0209517_10666812 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
3300027911|Ga0209698_11067811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 600 | Open in IMG/M |
3300027986|Ga0209168_10173076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1088 | Open in IMG/M |
3300028379|Ga0268266_10949908 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300028381|Ga0268264_11920627 | Not Available | 601 | Open in IMG/M |
3300028536|Ga0137415_11177925 | Not Available | 581 | Open in IMG/M |
3300028780|Ga0302225_10454962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 599 | Open in IMG/M |
3300028874|Ga0302155_10358897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 624 | Open in IMG/M |
3300029910|Ga0311369_11186342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 591 | Open in IMG/M |
3300030874|Ga0265742_1018068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 584 | Open in IMG/M |
3300030877|Ga0265777_106254 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300031028|Ga0302180_10215216 | Not Available | 1026 | Open in IMG/M |
3300031546|Ga0318538_10213182 | Not Available | 1033 | Open in IMG/M |
3300031680|Ga0318574_10352759 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300031708|Ga0310686_116001433 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Daviesbacteria | 1329 | Open in IMG/M |
3300031726|Ga0302321_103035462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 548 | Open in IMG/M |
3300031744|Ga0306918_10530709 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
3300031823|Ga0307478_11343927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 594 | Open in IMG/M |
3300031879|Ga0306919_11206809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
3300031890|Ga0306925_12257165 | Not Available | 504 | Open in IMG/M |
3300032042|Ga0318545_10133691 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300032072|Ga0326631_100162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 2275 | Open in IMG/M |
3300032261|Ga0306920_102658579 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
3300032421|Ga0310812_10180003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 911 | Open in IMG/M |
3300032782|Ga0335082_11141840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 646 | Open in IMG/M |
3300032783|Ga0335079_11506756 | Not Available | 664 | Open in IMG/M |
3300032783|Ga0335079_11842541 | Not Available | 587 | Open in IMG/M |
3300033134|Ga0335073_10801189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1011 | Open in IMG/M |
3300033289|Ga0310914_11573286 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.04% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.20% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.36% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.36% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.36% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.36% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.36% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.52% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.52% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.52% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.52% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.52% