Basic Information | |
---|---|
Family ID | F075255 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 40 residues |
Representative Sequence | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPRT |
Number of Associated Samples | 108 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 36.13 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.44 % |
Associated GOLD sequencing projects | 101 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.50 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (94.958 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.765 % of family members) |
Environment Ontology (ENVO) | Unclassified (21.849 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.059 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.67% β-sheet: 13.64% Coil/Unstructured: 69.70% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF13145 | Rotamase_2 | 67.23 |
PF01545 | Cation_efflux | 5.88 |
PF16916 | ZT_dimer | 3.36 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 5.88 |
COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 5.88 |
COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 5.88 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 94.96 % |
Unclassified | root | N/A | 5.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352024|deeps_contig81071.48574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1201 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10113647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1083 | Open in IMG/M |
3300004478|Ga0068972_1491260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
3300004479|Ga0062595_100490127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
3300004479|Ga0062595_100697721 | Not Available | 814 | Open in IMG/M |
3300005344|Ga0070661_101490557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 570 | Open in IMG/M |
3300005439|Ga0070711_100435199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
3300005557|Ga0066704_10524904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
3300005564|Ga0070664_101659867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300005602|Ga0070762_11048213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 560 | Open in IMG/M |
3300005610|Ga0070763_10296804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
3300005952|Ga0080026_10010168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2205 | Open in IMG/M |
3300005995|Ga0066790_10490482 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300006057|Ga0075026_100550544 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300006162|Ga0075030_100826151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
3300006173|Ga0070716_100160642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1455 | Open in IMG/M |
3300006755|Ga0079222_11682814 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300006854|Ga0075425_100429091 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1522 | Open in IMG/M |
3300006954|Ga0079219_12396762 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300009093|Ga0105240_11230787 | Not Available | 792 | Open in IMG/M |
3300009174|Ga0105241_10343209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1294 | Open in IMG/M |
3300009551|Ga0105238_11866343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 633 | Open in IMG/M |
3300009623|Ga0116133_1222368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300009665|Ga0116135_1223934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
3300009839|Ga0116223_10080471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2083 | Open in IMG/M |
3300010048|Ga0126373_10562753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1189 | Open in IMG/M |
3300010373|Ga0134128_10891413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
3300010376|Ga0126381_102872442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 686 | Open in IMG/M |
3300010379|Ga0136449_100478468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2172 | Open in IMG/M |
3300010379|Ga0136449_101487750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1038 | Open in IMG/M |
3300011120|Ga0150983_15564179 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
3300012210|Ga0137378_11535443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
