NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075255

Metagenome / Metatranscriptome Family F075255

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075255
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 40 residues
Representative Sequence MAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPRT
Number of Associated Samples 108
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 36.13 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.44 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.958 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.765 % of family members)
Environment Ontology (ENVO) Unclassified
(21.849 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.059 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 16.67%    β-sheet: 13.64%    Coil/Unstructured: 69.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF13145Rotamase_2 67.23
PF01545Cation_efflux 5.88
PF16916ZT_dimer 3.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 5.88
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 5.88
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 5.88


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.96 %
UnclassifiedrootN/A5.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps_contig81071.48574All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1201Open in IMG/M
3300003505|JGIcombinedJ51221_10113647All Organisms → cellular organisms → Bacteria → Acidobacteria1083Open in IMG/M
3300004478|Ga0068972_1491260All Organisms → cellular organisms → Bacteria → Acidobacteria831Open in IMG/M
3300004479|Ga0062595_100490127All Organisms → cellular organisms → Bacteria → Acidobacteria919Open in IMG/M
3300004479|Ga0062595_100697721Not Available814Open in IMG/M
3300005344|Ga0070661_101490557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter570Open in IMG/M
3300005439|Ga0070711_100435199All Organisms → cellular organisms → Bacteria → Acidobacteria1071Open in IMG/M
3300005557|Ga0066704_10524904All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium776Open in IMG/M
3300005564|Ga0070664_101659867All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300005602|Ga0070762_11048213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae560Open in IMG/M
3300005610|Ga0070763_10296804All Organisms → cellular organisms → Bacteria → Acidobacteria887Open in IMG/M
3300005952|Ga0080026_10010168All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2205Open in IMG/M
3300005995|Ga0066790_10490482All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300006057|Ga0075026_100550544All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300006162|Ga0075030_100826151All Organisms → cellular organisms → Bacteria → Acidobacteria732Open in IMG/M
3300006173|Ga0070716_100160642All Organisms → cellular organisms → Bacteria → Acidobacteria1455Open in IMG/M
3300006755|Ga0079222_11682814All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300006854|Ga0075425_100429091All Organisms → cellular organisms → Bacteria → Acidobacteria1522Open in IMG/M
3300006954|Ga0079219_12396762All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300009093|Ga0105240_11230787Not Available792Open in IMG/M
3300009174|Ga0105241_10343209All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1294Open in IMG/M
3300009551|Ga0105238_11866343All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium633Open in IMG/M
3300009623|Ga0116133_1222368All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300009665|Ga0116135_1223934All Organisms → cellular organisms → Bacteria → Acidobacteria724Open in IMG/M
3300009839|Ga0116223_10080471All Organisms → cellular organisms → Bacteria → Acidobacteria2083Open in IMG/M
