Basic Information | |
---|---|
Family ID | F075305 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 45 residues |
Representative Sequence | DERLRAQLRTALTQLILAGLKQPEIKALINEELDELLKESRRG |
Number of Associated Samples | 101 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.84 % |
% of genes near scaffold ends (potentially truncated) | 98.32 % |
% of genes from short scaffolds (< 2000 bps) | 92.44 % |
Associated GOLD sequencing projects | 91 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.67 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (57.143 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere (8.403 % of family members) |
Environment Ontology (ENVO) | Unclassified (52.101 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (68.067 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF04773 | FecR | 26.05 |
PF13519 | VWA_2 | 4.20 |
PF01642 | MM_CoA_mutase | 0.84 |
PF00092 | VWA | 0.84 |
PF00392 | GntR | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.14 % |
Unclassified | root | N/A | 42.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003267|soilL1_10040252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium → Chloracidobacterium thermophilum | 12176 | Open in IMG/M |
3300004016|Ga0058689_10142004 | Not Available | 546 | Open in IMG/M |
3300004022|Ga0055432_10083071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
3300004463|Ga0063356_103876778 | Not Available | 644 | Open in IMG/M |
3300004799|Ga0058863_10766580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
3300004803|Ga0058862_12034365 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1403 | Open in IMG/M |
3300005293|Ga0065715_10929732 | Not Available | 500 | Open in IMG/M |
3300005330|Ga0070690_100100026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 1921 | Open in IMG/M |
3300005335|Ga0070666_10555943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300005339|Ga0070660_101058823 | Not Available | 686 | Open in IMG/M |
3300005341|Ga0070691_10134480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1255 | Open in IMG/M |
3300005353|Ga0070669_100120904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 1998 | Open in IMG/M |
3300005356|Ga0070674_101655844 | Not Available | 578 | Open in IMG/M |
3300005457|Ga0070662_100932069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
3300005459|Ga0068867_101381213 | Not Available | 652 | Open in IMG/M |
3300005536|Ga0070697_100863443 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300005543|Ga0070672_100916002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
3300005545|Ga0070695_101034414 | Not Available | 669 | Open in IMG/M |
3300005547|Ga0070693_101219865 | Not Available | 578 | Open in IMG/M |
3300005563|Ga0068855_100516521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
3300005564|Ga0070664_100172946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Chloracidobacterium | 1916 | Open in IMG/M |
3300005578|Ga0068854_100376412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1169 | Open in IMG/M |
3300005578|Ga0068854_101083577 | Not Available | 713 | Open in IMG/M |
3300005578|Ga0068854_101842282 | Not Available | 555 | Open in IMG/M |