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.68% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.84% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.84% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.84% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.84% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.84% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.84% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.84% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.84% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300016728 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022525 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022714 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030874 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
3300032072 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ13530_1057847291 | 3300001213 | Wetland | RTMQLKFVISRLDSLVGSRIAVNGLLMGTDGVDGINVTGVSRVAQKCP* |
Ga0062385_108754602 | 3300004080 | Bog Forest Soil | PLKFVVTRLDPLTGSRVVVSGILIGADGVDGINVTTVTRVAEKCP* |
Ga0070658_109763221 | 3300005327 | Corn Rhizosphere | IPLKFVVTKLDALTGSRVVASGLLIEAGGVDGLNVTAVNRVADKCP* |
Ga0070658_112848221 | 3300005327 | Corn Rhizosphere | VTKLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP* |
Ga0070676_101454523 | 3300005328 | Miscanthus Rhizosphere | TVPLKFVITRLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP* |
Ga0070674_1020415802 | 3300005356 | Miscanthus Rhizosphere | ARPLGSRAIVLKFVITRLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP* |
Ga0070711_1008814771 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTKLDALAGSLVAVSGLLIGEGGVDGINVTTVTRVAQKWSLTA* |
Ga0070739_105101651 | 3300005532 | Surface Soil | FVVTKLDELAGSRVAVIGLLIGTGGVDGINVTTVSRVAEKCP* |
Ga0070735_102452242 | 3300005534 | Surface Soil | TMPLKFVVTRLDALAGSRVAVSGLLMGAGGVDGINVTAVTRVAPKCP* |
Ga0070684_1011784493 | 3300005535 | Corn Rhizosphere | ATRPLGKRTMALKFVITKLDAMVGSRVAVSGLLIGEGGADGINVTTVNRVAPKCP* |
Ga0070695_1010725962 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | PLGSRTMALKFVVTKLDALVGSRVAVSGLLIGEGGVDGINVTIVNRVAPKCP* |
Ga0068855_1001900843 | 3300005563 | Corn Rhizosphere | VTKLDALARSRVAVSGLLIGEGGINVTTVTRVAPKCP* |
Ga0068857_10000167619 | 3300005577 | Corn Rhizosphere | VTKLDALAGSRVAVSGLLIGEGGINVTTVTRVAPTCP* |
Ga0068859_1005351411 | 3300005617 | Switchgrass Rhizosphere | ATRALGSRRMVLKFVVTKLDAFAGSRVAVSGLLIGEGGADGLNVTAVNRVAQKCP* |
Ga0068859_1022338652 | 3300005617 | Switchgrass Rhizosphere | RPLGSRTVPLKFVITRLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP* |
Ga0068866_101484791 | 3300005718 | Miscanthus Rhizosphere | RAIVLKFVITRLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP* |
Ga0068860_1021398321 | 3300005843 | Switchgrass Rhizosphere | RTIALKFVITRLDALTGSRVAVSGLLIGEGGVEGINVTTVTRVAPKCP* |
Ga0075017_1006244173 | 3300006059 | Watersheds | RKMALKFVVTRLDALAGSRVSVTGLLMGAGGVDGLNVTTVSRVAPKCP* |
Ga0075021_106214701 | 3300006354 | Watersheds | LDPLAGSRIAVSGLLIGANGADGINVTTVNRVAPKCP* |
Ga0075021_108674281 | 3300006354 | Watersheds | LIGTRVAVSGLLMGTDGTDGINVTAVSRVAPKCP* |
Ga0075522_1000008933 | 3300006638 | Arctic Peat Soil | MALKFVVTKLDGLAGSRVAVSGLLIGEGGVDGINVTTVNRVGQKCP* |
Ga0075522_100570523 | 3300006638 | Arctic Peat Soil | LDPLAGSRVAVSGLLIGADGADGINVTTVNRVAPKCP* |