3300012212|Ga0150985_109998770 | Not Available | 561 | Open in IMG/M |
3300012356|Ga0137371_11405932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300012361|Ga0137360_11727443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
3300012363|Ga0137390_11423690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
3300012917|Ga0137395_10505503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
3300012929|Ga0137404_10341180 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1309 | Open in IMG/M |
3300012944|Ga0137410_11178843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
3300012971|Ga0126369_10249684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1745 | Open in IMG/M |
3300013296|Ga0157374_11184069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
3300013307|Ga0157372_10093820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3416 | Open in IMG/M |
3300015371|Ga0132258_12431319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
3300017924|Ga0187820_1152331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
3300017938|Ga0187854_10485374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300017939|Ga0187775_10037710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1422 | Open in IMG/M |
3300017942|Ga0187808_10140755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
3300017943|Ga0187819_10688735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
3300017948|Ga0187847_10185203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1136 | Open in IMG/M |
3300018007|Ga0187805_10027681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2507 | Open in IMG/M |
3300018007|Ga0187805_10306442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
3300018013|Ga0187873_1185711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
3300018085|Ga0187772_10885834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
3300018088|Ga0187771_10288493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1374 | Open in IMG/M |
3300019275|Ga0187798_1160225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
3300019786|Ga0182025_1019080 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
3300019786|Ga0182025_1147798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1677 | Open in IMG/M |
3300020579|Ga0210407_10946153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
3300020580|Ga0210403_10228547 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1526 | Open in IMG/M |
3300020583|Ga0210401_10977614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
3300021180|Ga0210396_10305471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1408 | Open in IMG/M |
3300021403|Ga0210397_10332911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1122 | Open in IMG/M |
3300021405|Ga0210387_10237048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1593 | Open in IMG/M |
3300021405|Ga0210387_11437407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
3300021407|Ga0210383_10731644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
3300021432|Ga0210384_10522881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1068 | Open in IMG/M |
3300021478|Ga0210402_11561711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
3300021479|Ga0210410_10841653 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
3300021559|Ga0210409_10269844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1538 | Open in IMG/M |
3300021861|Ga0213853_10873429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300022533|Ga0242662_10138567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
3300024220|Ga0224568_1007619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
3300025910|Ga0207684_10207911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1688 | Open in IMG/M |
3300025914|Ga0207671_11242356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
3300025916|Ga0207663_10268405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1263 | Open in IMG/M |
3300025921|Ga0207652_11805902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
3300025922|Ga0207646_11677279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300025927|Ga0207687_11778777 | Not Available | 528 | Open in IMG/M |
3300025939|Ga0207665_11031677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