3300005614|Ga0068856_101737974 | Not Available | 636 | Open in IMG/M |
3300005617|Ga0068859_100892350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
3300005617|Ga0068859_101678548 | Not Available | 702 | Open in IMG/M |
3300005618|Ga0068864_101058565 | Not Available | 806 | Open in IMG/M |
3300005719|Ga0068861_102614756 | Not Available | 509 | Open in IMG/M |
3300005833|Ga0074472_10771337 | Not Available | 537 | Open in IMG/M |
3300005834|Ga0068851_10484362 | Not Available | 740 | Open in IMG/M |
3300005840|Ga0068870_10514362 | Not Available | 800 | Open in IMG/M |
3300005842|Ga0068858_101415439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300005842|Ga0068858_101440680 | Not Available | 679 | Open in IMG/M |
3300005844|Ga0068862_101429083 | Not Available | 696 | Open in IMG/M |
3300006169|Ga0082029_1340233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1403 | Open in IMG/M |
3300006173|Ga0070716_101282888 | Not Available | 591 | Open in IMG/M |
3300006845|Ga0075421_100727711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
3300006847|Ga0075431_100682430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1006 | Open in IMG/M |
3300006852|Ga0075433_10104039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2515 | Open in IMG/M |
3300006852|Ga0075433_11534119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300006852|Ga0075433_11708932 | Not Available | 542 | Open in IMG/M |
3300006854|Ga0075425_101468052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
3300006854|Ga0075425_103129160 | Not Available | 504 | Open in IMG/M |
3300006881|Ga0068865_102025230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
3300006954|Ga0079219_11835620 | Not Available | 569 | Open in IMG/M |
3300006954|Ga0079219_12100437 | Not Available | 541 | Open in IMG/M |
3300007004|Ga0079218_10051090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2569 | Open in IMG/M |
3300009011|Ga0105251_10242699 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300009098|Ga0105245_11455712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
3300009100|Ga0075418_11255302 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
3300009174|Ga0105241_10285047 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1412 | Open in IMG/M |
3300009174|Ga0105241_11506439 | Not Available | 647 | Open in IMG/M |
3300009177|Ga0105248_10386255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1576 | Open in IMG/M |
3300009177|Ga0105248_10934033 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
3300009545|Ga0105237_11450484 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 693 | Open in IMG/M |
3300009545|Ga0105237_12664615 | Not Available | 511 | Open in IMG/M |
3300009553|Ga0105249_13450754 | Not Available | 509 | Open in IMG/M |
3300010036|Ga0126305_11087084 | Not Available | 550 | Open in IMG/M |
3300010038|Ga0126315_10332963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
3300010362|Ga0126377_12967583 | Not Available | 547 | Open in IMG/M |
3300010373|Ga0134128_11064400 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
3300010375|Ga0105239_10242615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2022 | Open in IMG/M |