Ga0079219_102490821 | 3300006954 | Agricultural Soil | LKFVVTKLDPLIGSRVAVTGLLMGNGGIDGINVTTVSRISPKCP* |
Ga0105245_111536831 | 3300009098 | Miscanthus Rhizosphere | PLGSRTIALKFVITRLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAAKCP* |
Ga0105247_108947173 | 3300009101 | Switchgrass Rhizosphere | LKFVITRLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP* |
Ga0099792_110106031 | 3300009143 | Vadose Zone Soil | RPLGSRTIPLKFVITRLDAWAGSRVAVSGLLMGEGGVDGINVTAVNRVAPKCP* |
Ga0116221_11644521 | 3300009523 | Peatlands Soil | FVVTHLDPLAGSRVAVNGLLIGDGGADGINVTTVSRVAEKCP* |
Ga0105238_109227681 | 3300009551 | Corn Rhizosphere | RPLGSRTMPLKFLLTSLDSLAGSRVAVSGLLIGADGADGINVTTVNRVAAKCP* |
Ga0105238_113908983 | 3300009551 | Corn Rhizosphere | LKFVVTKLDALAGSRVAVSGLLIGEGGVDGINVTTVTRVAPKCP* |
Ga0116215_12284733 | 3300009672 | Peatlands Soil | RLDPLAGSRVAVNGLLICADGVDGINVTTVNRVAQQCP* |
Ga0116219_102995243 | 3300009824 | Peatlands Soil | TRSLGSRKIALKFVVTKLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAQKCP* |
Ga0126373_114852661 | 3300010048 | Tropical Forest Soil | LKFVVTRLDPMAGSRVAVSGLLIGPGGADGINVTTVNRVGQKCP* |
Ga0126378_133169312 | 3300010361 | Tropical Forest Soil | VLTRLDPLADSRVSVSGLLIGAGGADGINVMTVNRVAEKCP* |
Ga0134128_113001792 | 3300010373 | Terrestrial Soil | MALKFVVTKLDALVGSRVAVSGLLIGEGGVDGINVTIVNRVAPKCP* |
Ga0126381_1013672011 | 3300010376 | Tropical Forest Soil | VLTRLDPLAGSRVSVSGLLIGAGGADGINVMTVNRVAEKCP* |
Ga0134127_106523783 | 3300010399 | Terrestrial Soil | LGSRTMALKFVVTKLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAQKCP* |
Ga0134122_100528031 | 3300010400 | Terrestrial Soil | SRTMALKFAVTKLDALAGSRVAVSGLLIGEGGVDGINVTTVDRVAPRCP* |
Ga0150983_110038462 | 3300011120 | Forest Soil | RLDALAGSRVAVNGLLIGAGGVDGINVTAVTRVADRCP* |
Ga0150983_110226781 | 3300011120 | Forest Soil | LDPLAGSRVVVNGLLIGDGGADGINVTTVSRVAEKCP* |
Ga0150983_128122302 | 3300011120 | Forest Soil | LLTKLDAFIGSRVAVSGLLIGAGGADGINVMAVNRVAPLCP* |
Ga0150983_157591211 | 3300011120 | Forest Soil | LKFVVTKLDAFAGSRVAVTGLLIGADGMDGINVTEVSRVAPKCP* |
Ga0150983_166122441 | 3300011120 | Forest Soil | DATRPLGSRTIPLKFVVTRLDPLAGSRVAVSGLLIGAGGADGINVTTVNRLAPKCP* |
Ga0137378_110595562 | 3300012210 | Vadose Zone Soil | LTRLDALAGSRVAVSGLLIGDGGVDGINVTAVNRVAQKCP* |
Ga0150985_1100901562 | 3300012212 | Avena Fatua Rhizosphere | VLTRLDQHVGKRMSVNGLLMGVGGKDGINVTNVSRVAESCP* |
Ga0137384_108997752 | 3300012357 | Vadose Zone Soil | MALKFVVTRLDALVGSRVAVSGLLIGDGGVDGINVTAVNRVAPKCP* |
Ga0126369_121424152 | 3300012971 | Tropical Forest Soil | FVVTRLDTLAGSRVVVNGLLIGAGGADGINVTTVNRAAPKCP* |
Ga0157369_102850625 | 3300013105 | Corn Rhizosphere | MVLKYVVTKLDALAGSRVAVNGLLIGEGGVDGINVTTVNRVAPKCP* |
Ga0157372_108438092 | 3300013307 | Corn Rhizosphere | ATRPLGSRTMPLKFLLTSLDSLAGSRVAVSGLLIGADGADGINVTTVNRVAAKCP* |
Ga0157379_114693942 | 3300014968 | Switchgrass Rhizosphere | VLTRLDALLGSRVAVNGILIGAGGVDGINVTTVNRVAPKCP* |
Ga0181500_14241372 | 3300016728 | Peatland | PLKFVVTRLDPLAGSRVTVSGLLIGANGADGINVTTVNRVAEKCP |
Ga0181505_102649691 | 3300016750 | Peatland | LDALAGSRVAVSGLLIGDDGADGINVTAVNRVAQKCP |
Ga0187847_108488721 | 3300017948 | Peatland | KFVVTRLDALAGSRVTVSGLLIGADGTEGINVTTVNRVAQKCP |