3300026005|Ga0208285_1025227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
3300026078|Ga0207702_11973590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300026078|Ga0207702_12274306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
3300026320|Ga0209131_1175399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
3300027035|Ga0207776_1048726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
3300027101|Ga0208727_100813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
3300027432|Ga0209421_1071065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
3300027568|Ga0208042_1150008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300027787|Ga0209074_10246794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
3300027826|Ga0209060_10144484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1104 | Open in IMG/M |
3300027855|Ga0209693_10450395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
3300027879|Ga0209169_10237758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 954 | Open in IMG/M |
3300027911|Ga0209698_10666060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 795 | Open in IMG/M |
3300028017|Ga0265356_1010339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1041 | Open in IMG/M |
3300028379|Ga0268266_10474153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1192 | Open in IMG/M |
3300028379|Ga0268266_10766680 | Not Available | 931 | Open in IMG/M |
3300028381|Ga0268264_10018349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5721 | Open in IMG/M |
3300028746|Ga0302233_10374967 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
3300028906|Ga0308309_10800331 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 819 | Open in IMG/M |
3300028906|Ga0308309_10890694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 772 | Open in IMG/M |
3300030646|Ga0302316_10013147 | All Organisms → cellular organisms → Bacteria | 4467 | Open in IMG/M |
3300030659|Ga0316363_10083162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1448 | Open in IMG/M |
3300030693|Ga0302313_10051572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1809 | Open in IMG/M |
3300030706|Ga0310039_10338391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
3300030813|Ga0265750_1013875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
3300031057|Ga0170834_106140024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
3300031122|Ga0170822_10369140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
3300031231|Ga0170824_116522868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
3300031231|Ga0170824_118460432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
3300031474|Ga0170818_101315384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300031474|Ga0170818_105749760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
3300031708|Ga0310686_100852337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300031715|Ga0307476_10015153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4907 | Open in IMG/M |
3300031715|Ga0307476_11100714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300031718|Ga0307474_10422999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1039 | Open in IMG/M |
3300031770|Ga0318521_10613675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
3300031996|Ga0308176_12191292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
3300032782|Ga0335082_10093932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2985 | Open in IMG/M |
3300032892|Ga0335081_11956627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
3300032893|Ga0335069_12040328 | Not Available | 603 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.88% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 