3300010048|Ga0126373_10562753All Organisms → cellular organisms → Bacteria → Acidobacteria1189Open in IMG/M
3300010373|Ga0134128_10891413All Organisms → cellular organisms → Bacteria → Acidobacteria985Open in IMG/M
3300010376|Ga0126381_102872442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117686Open in IMG/M
3300010379|Ga0136449_100478468All Organisms → cellular organisms → Bacteria → Acidobacteria2172Open in IMG/M
3300010379|Ga0136449_101487750All Organisms → cellular organisms → Bacteria → Acidobacteria1038Open in IMG/M
3300011120|Ga0150983_15564179All Organisms → cellular organisms → Bacteria → Acidobacteria790Open in IMG/M
3300012210|Ga0137378_11535443All Organisms → cellular organisms → Bacteria → Acidobacteria576Open in IMG/M
3300012212|Ga0150985_109998770Not Available561Open in IMG/M
3300012356|Ga0137371_11405932All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300012361|Ga0137360_11727443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300012363|Ga0137390_11423690All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300012917|Ga0137395_10505503All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium870Open in IMG/M
3300012929|Ga0137404_10341180All Organisms → cellular organisms → Bacteria → Acidobacteria1309Open in IMG/M
3300012944|Ga0137410_11178843All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300012971|Ga0126369_10249684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1745Open in IMG/M
3300013296|Ga0157374_11184069All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300013307|Ga0157372_10093820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3416Open in IMG/M
3300015371|Ga0132258_12431319All Organisms → cellular organisms → Bacteria → Acidobacteria1312Open in IMG/M
3300017924|Ga0187820_1152331All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300017938|Ga0187854_10485374All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300017939|Ga0187775_10037710All Organisms → cellular organisms → Bacteria → Acidobacteria1422Open in IMG/M
3300017942|Ga0187808_10140755All Organisms → cellular organisms → Bacteria → Acidobacteria1061Open in IMG/M
3300017943|Ga0187819_10688735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium577Open in IMG/M
3300017948|Ga0187847_10185203All Organisms → cellular organisms → Bacteria → Acidobacteria1136Open in IMG/M
3300018007|Ga0187805_10027681All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2507Open in IMG/M
3300018007|Ga0187805_10306442All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium731Open in IMG/M
3300018013|Ga0187873_1185711All Organisms → cellular organisms → Bacteria → Acidobacteria783Open in IMG/M
3300018085|Ga0187772_10885834All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300018088|Ga0187771_10288493All Organisms → cellular organisms → Bacteria → Acidobacteria1374Open in IMG/M
3300019275|Ga0187798_1160225All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300019786|Ga0182025_1019080All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300019786|Ga0182025_1147798All Organisms → cellular organisms → Bacteria → Acidobacteria1677Open in IMG/M
3300020579|Ga0210407_10946153All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium659Open in IMG/M
3300020580|Ga0210403_10228547All Organisms → cellular organisms → Bacteria → Acidobacteria1526Open in IMG/M
3300020583|Ga0210401_10977614All Organisms → cellular organisms → Bacteria → Acidobacteria705Open in IMG/M
3300021180|Ga0210396_10305471All Organisms → cellular organisms → Bacteria → Acidobacteria1408Open in IMG/M