3300010375|Ga0105239_13005233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300010400|Ga0134122_12509933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
3300010403|Ga0134123_10099271 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 2314 | Open in IMG/M |
3300011119|Ga0105246_10319058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
3300011332|Ga0126317_10847625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1241 | Open in IMG/M |
3300011333|Ga0127502_10359925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
3300012203|Ga0137399_11470404 | Not Available | 568 | Open in IMG/M |
3300012212|Ga0150985_104722721 | Not Available | 707 | Open in IMG/M |
3300012212|Ga0150985_120647521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
3300012948|Ga0126375_10535815 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 881 | Open in IMG/M |
3300012948|Ga0126375_12023083 | Not Available | 510 | Open in IMG/M |
3300012984|Ga0164309_10878729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300012989|Ga0164305_10588521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 892 | Open in IMG/M |
3300013306|Ga0163162_13427855 | Not Available | 505 | Open in IMG/M |
3300014263|Ga0075324_1017684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1229 | Open in IMG/M |
3300014267|Ga0075313_1221388 | Not Available | 509 | Open in IMG/M |
3300014325|Ga0163163_12228498 | Not Available | 607 | Open in IMG/M |
3300015262|Ga0182007_10086186 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
3300015372|Ga0132256_101379570 | Not Available | 817 | Open in IMG/M |
3300015373|Ga0132257_100056829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 4379 | Open in IMG/M |
3300015373|Ga0132257_102871510 | Not Available | 628 | Open in IMG/M |
3300018083|Ga0184628_10507820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
3300018422|Ga0190265_13304513 | Not Available | 538 | Open in IMG/M |
3300021290|Ga0213902_106446 | Not Available | 546 | Open in IMG/M |
3300025796|Ga0210113_1111254 | Not Available | 538 | Open in IMG/M |
3300025903|Ga0207680_10091212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1938 | Open in IMG/M |
3300025903|Ga0207680_10186590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1405 | Open in IMG/M |
3300025917|Ga0207660_10401312 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
3300025920|Ga0207649_11539803 | Not Available | 526 | Open in IMG/M |
3300025925|Ga0207650_11902339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
3300025932|Ga0207690_10778625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
3300025933|Ga0207706_10468057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
3300025940|Ga0207691_10009797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 9198 | Open in IMG/M |
3300025941|Ga0207711_10646679 | Not Available | 986 | Open in IMG/M |
3300025981|Ga0207640_10909871 | Not Available | 769 | Open in IMG/M |
3300025981|Ga0207640_11085125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300026035|Ga0207703_10368962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1325 | Open in IMG/M |
3300026041|Ga0207639_11105217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