5.04% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.04% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.04% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.20% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.36% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.36% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.52% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.52% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.52% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.52% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.52% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.52% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.52% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.68% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.68% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.84% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.84% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.84% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.84% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.84% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.84% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.84% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.84% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004478 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026005 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes) | Environmental | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
3300027101 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF027 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
deeps_00611800 | 2199352024 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDLNP |
JGIcombinedJ51221_101136471 | 3300003505 | Forest Soil | MANVKPVVVLTGIAGNLGSRLLPLLGDFSVIGVDLSPPQTDLPLQFERL |
Ga0068972_14912602 | 3300004478 | Peatlands Soil | MGDEKPRVVVTGIAGNLGLRLLPLLAQCQVIGIDLSPPST |
Ga0062595_1004901271 | 3300004479 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGSFSVIGVDVSPPRTNAELQFGSI |
Ga0062595_1006977212 | 3300004479 | Soil | MAEDHPTVVVTGVSGNLGLRLLPLLENFQVIGVDLNPPNTSLP |
Ga0070661_1014905572 | 3300005344 | Corn Rhizosphere | MAKPVVVLTGVSGNLGMRLLPLLGRYTVIGVDVNPPKTDCPLQFESL |
Ga0070711_1004351991 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKPVVVVTGISGNLGSRLLPLLRSFSVIGVDVAPPQTDSELQFENL |
Ga0066704_105249042 | 3300005557 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVTPPQTESEMQFESMD |
Ga0070664_1016598671 | 3300005564 | Corn Rhizosphere | MGDEKPTVVVTGISGNLGSRLLPLLGGFNVIGVDV |
Ga0070762_110482131 | 3300005602 | Soil | MPKPVVVVTGVSGNLGSRLLPLLGRYSVIGVDVSPP |
Ga0070763_102968041 | 3300005610 | Soil | MSGEKPCVFVTGIAGNLGLRLLPLLEDYQVVGLDVNP |
Ga0080026_100101683 | 3300005952 | Permafrost Soil | MAKPVVVVTGVSGNLGSRLLPLLGSFSVIGVDITPPQTDS |
Ga0066790_104904822 | 3300005995 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPRTDS |
Ga0075026_1005505441 | 3300006057 | Watersheds | MGETKPTVVVTGISGNLGARLLPLLHEFDVIGVDLA |
Ga0075030_1008261511 | 3300006162 | Watersheds | MAKPVVVVTGISGNLGSRLLPLLGRYSVIGVDVSPPRTD |
Ga0070716_1001606421 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKPVVVLTGVSGNLGMRLLPLLGRYTVIGVDVNPPKTDCPL |
Ga0079222_116828141 | 3300006755 | Agricultural Soil | MGTEKPAVLVTGIAGNLGSRLLPLLADFQVIAVDLNPPDTSQN |
Ga0075425_1004290913 | 3300006854 | Populus Rhizosphere | MGDPKPTVVVTGISGNLGTRLLPQLVGFDVIGVDLNPPAT |
Ga0079219_123967622 | 3300006954 | Agricultural Soil | MAKPVVVVTGISGNLGSRLLPLLRSFSVIGVDVAPPQTDS |
Ga0105240_112307872 | 3300009093 | Corn Rhizosphere | MKPVIVITGISGNLGMRLLPLLEDYDVIGVDIHPPETSHPLRF |
Ga0105241_103432092 | 3300009174 | Corn Rhizosphere | MAEDHPTVVVTGVSGNLGLRLLPLLENFHVIGVDLNP |
Ga0105238_118663431 | 3300009551 | Corn Rhizosphere | MAKPVVVLTGISGNLGMRLLPLLGRYTVIGVDVNPPKT |
Ga0116133_12223681 | 3300009623 | Peatland | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDLHAPQTDSELQ |
Ga0116135_12239341 | 3300009665 | Peatland | MGQLMRNERPSIVVTGIAGNLGQRLLPLLTDYQVIGID |
Ga0116223_100804713 | 3300009839 | Peatlands Soil | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDLHPPQTDSELQFE |
Ga0126373_105627532 | 3300010048 | Tropical Forest Soil | MAKPVVVVTGVSGNLGSRLLPLLGSFSVIGVDVVS |
Ga0134128_108914131 | 3300010373 | Terrestrial Soil | MAKPVVVLTGVSGNLGSRLLPLLGRYSVIGVDVSPPKTDCELQF |
Ga0126381_1028724421 | 3300010376 | Tropical Forest Soil | MGDERPSVVITGVSGNLGLRLLSMLPEFQIIGVDLNPPHTS |
Ga0136449_1004784681 | 3300010379 | Peatlands Soil | MAKPVVVITGVSGNLGTRLLPLLGSYSVVGVDVSPPKTDSEL |
Ga0136449_1014877502 | 3300010379 | Peatlands Soil | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVGPPRTD |
Ga0150983_155641791 | 3300011120 | Forest Soil | MTSTKPVVVITGIAGNLGSRLLPLLADFSVIGVDLNPPQTGLQ |