3300021403|Ga0210397_10332911All Organisms → cellular organisms → Bacteria → Acidobacteria1122Open in IMG/M
3300021405|Ga0210387_10237048All Organisms → cellular organisms → Bacteria → Acidobacteria1593Open in IMG/M
3300021405|Ga0210387_11437407All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium592Open in IMG/M
3300021407|Ga0210383_10731644All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium849Open in IMG/M
3300021432|Ga0210384_10522881All Organisms → cellular organisms → Bacteria → Acidobacteria1068Open in IMG/M
3300021478|Ga0210402_11561711All Organisms → cellular organisms → Bacteria → Acidobacteria587Open in IMG/M
3300021479|Ga0210410_10841653All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300021559|Ga0210409_10269844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1538Open in IMG/M
3300021861|Ga0213853_10873429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300022533|Ga0242662_10138567All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300024220|Ga0224568_1007619All Organisms → cellular organisms → Bacteria → Acidobacteria1039Open in IMG/M
3300025910|Ga0207684_10207911All Organisms → cellular organisms → Bacteria → Acidobacteria1688Open in IMG/M
3300025914|Ga0207671_11242356All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300025916|Ga0207663_10268405All Organisms → cellular organisms → Bacteria → Acidobacteria1263Open in IMG/M
3300025921|Ga0207652_11805902All Organisms → cellular organisms → Bacteria → Acidobacteria516Open in IMG/M
3300025922|Ga0207646_11677279All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300025927|Ga0207687_11778777Not Available528Open in IMG/M
3300025939|Ga0207665_11031677All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300026005|Ga0208285_1025227All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300026078|Ga0207702_11973590All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300026078|Ga0207702_12274306All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium530Open in IMG/M
3300026320|Ga0209131_1175399All Organisms → cellular organisms → Bacteria → Acidobacteria1044Open in IMG/M
3300027035|Ga0207776_1048726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300027101|Ga0208727_100813All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300027432|Ga0209421_1071065All Organisms → cellular organisms → Bacteria → Acidobacteria702Open in IMG/M
3300027568|Ga0208042_1150008All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300027787|Ga0209074_10246794All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300027826|Ga0209060_10144484All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71104Open in IMG/M
3300027855|Ga0209693_10450395All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300027879|Ga0209169_10237758All Organisms → cellular organisms → Bacteria → Acidobacteria954Open in IMG/M
3300027911|Ga0209698_10666060All Organisms → cellular organisms → Bacteria → Acidobacteria795Open in IMG/M
3300028017|Ga0265356_1010339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1041Open in IMG/M
3300028379|Ga0268266_10474153All Organisms → cellular organisms → Bacteria → Acidobacteria1192Open in IMG/M
3300028379|Ga0268266_10766680Not Available931Open in IMG/M
3300028381|Ga0268264_10018349All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis5721Open in IMG/M
3300028746|Ga0302233_10374967All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300028906|Ga0308309_10800331All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7819Open in IMG/M
3300028906|Ga0308309_10890694All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300030646|Ga0302316_10013147All Organisms → cellular organisms → Bacteria4467Open in IMG/M