3300026075|Ga0207708_10889713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
3300026089|Ga0207648_11743153 | Not Available | 584 | Open in IMG/M |
3300026116|Ga0207674_12040702 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
3300026535|Ga0256867_10024919 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
3300027886|Ga0209486_10669593 | Not Available | 666 | Open in IMG/M |
3300027909|Ga0209382_10894595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
3300028380|Ga0268265_11836955 | Not Available | 612 | Open in IMG/M |
3300031731|Ga0307405_10683233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 848 | Open in IMG/M |
3300031854|Ga0310904_11359565 | Not Available | 516 | Open in IMG/M |
3300031901|Ga0307406_10358846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
3300031940|Ga0310901_10113712 | Not Available | 995 | Open in IMG/M |
3300032003|Ga0310897_10052311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1478 | Open in IMG/M |
3300032013|Ga0310906_10044435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2141 | Open in IMG/M |
3300033412|Ga0310810_10434512 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1338 | Open in IMG/M |
3300034660|Ga0314781_086034 | Not Available | 614 | Open in IMG/M |
3300034661|Ga0314782_011314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1369 | Open in IMG/M |
3300034661|Ga0314782_195191 | Not Available | 522 | Open in IMG/M |
3300034668|Ga0314793_094010 | Not Available | 616 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 8.40% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.56% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.04% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.04% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 5.04% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.20% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.20% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.36% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.36% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.52% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.52% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.68% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.68% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.68% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.68% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.68% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.68% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.68% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.84% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.84% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.84% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.84% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.84% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.84% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.84% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.84% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.84% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011333 | Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300021290 | Switchgrass-associated microbial communities from reclaimed mine lands soil in West Virginia, United States ? Hobet_Cave_2 | Environmental | Open in IMG/M |