Ga0187817_107541501 | 3300017955 | Freshwater Sediment | DATRPLGSRTMPLKFVVTRLDSLAGSRVAVSGLLIGADGADGINVTEVNRVAPKCP |
Ga0187779_101339552 | 3300017959 | Tropical Peatland | VTRLDPLAGSRVAVNGLLIGAGGVDGINVTTVNRVAPKCP |
Ga0187778_104399682 | 3300017961 | Tropical Peatland | ALKFVVTHLDPLVGSRVLVTGLLIGDGGEDGINVTTVNRVAPKCP |
Ga0187857_101920991 | 3300018026 | Peatland | LGSRTIALKFVVTRLDALAGSRVAVSGLLIGADGADGINVTAVNRVAEKCP |
Ga0187772_105077952 | 3300018085 | Tropical Peatland | KFVITHLDSLSGSRVAVSGLLIGDGGKDGINVTTVSRVAAKCP |
Ga0184598_1171812 | 3300019182 | Soil | DSLAGSRVAVSGLLMGTGGADGINVTTVTRVAPKCP |
Ga0181508_15853392 | 3300019256 | Peatland | RLDPLAGSRVAVSGLLIGANGVDGINVTAVTRVAEKCP |
Ga0181506_14097472 | 3300019260 | Peatland | LGNRTIPLKFVVTRLDPLSGSRVAVNGLLIGDGGADGINVTAVKRVAEKCP |
Ga0197907_111235691 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | LKFVVTKLDALTGSRVVASGLLIGAGGVDGLNVTAVNGVADKCP |
Ga0210407_113127852 | 3300020579 | Soil | ALAGSRVAVSGLLIGEGGVDGINVTAVNRVAQKCP |
Ga0210399_112407541 | 3300020581 | Soil | RPLASRKIVLKFVVTKLDALVGSRVSVSGLLIGEGGVDGINVTAVSRVAQKCP |
Ga0210388_108054721 | 3300021181 | Soil | VTRLNALAGSRVAVSGLLMGADGVDGINVTAVNRVAEKCP |
Ga0210391_100763381 | 3300021433 | Soil | LDQLYGSRVAVTGLLIGAGGVDGINVTTVTRVAPKCP |
Ga0210391_105796793 | 3300021433 | Soil | IPLKFVVTRLDPLAGSRVAVSGLLIGADGVEGINVTNVARIADKCP |
Ga0242676_10279961 | 3300022512 | Soil | TMPLKFVVTHLDPLSGSRVVVTGLLIGAGGADGINVTTVNRVAGKCP |
Ga0242656_10786701 | 3300022525 | Soil | LGNRKIQLKFVVTRLDALAGSRVAVSGLLIGAGGVDGINVTAVNRVAQKCP |
Ga0242671_10409372 | 3300022714 | Soil | GADATRPLGNRTIPLKFVVTRLDPLSGSRVAVSGLLIGDGGADGINVTAVKRVAEKCP |
Ga0242671_10469431 | 3300022714 | Soil | RAIPLKFVVTRLDPLAGSRVAVSGLLIGAGGADGINVTTVNRVAPKCP |
Ga0242665_103871161 | 3300022724 | Soil | LKFVVTRLDTLVGSRVAVSGLLIGEGGVDGINVTAVNRVAQKCP |
Ga0224550_10232581 | 3300022873 | Soil | TRPLGSRTMPLKFVVTHLDPLAGSRVVVSGLLIGAGGADGINVTTVNRVAQSCP |
Ga0209483_100004230 | 3300025862 | Arctic Peat Soil | MALKFVVTKLDGLAGSRVAVSGLLIGEGGVDGINVTTVNRVGQKCP |
Ga0207705_112251102 | 3300025909 | Corn Rhizosphere | VTKLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP |
Ga0207654_104531133 | 3300025911 | Corn Rhizosphere | VVTKLDALAGSRVAVSGLLIGEGGVDGINVTTVTRVGPKCP |
Ga0207707_105749612 | 3300025912 | Corn Rhizosphere | VTKLDALAGSRVAVSGLLIGEGGINVTTVTRVAPTCP |
Ga0207671_108455141 | 3300025914 | Corn Rhizosphere | TIALKFVVTKLDGLAGSRVAVSGLLIGEGGINVTTVTRVAPKCP |
Ga0207663_110539831 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | TMALKFVVTKLDALAGSRVAVSGLLIGAGGADGINVTTVSRVAPKCP |
Ga0207649_109899463 | 3300025920 | Corn Rhizosphere | KYVVTKLDALAGSRVAVNGLLIGEGGVDGINVTTVNRVAPKCP |
Ga0207694_103032111 | 3300025924 | Corn Rhizosphere | LKFVVTKLDALAGSRVAVSGLLIGEGGVDGINVTTVTRVAPKCP |
Ga0207694_108161671 | 3300025924 | Corn Rhizosphere | DATRPLGSRTMPLKFLLTSLDSLAGSRVAVSGLLIGADGADGINVTTVNRVAAKCP |
Ga0207687_108572541 | 3300025927 | Miscanthus Rhizosphere | SAGNDATRPLGTRTVPLKFVITRLDALTGSRVAVSGLLIGEGGVDGINVTTVNRVAAKCP |
Ga0207664_101070981 | 3300025929 | Agricultural Soil | FVVTKLDGLAGSRVVVSGLLIGEGGVDGLNVTTVNRVAPKCP |
Ga0207679_105003922 | 3300025945 | Corn Rhizosphere | VTKLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPTCP |
Ga0207712_106756661 | 3300025961 | Switchgrass Rhizosphere | LGNRTIALKFVITRLDALTGSRVAVSGLLIGEGGVEGINVTTVTRVAPKCP |