3300030659|Ga0316363_10083162All Organisms → cellular organisms → Bacteria → Acidobacteria1448Open in IMG/M
3300030693|Ga0302313_10051572All Organisms → cellular organisms → Bacteria → Acidobacteria1809Open in IMG/M
3300030706|Ga0310039_10338391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium563Open in IMG/M
3300030813|Ga0265750_1013875All Organisms → cellular organisms → Bacteria → Acidobacteria963Open in IMG/M
3300031057|Ga0170834_106140024All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium679Open in IMG/M
3300031122|Ga0170822_10369140All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300031231|Ga0170824_116522868All Organisms → cellular organisms → Bacteria → Acidobacteria842Open in IMG/M
3300031231|Ga0170824_118460432All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium676Open in IMG/M
3300031474|Ga0170818_101315384All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300031474|Ga0170818_105749760All Organisms → cellular organisms → Bacteria → Acidobacteria1003Open in IMG/M
3300031708|Ga0310686_100852337All Organisms → cellular organisms → Bacteria → Acidobacteria550Open in IMG/M
3300031715|Ga0307476_10015153All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4907Open in IMG/M
3300031715|Ga0307476_11100714All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300031718|Ga0307474_10422999All Organisms → cellular organisms → Bacteria → Acidobacteria1039Open in IMG/M
3300031770|Ga0318521_10613675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300031996|Ga0308176_12191292All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300032782|Ga0335082_10093932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2985Open in IMG/M
3300032892|Ga0335081_11956627All Organisms → cellular organisms → Bacteria → Acidobacteria627Open in IMG/M
3300032893|Ga0335069_12040328Not Available603Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.76%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.88%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil5.04%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.04%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.04%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.20%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.36%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.36%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.52%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.52%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.52%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.52%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.52%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.52%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.52%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.68%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.68%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.84%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.84%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.84%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.84%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.84%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.84%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.84%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004478Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300019275Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019786Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024220Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026005Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300027035Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes)EnvironmentalOpen in IMG/M