3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034661 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300034668 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
soilL1_100402525 | 3300003267 | Sugarcane Root And Bulk Soil | VISQTLKDKPDDRLRAQLRTALTQLILAGLKQPEIKALINEELDELQKIS* |
Ga0058689_101420042 | 3300004016 | Agave | ADKPGDRLRAQLRTALTQLILAGLKQPEIKALINEELEELQKQ* |
Ga0055432_100830711 | 3300004022 | Natural And Restored Wetlands | ISQKLREKPEDRHRVQLRTALTQLVLAGLKGPEIKTMINQELEELLKEPRRSS* |
Ga0063356_1038767781 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TLKEKPDDRLRAQLRTALTQLILAGLKQPEIKTLINEELDELLRPIK* |
Ga0058863_107665801 | 3300004799 | Host-Associated | PEDRLRLQLRTALTQLVLAGLKQPEIKAMINQELEDLMKESRH* |
Ga0058862_120343651 | 3300004803 | Host-Associated | DRLRLQLRTALTQLVLAGLKQPEIKAMINQELEDLMKESRH* |
Ga0065715_109297321 | 3300005293 | Miscanthus Rhizosphere | ASRTLKEKPDDRLRLQLRTALTQLILAGLKQPEIKAIINQELDELLKESRN* |
Ga0070690_1001000263 | 3300005330 | Switchgrass Rhizosphere | SQTVKEKPDDRLRAQLRTALTQLILAGLKQPEIKVIINEELDELLRDSKRG* |
Ga0070666_105559431 | 3300005335 | Switchgrass Rhizosphere | QTVKDKPEDRHRIQLRTALTQLVLAGLKAPEIKAMINQELEELLKEPRRSSPERS* |
Ga0070660_1010588232 | 3300005339 | Corn Rhizosphere | LKDKPDDRLRAQLRTALTQLILAGLKHSEIKTLINEELEELQKQ* |
Ga0070691_101344802 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | REKPDDRLRTQLRTALTQLILAGLKQPEIRTLINEELEELFKAPRQN* |
Ga0070669_1001209041 | 3300005353 | Switchgrass Rhizosphere | LKDKPDDRLRAQLRTALTQLILAGLKQTEIKALINEELEELQKS* |
Ga0070674_1016558441 | 3300005356 | Miscanthus Rhizosphere | LKDKPDDRLRAQLRTALTQLILAGLKQTEIKALINEELEELQKN* |
Ga0070662_1009320692 | 3300005457 | Corn Rhizosphere | ISQKLKDKPDDRLRAQLRTALTQLILSGLKQTEIKALINEELEELQKS* |
Ga0068867_1013812131 | 3300005459 | Miscanthus Rhizosphere | GAVVISQKLKDKPDDRLRAQLRTALTQLILAGLKHTEIKALINEELEELQKN* |
Ga0070697_1008634431 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VISQTLKEKPDDRLRAQLRTALTQLILSGLKHPEIRTLVNEELDELLKEPRRNA* |
Ga0070672_1009160021 | 3300005543 | Miscanthus Rhizosphere | RTALTQLILAGLKQPEIKTLINEELDELLKEPRRTSY* |
Ga0070695_1010344142 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | QIVKQKPEDGLRNQLRTALTQLVLAGLKPSEIKGLISEELDELLKESKRVG* |
Ga0070693_1012198652 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | KPEDRHRVQLRTALTQLVLAGLKAPEIKAMINQELEELLKEPRRSSPERS* |
Ga0068855_1005165212 | 3300005563 | Corn Rhizosphere | ALTQLVLAGLKAPEIKAMINQELEELLNEPRRSSPERS* |
Ga0070664_1001729463 | 3300005564 | Corn Rhizosphere | AQLRTALTQLILAGLKHSEIKALINEELEELQKQ* |
Ga0068854_1003764122 | 3300005578 | Corn Rhizosphere | VISQTLKDKPDDRLRAQLRTALTQLILAGLKQPEIKALINEELEELQKQ* |
Ga0068854_1010835772 | 3300005578 | Corn Rhizosphere | RVQLRTALTQLVLAGLKAPEIKAMINQELEELLKEPRRSSPERS* |
Ga0068854_1018422821 | 3300005578 | Corn Rhizosphere | EKPDERLRTQLRTALTQLILAGLKQSEIKALINEELEELTKI* |
Ga0068856_1017379741 | 3300005614 | Corn Rhizosphere | KPDERLRAQLRTALTQLILAGLKQPEIEALINEELDGLLKETGRG* |
Ga0068859_1008923501 | 3300005617 | Switchgrass Rhizosphere | VISQTLTEKPDDRLRAQLRTALTQLILAGLKPPEIRTLINEELDELLKAPRPN* |