Ga0137378_115354432 | 3300012210 | Vadose Zone Soil | MGDPKPTVVVTGVSGNLGTRLLPQLAEFDVIGVDLALPST |
Ga0150985_1099987702 | 3300012212 | Avena Fatua Rhizosphere | MAAANPTVVITGVAGDLGMRLLPLLADYQVLGVDLNPPSTSLPARFV |
Ga0137371_114059322 | 3300012356 | Vadose Zone Soil | MANSKPIVVVTGIAGNLGARLLPLLADFSVIGVDVNPPR |
Ga0137360_117274432 | 3300012361 | Vadose Zone Soil | MAKPVVVVTGIAGNLGSRLLPLLGSFSVIGVDVVP |
Ga0137390_114236901 | 3300012363 | Vadose Zone Soil | MKPVVVVTGISGNLGARLLPLLKSFSVIGVYVSPPHTDLPLQFERM |
Ga0137395_105055032 | 3300012917 | Vadose Zone Soil | MANSKPIVVVTGIAGNLGARLLPLLADFSVIGVDVSPPRTDLPL |
Ga0137404_103411802 | 3300012929 | Vadose Zone Soil | MAKPVVVVTGVSGNLGSRLLPLLGSFSVIGVDIAPP |
Ga0137410_111788432 | 3300012944 | Vadose Zone Soil | MGDPKPTVVITGVSGNLGTRLLPQLAEFDVIGVDLAPPST |
Ga0126369_102496841 | 3300012971 | Tropical Forest Soil | MSGTKPTVVVTGIAGNLGQRLLPQLAEFQVIGIDLKPPAGNS |
Ga0157374_111840692 | 3300013296 | Miscanthus Rhizosphere | MAKPVVVVTGVSGNLGSRLLPMLGSLSVIGVDIHPPQTDS |
Ga0157372_100938204 | 3300013307 | Corn Rhizosphere | MAKPVVVLTGISGNLGMRLLPLLGRYTVIGVDVNPP |
Ga0132258_124313192 | 3300015371 | Arabidopsis Rhizosphere | MGDEKPTVVVTGISGNLGSRLLPLLGGFNVIGVDVAP |
Ga0187820_11523312 | 3300017924 | Freshwater Sediment | MAKPVVVVTGISGNLGSRLLPMLGSFSVIGVDLHPPQIDSEMQF |
Ga0187854_104853742 | 3300017938 | Peatland | MVSDKPVVVVTGIAGNLGSRLLPLLGEFAVIGVDVSSPQTDLP |
Ga0187775_100377103 | 3300017939 | Tropical Peatland | VTSAAKPAVVVTGISGNLGIRLLRQLSGFEVIGVDVYPPHSDPP |
Ga0187808_101407552 | 3300017942 | Freshwater Sediment | MAKPVVVVTGISGNLGSRLLPLLGSFSVIGVDVHP |
Ga0187819_106887351 | 3300017943 | Freshwater Sediment | MAKPVVVVTGISGNLGSRLLPLLGSFSVIGVDVHPPRTDAELQ |
Ga0187847_101852032 | 3300017948 | Peatland | MAKPVIVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPQTESELQF |
Ga0187805_100276813 | 3300018007 | Freshwater Sediment | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPRTDYE |
Ga0187805_103064422 | 3300018007 | Freshwater Sediment | MAKPVVVVTGISGNLGSRLLPLIGSFSVIGVDVHPPRT |
Ga0187873_11857111 | 3300018013 | Peatland | MASDKPVIVVTGIAGNLGSRLLPLLEDFSVIGVDLSTPKTDLPLRFERLD |
Ga0187772_108858342 | 3300018085 | Tropical Peatland | MAKPVVVVTGIAGNLGSRLLPLLGRYKVIGVDITPPKTDGELQF |
Ga0187771_102884931 | 3300018088 | Tropical Peatland | MAKPVVVVTGISGNLGSRLLSLLGSYSVIGVDVSPP |
Ga0187798_11602252 | 3300019275 | Peatland | MGATNPTVLVTGISGNLGVRLLPLLADYRVIGVDLSPPRTD |
Ga0182025_10190801 | 3300019786 | Permafrost | MAIAKPVVVVTGIAGNLGSRLLPLLGEFSVIGVDVGEFS |
Ga0182025_11477981 | 3300019786 | Permafrost | MAIAKPVVVVTGIAGNLGSRLLPLLGEFSVIGVDVTVIG |
Ga0210407_109461531 | 3300020579 | Soil | MPKPVVVVTGVSGNLGSRLLPLLGRYSVIGVDVSP |
Ga0210403_102285473 | 3300020580 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGSYSVTGGDVSP |
Ga0210401_109776141 | 3300020583 | Soil | MGQLMGKDKPSIVVTGIAGNLGVRLLPLLADYHVIGIDLNPPQAD |
Ga0210396_103054711 | 3300021180 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDMNPPHTDSEL |
Ga0210397_103329112 | 3300021403 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPRTDSE |
Ga0210387_102370482 | 3300021405 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVNP |
Ga0210387_114374071 | 3300021405 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSP |
Ga0210383_107316442 | 3300021407 | Soil | MARDKPVVVVTGIAGNLGSRLLPLLGEFSVIGVDVSSCQ |
Ga0210384_105228811 | 3300021432 | Soil | MESAKPVVVVTGIAGNLGARLLPLLGDYSVIGVDLNP |
Ga0210402_115617111 | 3300021478 | Soil | MTTGKPTLVVTGIAGNLGQRLLPLLGDFSVVGIDIAPPK |
Ga0210410_108416531 | 3300021479 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGRFSVIGVDVSPPR |
Ga0210409_102698441 | 3300021559 | Soil | MGQGMGKDKPNIVVTGIAGNLGVRLLPLLEDYHVIG |
Ga0213853_108734291 | 3300021861 | Watersheds | MAKPVVVVTGISGNLGLRLLKLLGNYSVIGVDVSP |
Ga0242662_101385672 | 3300022533 | Soil | MAKPVVVVTGISGNLGSRLLPLLRSFSVIGVDVAPPQTDSELQFE |
Ga0224568_10076192 | 3300024220 | Plant Litter | MTSTKPVVVITGIAGNLGSRLLPLLAEFSVIGVDLRPP |
Ga0207684_102079111 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKPVVVVTGIAGNLGSRLLPLLKGFSVIGVDVSPPQT |
Ga0207671_112423561 | 3300025914 | Corn Rhizosphere | MGDEKPTVVVTGISGNLGSRLLPLLGGFNVIGVDVAPP |
Ga0207663_102684051 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKPVVVVTGVSGNLGSRLLPMLGSFSVIGVDIHPPQTDSELQ |