3300027101Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF027 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027568Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028017Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030693Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2EnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300030813Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031122Oak Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deeps_006118002199352024SoilMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDLNP
JGIcombinedJ51221_1011364713300003505Forest SoilMANVKPVVVLTGIAGNLGSRLLPLLGDFSVIGVDLSPPQTDLPLQFERL
Ga0068972_149126023300004478Peatlands SoilMGDEKPRVVVTGIAGNLGLRLLPLLAQCQVIGIDLSPPST
Ga0062595_10049012713300004479SoilMAKPVVVVTGVSGNLGSRLLPLLGSFSVIGVDVSPPRTNAELQFGSI
Ga0062595_10069772123300004479SoilMAEDHPTVVVTGVSGNLGLRLLPLLENFQVIGVDLNPPNTSLP
Ga0070661_10149055723300005344Corn RhizosphereMAKPVVVLTGVSGNLGMRLLPLLGRYTVIGVDVNPPKTDCPLQFESL
Ga0070711_10043519913300005439Corn, Switchgrass And Miscanthus RhizosphereMAKPVVVVTGISGNLGSRLLPLLRSFSVIGVDVAPPQTDSELQFENL
Ga0066704_1052490423300005557SoilMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVTPPQTESEMQFESMD
Ga0070664_10165986713300005564Corn RhizosphereMGDEKPTVVVTGISGNLGSRLLPLLGGFNVIGVDV
Ga0070762_1104821313300005602SoilMPKPVVVVTGVSGNLGSRLLPLLGRYSVIGVDVSPP
Ga0070763_1029680413300005610SoilMSGEKPCVFVTGIAGNLGLRLLPLLEDYQVVGLDVNP
Ga0080026_1001016833300005952Permafrost SoilMAKPVVVVTGVSGNLGSRLLPLLGSFSVIGVDITPPQTDS
Ga0066790_1049048223300005995SoilMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPRTDS
Ga0075026_10055054413300006057WatershedsMGETKPTVVVTGISGNLGARLLPLLHEFDVIGVDLA
Ga0075030_10082615113300006162WatershedsMAKPVVVVTGISGNLGSRLLPLLGRYSVIGVDVSPPRTD
Ga0070716_10016064213300006173Corn, Switchgrass And Miscanthus RhizosphereMAKPVVVLTGVSGNLGMRLLPLLGRYTVIGVDVNPPKTDCPL
Ga0079222_1168281413300006755Agricultural SoilMGTEKPAVLVTGIAGNLGSRLLPLLADFQVIAVDLNPPDTSQN
Ga0075425_10042909133300006854Populus RhizosphereMGDPKPTVVVTGISGNLGTRLLPQLVGFDVIGVDLNPPAT
Ga0079219_1239676223300006954Agricultural SoilMAKPVVVVTGISGNLGSRLLPLLRSFSVIGVDVAPPQTDS
Ga0105240_1123078723300009093Corn RhizosphereMKPVIVITGISGNLGMRLLPLLEDYDVIGVDIHPPETSHPLRF
Ga0105241_1034320923300009174Corn RhizosphereMAEDHPTVVVTGVSGNLGLRLLPLLENFHVIGVDLNP
Ga0105238_1186634313300009551Corn RhizosphereMAKPVVVLTGISGNLGMRLLPLLGRYTVIGVDVNPPKT
Ga0116133_122236813300009623PeatlandMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDLHAPQTDSELQ
Ga0116135_122393413300009665PeatlandMGQLMRNERPSIVVTGIAGNLGQRLLPLLTDYQVIGID
Ga0116223_1008047133300009839Peatlands SoilMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDLHPPQTDSELQFE
Ga0126373_1056275323300010048Tropical Forest SoilMAKPVVVVTGVSGNLGSRLLPLLGSFSVIGVDVVS
Ga0134128_1089141313300010373Terrestrial SoilMAKPVVVLTGVSGNLGSRLLPLLGRYSVIGVDVSPPKTDCELQF
Ga0126381_10287244213300010376Tropical Forest SoilMGDERPSVVITGVSGNLGLRLLSMLPEFQIIGVDLNPPHTS
Ga0136449_10047846813300010379Peatlands SoilMAKPVVVITGVSGNLGTRLLPLLGSYSVVGVDVSPPKTDSEL
Ga0136449_10148775023300010379Peatlands SoilMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVGPPRTD
Ga0150983_1556417913300011120Forest SoilMTSTKPVVVITGIAGNLGSRLLPLLADFSVIGVDLNPPQTGLQ
Ga0137378_1153544323300012210Vadose Zone SoilMGDPKPTVVVTGVSGNLGTRLLPQLAEFDVIGVDLALPST
Ga0150985_10999877023300012212Avena Fatua RhizosphereMAAANPTVVITGVAGDLGMRLLPLLADYQVLGVDLNPPSTSLPARFV
Ga0137371_1140593223300012356Vadose Zone SoilMANSKPIVVVTGIAGNLGARLLPLLADFSVIGVDVNPPR
Ga0137360_1172744323300012361Vadose Zone SoilMAKPVVVVTGIAGNLGSRLLPLLGSFSVIGVDVVP