Ga0068859_1016785482 | 3300005617 | Switchgrass Rhizosphere | VVISQTLKDKPDDRLRAQLRTALTQLILAGLKQPEIKALINEELEELQKQ* |
Ga0068864_1010585651 | 3300005618 | Switchgrass Rhizosphere | TLKDKPDDRLRAQLRTALTQLILAGLKQPEIKALINEELDELLKETRRGQ* |
Ga0068861_1026147561 | 3300005719 | Switchgrass Rhizosphere | DDRLRAQLRTALTQLILAGLKQPEIKALINEELEELQKQ* |
Ga0074472_107713371 | 3300005833 | Sediment (Intertidal) | EKPQDRLRAQLRTALTQLVLAGLKQPEIKALIQEELDELLRESRRPSGTRA* |
Ga0068851_104843622 | 3300005834 | Corn Rhizosphere | PDDRLRAQLRTALTQLLLAGLKHSEIKALINEELEELQKQ* |
Ga0068870_105143621 | 3300005840 | Miscanthus Rhizosphere | PDERLRAQLRTALTQLILAGLKQPEIKALINEELDELLRPIK* |
Ga0068858_1014154391 | 3300005842 | Switchgrass Rhizosphere | AVVISQTVQQKPEDGLRNQLRTALTQLVLSGLKPSEIKGLISEELDELLRASKKIG* |
Ga0068858_1014406802 | 3300005842 | Switchgrass Rhizosphere | ENNQEDRLRAQLRTALTQLVLAGLKQPEIKALINEELDELLRESRRA* |
Ga0068862_1014290832 | 3300005844 | Switchgrass Rhizosphere | DRLRAQLRTALTQLILAGLKHSEIKALINEELEELQKQ* |
Ga0082029_13402331 | 3300006169 | Termite Nest | LRTALTQLILSGLKPPEIKTLINEELDELLHDTRR* |
Ga0070716_1012828881 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | DERLRAQLRTALTQLILAGLKQPEIKALINEELDELLKESRRG* |
Ga0075421_1007277111 | 3300006845 | Populus Rhizosphere | VVISQTLREKPDDRLRTQLRTALAQLILAGLKPPEIRTLINEELEELLKAPRQN* |
Ga0075431_1006824302 | 3300006847 | Populus Rhizosphere | ISQTLKEKPDDRLRAQLRTALTQLILSGLKPPEIKTLINEELDELLKSP* |
Ga0075433_101040391 | 3300006852 | Populus Rhizosphere | KPDDRLRAQLRTALTQLILAGLKQSEIKTLINEELDELLRETR* |
Ga0075433_115341192 | 3300006852 | Populus Rhizosphere | DERLRAQLRTALTQLILAGLKPPEIKTLINEELDELLRPS* |
Ga0075433_117089321 | 3300006852 | Populus Rhizosphere | KDKPDDRLRAQLRTALTQLILAGLKQSEIKTLINEELDELLRESR* |
Ga0075425_1014680522 | 3300006854 | Populus Rhizosphere | SQTLREKPEDRLRLQLRTALTQLILAGLKQPEIKAMINQELEDLMKDSRP* |
Ga0075425_1031291602 | 3300006854 | Populus Rhizosphere | VVISQTLKEKPDERLRTQLRTALTQLILAGLKQSEIKALINEELEELTKA* |
Ga0068865_1020252302 | 3300006881 | Miscanthus Rhizosphere | QLRTALTQLILAGLKQPEIKAIINEEMEELLREPRRA* |
Ga0079219_118356202 | 3300006954 | Agricultural Soil | RTALTQLILAGLKPPEIRTLINEELEELFKAPRQN* |
Ga0079219_121004372 | 3300006954 | Agricultural Soil | RLRAQLRTALTQLILAGLKQPEIKALINEELDELLKENRRGL* |
Ga0079218_100510904 | 3300007004 | Agricultural Soil | DDRLRAQLRTALTQLILAGLKQPEIRALINEELDELLKESRRNSPAT* |
Ga0105251_102426993 | 3300009011 | Switchgrass Rhizosphere | DHRLRAQLRTALTQLILAGLKHSEIKTLINEELEELQKQ* |
Ga0105245_114557122 | 3300009098 | Miscanthus Rhizosphere | ISQTLREKPEDRLRLQLRTALTQLILAGLKQPEIKAMINQELEDLMKDSRP* |
Ga0075418_112553021 | 3300009100 | Populus Rhizosphere | EKPDERLRTQLRTALTQLILAGLKYPEIKTLINEELDELLKESR* |
Ga0105241_102850472 | 3300009174 | Corn Rhizosphere | RAQLRTALTQLILAGLKQPEITSLINEELDELLKESRRTG* |
Ga0105241_115064391 | 3300009174 | Corn Rhizosphere | DRLRAQLRTALTQLVLAGLKQPEIKALINEELDELLRESRRA* |
Ga0105248_103862553 | 3300009177 | Switchgrass Rhizosphere | RTQLRTALAQLILVGLKPPEIRTLINEELEELFKAPRQN* |
Ga0105248_109340332 | 3300009177 | Switchgrass Rhizosphere | QTLREKPEDRLRLQLRTALTQLILAGLKQPEIKAMIKQELEDLMKDSRP* |
Ga0105237_114504841 | 3300009545 | Corn Rhizosphere | KDKPDDRLRAQLRTALTQLILAGLKQTEIKALINEELEELQKS* |