Ga0207641_108472223 | 3300026088 | Switchgrass Rhizosphere | ATKPLGSRTMTLKFVVTRLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP |
Ga0207641_111899321 | 3300026088 | Switchgrass Rhizosphere | LKFVITRLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP |
Ga0207676_109368822 | 3300026095 | Switchgrass Rhizosphere | VLTRLDALLGSRVAVNGILIGAGGVDGINVTTVNRVAPKCP |
Ga0209328_100180101 | 3300027727 | Forest Soil | EDANRPLGSRTIALKFVVTKLDALAGSRVAVSGLLIGEGGVDGINVTAVNRVAQKCP |
Ga0209810_13493222 | 3300027773 | Surface Soil | FVVTKLDELAGSRVAVIGLLIGTGGVDGINVTTVSRVAEKCP |
Ga0209517_106668123 | 3300027854 | Peatlands Soil | MPLKFVVTKLDSLVGSRVAVSGLLIGAGGVDGINVTTVSRVAGKCP |
Ga0209698_110678112 | 3300027911 | Watersheds | MVLKFVVTKLDALAGSRVAVSGLLIGAGGADGINVTTVNRVAPKCP |
Ga0209168_101730761 | 3300027986 | Surface Soil | TMPLKFVVTRLDALAGSRVAVSGLLMGAGGVDGINVTAVTRVAPKCP |
Ga0268266_109499081 | 3300028379 | Switchgrass Rhizosphere | VITRLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP |
Ga0268264_119206271 | 3300028381 | Switchgrass Rhizosphere | VTRLDALAGSRVAVSGLLIGEGGVDGINVTTVNRVAPKCP |
Ga0137415_111779252 | 3300028536 | Vadose Zone Soil | MTLKFSITRLDRFAEQRVSVSGLLIGTDGILGINVSSVTRVAEKCQ |
Ga0302225_104549621 | 3300028780 | Palsa | VTRLDPLIGSRVAVSGILIGAGGADGINVTTVTRVAPKCP |
Ga0302155_103588972 | 3300028874 | Bog | RLDPWAGSRIEVNGLLMGTGGADGINVTLVSRVAPKCP |
Ga0311369_111863421 | 3300029910 | Palsa | PLAGSRVVVSGLLIGADGVDGINVTAVTRVAQSCP |
Ga0265742_10180681 | 3300030874 | Soil | ATRPLGSRTLPLKFVVTRLDSLAGSRVAVSGLLIGTGGADGINVTAVNRVAPKCP |
Ga0265777_1062542 | 3300030877 | Soil | SLAGSRVAVSGLLMGTGGADGINVTTVTRVAPKCP |
Ga0302180_102152162 | 3300031028 | Palsa | LDPLAGSRVAVSGLLIGANGVDGINVTTVTRVAEKCP |
Ga0318538_102131821 | 3300031546 | Soil | TKLDSLAGSRVAVSGLLIGAGGVDGINVTTVNRLADKCP |
Ga0318574_103527592 | 3300031680 | Soil | LDSLAGSRVAVSGLLIGAGGVDGINVTAVSRVAEKCP |
Ga0310686_1160014331 | 3300031708 | Soil | SRTMPLKFVVTKLDSLAGSRVAVNGLLIGAGGVDGINVTGVNRVAQKCP |
Ga0302321_1030354621 | 3300031726 | Fen | LKFVVTKLDALVGSRVSVTGLLIGTDGVDGLNVTAVNRVAPKCP |
Ga0306918_105307091 | 3300031744 | Soil | PLGSRTMALKFVVTKLDSLAGSRVAVSGLLIGAGGVDGINVTAVNRVAEKCP |
Ga0307478_113439272 | 3300031823 | Hardwood Forest Soil | VTHLDPLAGSRVVVNGLLIGANGVDGINVTTVNRVAAKCP |
Ga0306919_112068091 | 3300031879 | Soil | ALAGSRVAVNGLLIGAGGTDGINVMTVNKVARKCP |
Ga0306925_122571652 | 3300031890 | Soil | RPLGSRTVPLKFVVTRLDPMAGARVVVTGLLIGTDGTDGINVTAVSRVAEKCP |
Ga0318545_101336911 | 3300032042 | Soil | LDSLAGSRVAVSGLLIGAGGVDGINVTAVNRVAEKCP |
Ga0326631_1001623 | 3300032072 | Soil | PLKFVVTRLDSLAGSRVAVSGLLMGTGGADGINVTTVTRVAPKCP |
Ga0306920_1026585792 | 3300032261 | Soil | ITKLDAFAGSRVAVSGLLIGADGVDGINVTAVNRVAPKCP |
Ga0310812_101800032 | 3300032421 | Soil | LKFVVTKLDALVGSRVAVSGLLIGEGGMDGINVTIVNRVAPKCP |
Ga0335082_111418402 | 3300032782 | Soil | ELAGARVAVAGLLIGPDGADGINVTAVTRLAEKCP |
Ga0335079_115067563 | 3300032783 | Soil | KMALKFVVTRLDSMVGSRIAVTGLLIGADGVDGINVTTVSRVAPKCP |
Ga0335079_118425411 | 3300032783 | Soil | FVLTRLDSMAGGRVLVKGLLIGNNGADGINVTEVSRIAPRCP |
Ga0335073_108011891 | 3300033134 | Soil | DATRPLGNRTIPLRFVLTRLDPWAGSRVAVNGLLIGDGGVDGINVTTVQRVAEKCP |
Ga0310914_115732861 | 3300033289 | Soil | DALAGSRIAVSGLLIGAGGVDGINVTAVNRVAPKCP |
⦗Top⦘ |