Ga0137390_1142369013300012363Vadose Zone SoilMKPVVVVTGISGNLGARLLPLLKSFSVIGVYVSPPHTDLPLQFERM
Ga0137395_1050550323300012917Vadose Zone SoilMANSKPIVVVTGIAGNLGARLLPLLADFSVIGVDVSPPRTDLPL
Ga0137404_1034118023300012929Vadose Zone SoilMAKPVVVVTGVSGNLGSRLLPLLGSFSVIGVDIAPP
Ga0137410_1117884323300012944Vadose Zone SoilMGDPKPTVVITGVSGNLGTRLLPQLAEFDVIGVDLAPPST
Ga0126369_1024968413300012971Tropical Forest SoilMSGTKPTVVVTGIAGNLGQRLLPQLAEFQVIGIDLKPPAGNS
Ga0157374_1118406923300013296Miscanthus RhizosphereMAKPVVVVTGVSGNLGSRLLPMLGSLSVIGVDIHPPQTDS
Ga0157372_1009382043300013307Corn RhizosphereMAKPVVVLTGISGNLGMRLLPLLGRYTVIGVDVNPP
Ga0132258_1243131923300015371Arabidopsis RhizosphereMGDEKPTVVVTGISGNLGSRLLPLLGGFNVIGVDVAP
Ga0187820_115233123300017924Freshwater SedimentMAKPVVVVTGISGNLGSRLLPMLGSFSVIGVDLHPPQIDSEMQF
Ga0187854_1048537423300017938PeatlandMVSDKPVVVVTGIAGNLGSRLLPLLGEFAVIGVDVSSPQTDLP
Ga0187775_1003771033300017939Tropical PeatlandVTSAAKPAVVVTGISGNLGIRLLRQLSGFEVIGVDVYPPHSDPP
Ga0187808_1014075523300017942Freshwater SedimentMAKPVVVVTGISGNLGSRLLPLLGSFSVIGVDVHP
Ga0187819_1068873513300017943Freshwater SedimentMAKPVVVVTGISGNLGSRLLPLLGSFSVIGVDVHPPRTDAELQ
Ga0187847_1018520323300017948PeatlandMAKPVIVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPQTESELQF
Ga0187805_1002768133300018007Freshwater SedimentMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPRTDYE
Ga0187805_1030644223300018007Freshwater SedimentMAKPVVVVTGISGNLGSRLLPLIGSFSVIGVDVHPPRT
Ga0187873_118571113300018013PeatlandMASDKPVIVVTGIAGNLGSRLLPLLEDFSVIGVDLSTPKTDLPLRFERLD
Ga0187772_1088583423300018085Tropical PeatlandMAKPVVVVTGIAGNLGSRLLPLLGRYKVIGVDITPPKTDGELQF
Ga0187771_1028849313300018088Tropical PeatlandMAKPVVVVTGISGNLGSRLLSLLGSYSVIGVDVSPP
Ga0187798_116022523300019275PeatlandMGATNPTVLVTGISGNLGVRLLPLLADYRVIGVDLSPPRTD
Ga0182025_101908013300019786PermafrostMAIAKPVVVVTGIAGNLGSRLLPLLGEFSVIGVDVGEFS
Ga0182025_114779813300019786PermafrostMAIAKPVVVVTGIAGNLGSRLLPLLGEFSVIGVDVTVIG
Ga0210407_1094615313300020579SoilMPKPVVVVTGVSGNLGSRLLPLLGRYSVIGVDVSP
Ga0210403_1022854733300020580SoilMAKPVVVVTGVSGNLGSRLLPLLGSYSVTGGDVSP
Ga0210401_1097761413300020583SoilMGQLMGKDKPSIVVTGIAGNLGVRLLPLLADYHVIGIDLNPPQAD
Ga0210396_1030547113300021180SoilMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDMNPPHTDSEL
Ga0210397_1033291123300021403SoilMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPRTDSE
Ga0210387_1023704823300021405SoilMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVNP
Ga0210387_1143740713300021405SoilMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSP
Ga0210383_1073164423300021407SoilMARDKPVVVVTGIAGNLGSRLLPLLGEFSVIGVDVSSCQ
Ga0210384_1052288113300021432SoilMESAKPVVVVTGIAGNLGARLLPLLGDYSVIGVDLNP
Ga0210402_1156171113300021478SoilMTTGKPTLVVTGIAGNLGQRLLPLLGDFSVVGIDIAPPK
Ga0210410_1084165313300021479SoilMAKPVVVVTGVSGNLGSRLLPLLGRFSVIGVDVSPPR
Ga0210409_1026984413300021559SoilMGQGMGKDKPNIVVTGIAGNLGVRLLPLLEDYHVIG
Ga0213853_1087342913300021861WatershedsMAKPVVVVTGISGNLGLRLLKLLGNYSVIGVDVSP
Ga0242662_1013856723300022533SoilMAKPVVVVTGISGNLGSRLLPLLRSFSVIGVDVAPPQTDSELQFE
Ga0224568_100761923300024220Plant LitterMTSTKPVVVITGIAGNLGSRLLPLLAEFSVIGVDLRPP
Ga0207684_1020791113300025910Corn, Switchgrass And Miscanthus RhizosphereMKPVVVVTGIAGNLGSRLLPLLKGFSVIGVDVSPPQT
Ga0207671_1124235613300025914Corn RhizosphereMGDEKPTVVVTGISGNLGSRLLPLLGGFNVIGVDVAPP
Ga0207663_1026840513300025916Corn, Switchgrass And Miscanthus RhizosphereMAKPVVVVTGVSGNLGSRLLPMLGSFSVIGVDIHPPQTDSELQ
Ga0207652_1180590223300025921Corn RhizosphereMGDEKPTVVVTGISGNLGSRLLPQLGGFNVIGVDVA
Ga0207646_1167727923300025922Corn, Switchgrass And Miscanthus RhizosphereMPKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVAW
Ga0207687_1177877723300025927Miscanthus RhizosphereMAEDHPTVVVTGVSGNLGLRLLPLLENFQVIGVDLN
Ga0207665_1103167713300025939Corn, Switchgrass And Miscanthus RhizosphereMGDPKPTVVVTGISGNLGIRLLPQLAGFDVIGVDIAPPSTDL
Ga0208285_102522713300026005Rice Paddy SoilMAKPVVVLTGVSGNLGSRLLPLLGRYSVIGVDVSPPKTDCELQFEN
Ga0207702_1197359013300026078Corn RhizosphereMGDEKPTVVVTGISGNLGSRLLPLLGGFNVIGVDVA
Ga0207702_1227430623300026078Corn RhizosphereMAKPVVVVTGVSGNLGSRLLPMLGSFSVIGVDIHPPQTDSEL
Ga0209131_117539913300026320Grasslands SoilMESTKPVVVVTGIAGNLGSRLLPLLGDFSVIGVDLSP
Ga0207776_104872623300027035Tropical Forest SoilMPKPVVVVTGVSGNLGTRLLPLLGSYSVIGVDVSPP
Ga0208727_10081323300027101Forest SoilMANVKPVVVLTGIAGNLGSRLLPLLGDFSVIGVDLSPPQTDLPLQFER
Ga0209421_107106513300027432Forest SoilMGDAKPTVVVTGISGNLGTRLLPQLGAFNVIGLDVNPPAT
Ga0208042_115000813300027568Peatlands SoilMAKPVVVITGVSGNLGTRLLPLLGSYSVLGVDVSPPKTDSELRFERMD
Ga0209074_1024679423300027787Agricultural SoilMGDPKPTVVVTGISGNLGIRLLPQLAGFDVIGVDIAPPSTD
Ga0209060_1014448413300027826Surface SoilMGDEKPRVVVTGISGNLGVRLLPLLAHSQVIGIDLNPP
Ga0209693_1045039523300027855SoilMAKPVVVVTGVSGNLGSRLLPLLGSFSVVGVDVSPPRTD
Ga0209169_1023775823300027879SoilMSGEKPCVFVTGIAGNLGLRLLPLLEDYQVVGLDVNPPQTD
Ga0209698_1066606023300027911WatershedsMAKPVVVVTGISGNLGSRLLPLLGRYSVIGVDVSPPR
Ga0265356_101033913300028017RhizosphereMASDKPVVVVTGIAGNLGSRLLPLLGEFSVIGVDVSSCQTDLP
Ga0268266_1047415313300028379Switchgrass RhizosphereMGDTKPTVVVTGISGNLGTRLLPQLAGFNVIGLDVA
Ga0268266_1076668023300028379Switchgrass RhizosphereMAEDHPTVVVTGVSGNLGLRLLPLLENFQVIGVDLNPPNTS
Ga0268264_1001834983300028381Switchgrass RhizosphereMAEDHPTVVVTGVSGNLGLRLLPLLENFQVIGVDLTPPNTSLP
Ga0302233_1037496713300028746PalsaMAKPVIVVTGVSGNLGSRLLPLLGSYSVIGVDVSP
Ga0308309_1080033123300028906SoilMDPAKPTVLVTGIAGNLGSRLLPLLADYQVIGIDLNPPVA
Ga0308309_1089069413300028906SoilMAKPVVVVTGVSGNLGSRLLPLLGKYSVIGIDVSPPQTDS
Ga0302316_1001314713300030646PalsaMASAKPVVVVTGIAGNLGSRFFPLLEDFSVIGVDVTPPQTELPLQF
Ga0316363_1008316213300030659Peatlands SoilMAKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPRT
Ga0302313_1005157213300030693PalsaMASAKPVVVVTGIAGNLGSRFFPLLEDFSVIGVDVTPPQTELPLQ
Ga0310039_1033839113300030706Peatlands SoilMAKPVVVITGVSGNLGSRLLPLLGSYSVIGVDVSPPRTDSELQFES
Ga0265750_101387513300030813SoilMAKPVIVVTGVSGNLGSRLLPLLGSYSVIGVDMSPPQSEAELQFE
Ga0170834_10614002423300031057Forest SoilMAKPVVVVTGVSGNLGSRLMPLLGSYSVIGVDVSPPQ
Ga0170822_1036914023300031122Forest SoilMPKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPQAESELQFENLQYENLDLGQE
Ga0170824_11652286823300031231Forest SoilMAKPVVVVTGVSGNLGTRLLPLLGSYSVIGVDVSPPRT
Ga0170824_11846043223300031231Forest SoilMAKPVVVVTGVSGNLGSRLMPLLGSYSVIGVDVSPP
Ga0170818_10131538423300031474Forest SoilVVVVTGVSGNLGSRLIPLLGSYSVIGVDVSPPQTDSELQFEGLDLG
Ga0170818_10574976023300031474Forest SoilMPKPVVVVTGVSGNLGSRLLPLLGSYSVIGVDVSPPQAESELQAN
Ga0310686_10085233713300031708SoilMAKPVVVVTGISGNLGLRLLPLLGSFSVIGVDVSPPQT
Ga0307476_1001515363300031715Hardwood Forest SoilMPKPVVVVTGVSGNLGTRLLPLLGSYSVIGVDVSPPQAESELQFEN
Ga0307476_1110071423300031715Hardwood Forest SoilMAKPVVVVTGISGNLGSRLLPLLRSFSVIGVDVAPPQTD
Ga0307474_1042299913300031718Hardwood Forest SoilMAKPVVIVTGVSGNLGSRLLPLLGSYSVVGVDLHPP
Ga0318521_1061367513300031770SoilMAKPVVVVTGVSGNLGSRLLPLLKSFSVIGVDVHPP
Ga0308176_1219129223300031996SoilMAKPVVVLTGVSGNLGMRLLPLLGRYTVIGVDVNPPKT
Ga0335082_1009393213300032782SoilMGNAKPTVVITGISGNLGSRLLPQLGEFDVIGVDMSPPVTDL
Ga0335081_1195662713300032892SoilMSSRGGVVLVTGVSGNLGTRLLPLLSDFHVVGVDVRPPS
Ga0335069_1204032813300032893SoilVNNSDKPAIVVTGVAGNLGSRLLPLLDAFQVVGVDLVPPR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.