Ga0105237_126646151 | 3300009545 | Corn Rhizosphere | KDKPDDRLRAQLRTALTQLILAGLKHSEIKALINEELEELQKQ* |
Ga0105249_134507541 | 3300009553 | Switchgrass Rhizosphere | TALTQLVLAGLKQPEIKALINEELDELLRESRRA* |
Ga0126305_110870842 | 3300010036 | Serpentine Soil | RAQLRTALTQLILAGLKPPEIRTLINEELDELLKPT* |
Ga0126315_103329632 | 3300010038 | Serpentine Soil | LRTQLRTALTQLILAGLKPPEIRTLINEELDELLKPS* |
Ga0126377_129675831 | 3300010362 | Tropical Forest Soil | QTLKEKPDERLRTQLRTALTQLILAGLKQSEIKALINEELDELLKEPRRIG* |
Ga0134128_110644002 | 3300010373 | Terrestrial Soil | VISQTLKEKPDDRLRAQIRTALTQLILAGLKPAEIRTIINEELDELRL* |
Ga0105239_102426153 | 3300010375 | Corn Rhizosphere | LKDKPDDRLRAQLRTALTQLILAGLKHTEIKTLINEELEELQKN* |
Ga0105239_130052332 | 3300010375 | Corn Rhizosphere | VISQTLREKPEDRLRVQLRTALTQLVLAGLKQPEIKVMINQELEDLMKDSRP* |
Ga0134122_125099331 | 3300010400 | Terrestrial Soil | LRTALTQLILAGLKQPEIKAMINQELEDLMKDSRP* |
Ga0134123_100992713 | 3300010403 | Terrestrial Soil | SQTLGTNQEDRLRSQLRTALTQLVLAGLKQPEIKALINEELDDLLKESRRT* |
Ga0105246_103190581 | 3300011119 | Miscanthus Rhizosphere | AVVISQTLKDKPDDRLRAQLRTALTQLILAGLKHTEIKTLINEELEELQKN* |
Ga0126317_108476251 | 3300011332 | Soil | QLRTALTQLILAGLKQPEIKAIINEEMEELLRESRRA* |
Ga0127502_103599251 | 3300011333 | Soil | RLRTQLRTALTQLILAGLKPPEIRILINEEFEELLKAPRQN* |
Ga0137399_114704041 | 3300012203 | Vadose Zone Soil | LRSQLRTALTQLVLAGFKRPEIKALINEELESLLRDQP* |
Ga0150985_1047227212 | 3300012212 | Avena Fatua Rhizosphere | DRLRAQLRTALTQLILSGLKPPEIRTLINEELDELLKPS* |
Ga0150985_1206475211 | 3300012212 | Avena Fatua Rhizosphere | DDRLRAQLRTALTQLILAGLKHSEIKALINEELEELQKQ* |
Ga0126375_105358152 | 3300012948 | Tropical Forest Soil | TLEEKPEDRLRAQLRTALTQLILAGLKQAEIKAVINEELDDLLNNSRNSVR* |
Ga0126375_120230831 | 3300012948 | Tropical Forest Soil | LRAQLRTALTQLVLAGLKQPEIKALINEELDELLMESRRT* |
Ga0164309_108787291 | 3300012984 | Soil | EDRLRLQLRTALTQLVLAGLKQPEIKAMINQELEDLVKDSRH* |
Ga0164305_105885212 | 3300012989 | Soil | DKPDDRLRAQLRTALTQLILAGLKQPEIKALINEELDELLKENRRGQ* |
Ga0163162_134278551 | 3300013306 | Switchgrass Rhizosphere | HRIQLRTALTQLVLAGLKAPEIKAMINQELEELLKEPRRSSPERS* |
Ga0075324_10176842 | 3300014263 | Natural And Restored Wetlands | TQLVLAGLKQPEIRALINEELDELLNEPRRTPHHN* |
Ga0075313_12213881 | 3300014267 | Natural And Restored Wetlands | DDRLRTQLRTALTQLILAGLKPPEIRTLINEELDELFKAPRQN* |
Ga0163163_122284981 | 3300014325 | Switchgrass Rhizosphere | ISQKLKDKPDDRLRAQLRTALTQLILAGLKQTEIKALINEELEELQKS* |
Ga0182007_100861861 | 3300015262 | Rhizosphere | LRAQLRTALTQLTLSGLKQSEIKALINEELDELTRQKSA* |
Ga0132256_1013795701 | 3300015372 | Arabidopsis Rhizosphere | TLKEKPDDRLRAQLRTALTQLILAGLKQPEIKALINEELDELVKEKPRTNTEGHR* |
Ga0132257_1000568295 | 3300015373 | Arabidopsis Rhizosphere | DDRLRAQLRTALTQLILAGLKQPEIKALINAELDDLLKDAKRAG* |
Ga0132257_1028715101 | 3300015373 | Arabidopsis Rhizosphere | DKPEDRHRIQLRTALTQLVLAGLKAPEIKAMINQELEELLKEPRRSSPERS* |
Ga0184628_105078201 | 3300018083 | Groundwater Sediment | REKPDDRLRAQLRTALTQLILAGLKQPEIKAIINEEMEELLRESRRA |
Ga0190265_133045131 | 3300018422 | Soil | KPDDRLRAQLRTALTQLILSGLKPPEIKTLINEELDELLKVP |
Ga0213902_1064461 | 3300021290 | Soil | VISQTLKDKPDDRLRAQLRTALTQLILAGLKPPEIKSLINEELDELLKESRR |