Ga0207652_118059022 | 3300025921 | Corn Rhizosphere | MGDEKPTVVVTGISGNLGSRLLPQLGGFNVIGVDVA |
Ga0207646_116772792 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVAW |
Ga0207687_117787772 | 3300025927 | Miscanthus Rhizosphere | MAEDHPTVVVTGVSGNLGLRLLPLLENFQVIGVDLN |
Ga0207665_110316771 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MGDPKPTVVVTGISGNLGIRLLPQLAGFDVIGVDIAPPSTDL |
Ga0208285_10252271 | 3300026005 | Rice Paddy Soil | MAKPVVVLTGVSGNLGSRLLPLLGRYSVIGVDVSPPKTDCELQFEN |
Ga0207702_119735901 | 3300026078 | Corn Rhizosphere | MGDEKPTVVVTGISGNLGSRLLPLLGGFNVIGVDVA |
Ga0207702_122743062 | 3300026078 | Corn Rhizosphere | MAKPVVVVTGVSGNLGSRLLPMLGSFSVIGVDIHPPQTDSEL |
Ga0209131_11753991 | 3300026320 | Grasslands Soil | MESTKPVVVVTGIAGNLGSRLLPLLGDFSVIGVDLSP |
Ga0207776_10487262 | 3300027035 | Tropical Forest Soil | MPKPVVVVTGVSGNLGTRLLPLLGSYSVIGVDVSPP |
Ga0208727_1008132 | 3300027101 | Forest Soil | MANVKPVVVLTGIAGNLGSRLLPLLGDFSVIGVDLSPPQTDLPLQFER |
Ga0209421_10710651 | 3300027432 | Forest Soil | MGDAKPTVVVTGISGNLGTRLLPQLGAFNVIGLDVNPPAT |
Ga0208042_11500081 | 3300027568 | Peatlands Soil | MAKPVVVITGVSGNLGTRLLPLLGSYSVLGVDVSPPKTDSELRFERMD |
Ga0209074_102467942 | 3300027787 | Agricultural Soil | MGDPKPTVVVTGISGNLGIRLLPQLAGFDVIGVDIAPPSTD |
Ga0209060_101444841 | 3300027826 | Surface Soil | MGDEKPRVVVTGISGNLGVRLLPLLAHSQVIGIDLNPP |
Ga0209693_104503952 | 3300027855 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGSFSVVGVDVSPPRTD |
Ga0209169_102377582 | 3300027879 | Soil | MSGEKPCVFVTGIAGNLGLRLLPLLEDYQVVGLDVNPPQTD |
Ga0209698_106660602 | 3300027911 | Watersheds | MAKPVVVVTGISGNLGSRLLPLLGRYSVIGVDVSPPR |
Ga0265356_10103391 | 3300028017 | Rhizosphere | MASDKPVVVVTGIAGNLGSRLLPLLGEFSVIGVDVSSCQTDLP |
Ga0268266_104741531 | 3300028379 | Switchgrass Rhizosphere | MGDTKPTVVVTGISGNLGTRLLPQLAGFNVIGLDVA |
Ga0268266_107666802 | 3300028379 | Switchgrass Rhizosphere | MAEDHPTVVVTGVSGNLGLRLLPLLENFQVIGVDLNPPNTS |
Ga0268264_100183498 | 3300028381 | Switchgrass Rhizosphere | MAEDHPTVVVTGVSGNLGLRLLPLLENFQVIGVDLTPPNTSLP |
Ga0302233_103749671 | 3300028746 | Palsa | MAKPVIVVTGVSGNLGSRLLPLLGSYSVIGVDVSP |
Ga0308309_108003312 | 3300028906 | Soil | MDPAKPTVLVTGIAGNLGSRLLPLLADYQVIGIDLNPPVA |
Ga0308309_108906941 | 3300028906 | Soil | MAKPVVVVTGVSGNLGSRLLPLLGKYSVIGIDVSPPQTDS |
Ga0302316_100131471 | 3300030646 | Palsa | MASAKPVVVVTGIAGNLGSRFFPLLEDFSVIGVDVTPPQTELPLQF |
Ga0316363_100831621 | 3300030659 | Peatlands Soil | MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPRT |
Ga0302313_100515721 | 3300030693 | Palsa | MASAKPVVVVTGIAGNLGSRFFPLLEDFSVIGVDVTPPQTELPLQ |
Ga0310039_103383911 | 3300030706 | Peatlands Soil | MAKPVVVITGVSGNLGSRLLPLLGSYSVIGVDVSPPRTDSELQFES |
Ga0265750_10138751 | 3300030813 | Soil | MAKPVIVVTGVSGNLGSRLLPLLGSYSVIGVDMSPPQSEAELQFE |
Ga0170834_1061400242 | 3300031057 | Forest Soil | MAKPVVVVTGVSGNLGSRLMPLLGSYSVIGVDVSPPQ |
Ga0170822_103691402 | 3300031122 | Forest Soil | MPKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPQAESELQFENLQYENLDLGQE |
Ga0170824_1165228682 | 3300031231 | Forest Soil | MAKPVVVVTGVSGNLGTRLLPLLGSYSVIGVDVSPPRT |
Ga0170824_1184604322 | 3300031231 | Forest Soil | MAKPVVVVTGVSGNLGSRLMPLLGSYSVIGVDVSPP |
Ga0170818_1013153842 | 3300031474 | Forest Soil | VVVVTGVSGNLGSRLIPLLGSYSVIGVDVSPPQTDSELQFEGLDLG |
Ga0170818_1057497602 | 3300031474 | Forest Soil | MPKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPQAESELQAN |
Ga0310686_1008523371 | 3300031708 | Soil | MAKPVVVVTGISGNLGLRLLPLLGSFSVIGVDVSPPQT |
Ga0307476_100151536 | 3300031715 | Hardwood Forest Soil | MPKPVVVVTGVSGNLGTRLLPLLGSYSVIGVDVSPPQAESELQFEN |
Ga0307476_111007142 | 3300031715 | Hardwood Forest Soil | MAKPVVVVTGISGNLGSRLLPLLRSFSVIGVDVAPPQTD |
Ga0307474_104229991 | 3300031718 | Hardwood Forest Soil | MAKPVVIVTGVSGNLGSRLLPLLGSYSVVGVDLHPP |
Ga0318521_106136751 | 3300031770 | Soil | MAKPVVVVTGVSGNLGSRLLPLLKSFSVIGVDVHPP |
Ga0308176_121912922 | 3300031996 | Soil | MAKPVVVLTGVSGNLGMRLLPLLGRYTVIGVDVNPPKT |
Ga0335082_100939321 | 3300032782 | Soil | MGNAKPTVVITGISGNLGSRLLPQLGEFDVIGVDMSPPVTDL |
Ga0335081_119566271 | 3300032892 | Soil | MSSRGGVVLVTGVSGNLGTRLLPLLSDFHVVGVDVRPPS |
Ga0335069_120403281 | 3300032893 | Soil | VNNSDKPAIVVTGVAGNLGSRLLPLLDAFQVVGVDLVPPR |
⦗Top⦘ |