Ga0210113_11112542 | 3300025796 | Natural And Restored Wetlands | TLKEKPDDRLRTQLRTALTQLILAGLKPPEIRTLINEELDELLKEPRRIL |
Ga0207680_100912123 | 3300025903 | Switchgrass Rhizosphere | LRAQLRTALTQLILAGLKQPEIKVMINEELDELLRDSKRG |
Ga0207680_101865901 | 3300025903 | Switchgrass Rhizosphere | QTVQQKPEDGLRNQLRTALTQLVLSGLKPSEIKGLISEELDELLRASKKIG |
Ga0207660_104013121 | 3300025917 | Corn Rhizosphere | RTALTQLILAGLKQPEIRTLINEELEELFKAPRQN |
Ga0207649_115398032 | 3300025920 | Corn Rhizosphere | VVISQKLKDKPDDRLRAQLRTALTQLILAGLKQTEIKALINEELEELQKQ |
Ga0207650_119023392 | 3300025925 | Switchgrass Rhizosphere | AVVVSQTLSEKPDDRLRVQLRTALAQLVLAGLKPSEIKVIINQEMEELLRRSS |
Ga0207690_107786252 | 3300025932 | Corn Rhizosphere | EDRLRLQLRTALTQLILAGLKQPEIKAMINQELEDLMKDSRP |
Ga0207706_104680572 | 3300025933 | Corn Rhizosphere | QQKPEDGLRNQLRTALTQLVLSGLKPSEIKGLISEALDELLRASKKIG |
Ga0207691_100097971 | 3300025940 | Miscanthus Rhizosphere | LRAQLRTALTQLILAGLKQPEIKVMINEELDELLRDSKRA |
Ga0207711_106466793 | 3300025941 | Switchgrass Rhizosphere | RLRTQLRTALTQLILAGLKPPEIRTLINEELEELFKAPRQN |
Ga0207640_109098712 | 3300025981 | Corn Rhizosphere | TVKNKPEDRHRVQLRTALTQLVLAGLKAPEIKAMINQELEELLKEPRRSSPERS |
Ga0207640_110851252 | 3300025981 | Corn Rhizosphere | EKPDDRLRAQLRTALTQLILSGLKPPEIKTLINEELDELLNEPRR |
Ga0207703_103689622 | 3300026035 | Switchgrass Rhizosphere | RAQLRTALTQLILAGLKHSEIKALINEELEELQKQ |
Ga0207639_111052172 | 3300026041 | Corn Rhizosphere | SQTLREKPDDRLRAQLRTALTQLILSGLKPPEIKTLINEELDELLNEPRR |
Ga0207708_108897132 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VVISQKLKDKPDDRLRAQLRTALTQLILAGLKQTEIKALINEELEELQKS |
Ga0207648_117431531 | 3300026089 | Miscanthus Rhizosphere | KQKPEDGLRNQLRTALTQLVLAGLKPSEIKGLISEELDELLKESKRVG |
Ga0207674_120407021 | 3300026116 | Corn Rhizosphere | EDRLRVQLRTALTQLILAGLKQPEIKAMINQELEDLMKDSRP |
Ga0256867_100249191 | 3300026535 | Soil | TALTQLILAGLKHPEIKTLINEELDELLKEPRRSLQA |
Ga0209486_106695931 | 3300027886 | Agricultural Soil | LTQLILAGLKQPEIRALINEELDELLKESRRNSPAT |
Ga0209382_108945951 | 3300027909 | Populus Rhizosphere | ISQTLKEKPDDRLRAQLRTALTQLILSGLKPPEIKTLINEELDELLKSP |
Ga0268265_118369551 | 3300028380 | Switchgrass Rhizosphere | RLRAQLRTALTQLILAGLKQTEIKALINEELEELQKN |
Ga0307405_106832332 | 3300031731 | Rhizosphere | KPDDRLRAQLRTALTQLILAGLKQPEIKTLINEELDELLRPMK |
Ga0310904_113595651 | 3300031854 | Soil | ISQTVKEKPDDRLRAQLRTALTQLILAGLKQPEIKVMINEELDELLRDSKRG |
Ga0307406_103588461 | 3300031901 | Rhizosphere | AQLRTALTQLILSGLKPPEIKTLINEELDELLNEPRR |
Ga0310901_101137121 | 3300031940 | Soil | LGTNQEDRLRSQLRTALTQLVLAGLKQPEIKTLINEELDDLLKESRRT |
Ga0310897_100523111 | 3300032003 | Soil | TLREKPDDRLRTQLRTALTQLILAGLKQPEIRTLINEELEELFKAPRQN |
Ga0310906_100444351 | 3300032013 | Soil | SQLRTALTQLVLAGLKQPEIKTLINEELDDLLKESRRT |
Ga0310810_104345122 | 3300033412 | Soil | VVISQTLKDKPDERLRAQLRTALTQLTLSGLKQSEIKALINEELDELTRQKSA |
Ga0314781_086034_13_135 | 3300034660 | Soil | LRAQLRTALTQLILAGLKPPEIRTLINEELEELFKAPRQI |
Ga0314782_011314_1253_1369 | 3300034661 | Soil | RAQLRTALTQLILAGLKQSEIKALINEELDELIRQKSA |
Ga0314782_195191_3_140 | 3300034661 | Soil | PDDRLRAQLRTALTQLILAGLKQPEIKSLINEELDELLKESRRTG |
Ga0314793_094010_3_140 | 3300034668 | Soil | KPDDRLRTQLRTALTQLILAGLKQPEIRTLINEELEELFKAPRQN |
⦗Top⦘ |