Basic Information | |
---|---|
Family ID | F075365 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 119 |
Average Sequence Length | 41 residues |
Representative Sequence | LAADASAILLEGLKVLAWYFLSPDMFRSEATDTRMGSGSA |
Number of Associated Samples | 104 |
Number of Associated Scaffolds | 119 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.84 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 92.44 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.38 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (56.303 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (14.286 % of family members) |
Environment Ontology (ENVO) | Unclassified (15.966 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.420 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 119 Family Scaffolds |
---|---|---|
PF00011 | HSP20 | 3.36 |
PF07369 | DUF1488 | 1.68 |
PF04542 | Sigma70_r2 | 1.68 |
PF00665 | rve | 1.68 |
PF00313 | CSD | 1.68 |
PF03401 | TctC | 0.84 |
PF00756 | Esterase | 0.84 |
PF07568 | HisKA_2 | 0.84 |
PF08281 | Sigma70_r4_2 | 0.84 |
PF13439 | Glyco_transf_4 | 0.84 |
PF00027 | cNMP_binding | 0.84 |
PF13565 | HTH_32 | 0.84 |
PF04226 | Transgly_assoc | 0.84 |
PF07045 | DUF1330 | 0.84 |
PF05013 | FGase | 0.84 |
PF01381 | HTH_3 | 0.84 |
PF13546 | DDE_5 | 0.84 |
PF07719 | TPR_2 | 0.84 |
PF01068 | DNA_ligase_A_M | 0.84 |
COG ID | Name | Functional Category | % Frequency in 119 Family Scaffolds |
---|---|---|---|
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 3.36 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.68 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.68 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.68 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 1.68 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 1.68 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 1.68 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 1.68 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.68 |
COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 0.84 |
COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 0.84 |
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.84 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.84 |
COG3741 | N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.84 |
COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.84 |
COG3931 | Predicted N-formylglutamate amidohydrolase | Amino acid transport and metabolism [E] | 0.84 |
COG5470 | Uncharacterized conserved protein, DUF1330 family | Function unknown [S] | 0.84 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 56.30 % |
All Organisms | root | All Organisms | 43.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459007|GKWS7RC02JIYIH | Not Available | 503 | Open in IMG/M |
3300000443|F12B_10840939 | Not Available | 811 | Open in IMG/M |
3300001081|JGI12662J13196_1000155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2907 | Open in IMG/M |
3300001545|JGI12630J15595_10030244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1121 | Open in IMG/M |
3300001545|JGI12630J15595_10084606 | Not Available | 623 | Open in IMG/M |
3300001867|JGI12627J18819_10169373 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 886 | Open in IMG/M |
3300002906|JGI25614J43888_10042804 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1401 | Open in IMG/M |
3300002911|JGI25390J43892_10013687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1914 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10008658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3236 | Open in IMG/M |
3300004080|Ga0062385_10592039 | Not Available | 700 | Open in IMG/M |
3300004092|Ga0062389_104249163 | Not Available | 539 | Open in IMG/M |
3300005160|Ga0066820_1002532 | Not Available | 900 | Open in IMG/M |
3300005166|Ga0066674_10470964 | Not Available | 570 | Open in IMG/M |
3300005178|Ga0066688_10731253 | Not Available | 625 | Open in IMG/M |
3300005364|Ga0070673_100108254 | Not Available | 2301 | Open in IMG/M |
3300005364|Ga0070673_101562075 | Not Available | 623 | Open in IMG/M |
3300005468|Ga0070707_100907777 | Not Available | 845 | Open in IMG/M |
3300005468|Ga0070707_101795614 | Not Available | 580 | Open in IMG/M |
3300005518|Ga0070699_100581548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 1020 | Open in IMG/M |
3300005535|Ga0070684_100861838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 848 | Open in IMG/M |
3300005536|Ga0070697_101025993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 733 | Open in IMG/M |
3300005546|Ga0070696_101407851 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300005559|Ga0066700_11026605 | Not Available | 542 | Open in IMG/M |
3300005610|Ga0070763_10552205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 664 | Open in IMG/M |
3300005615|Ga0070702_100444436 | Not Available | 939 | Open in IMG/M |
3300006057|Ga0075026_100294818 | Not Available | 883 | Open in IMG/M |
3300006059|Ga0075017_100676751 | Not Available | 793 | Open in IMG/M |
3300006059|Ga0075017_101492277 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300006086|Ga0075019_10262799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1032 | Open in IMG/M |
3300006163|Ga0070715_10509115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 691 | Open in IMG/M |
3300006163|Ga0070715_10511004 | Not Available | 689 | Open in IMG/M |
3300006173|Ga0070716_100880192 | Not Available | 700 | Open in IMG/M |
3300006174|Ga0075014_100027349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2266 | Open in IMG/M |
3300006174|Ga0075014_100797199 | Not Available | 558 | Open in IMG/M |
3300006175|Ga0070712_101747909 | Not Available | 544 | Open in IMG/M |
3300006176|Ga0070765_102086779 | Not Available | 530 | Open in IMG/M |
3300006354|Ga0075021_11061397 | Not Available | 529 | Open in IMG/M |
3300006794|Ga0066658_10613784 | Not Available | 593 | Open in IMG/M |
3300006800|Ga0066660_10393659 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1141 | Open in IMG/M |
3300006844|Ga0075428_102390332 | Not Available | 543 | Open in IMG/M |
3300009098|Ga0105245_10236859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1768 | Open in IMG/M |
3300009098|Ga0105245_12946411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 528 | Open in IMG/M |
3300009100|Ga0075418_11550823 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300009147|Ga0114129_12117132 | Not Available | 678 | Open in IMG/M |
3300009176|Ga0105242_12661509 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300010303|Ga0134082_10331586 | Not Available | 642 | Open in IMG/M |
3300010343|Ga0074044_11074992 | Not Available | 527 | Open in IMG/M |
3300010373|Ga0134128_12994011 | Not Available | 520 | Open in IMG/M |
3300011269|Ga0137392_10698299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 840 | Open in IMG/M |
3300012350|Ga0137372_11217460 | Not Available | 507 | Open in IMG/M |
3300012356|Ga0137371_10980325 | Not Available | 642 | Open in IMG/M |
3300012925|Ga0137419_11678247 | Not Available | 542 | Open in IMG/M |
3300012930|Ga0137407_11921250 | Not Available | 564 | Open in IMG/M |
3300012951|Ga0164300_10367293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 779 | Open in IMG/M |
3300012955|Ga0164298_10834226 | Not Available | 663 | Open in IMG/M |
3300012957|Ga0164303_11092838 | Not Available | 575 | Open in IMG/M |
3300012957|Ga0164303_11477051 | Not Available | 512 | Open in IMG/M |
3300012958|Ga0164299_10556366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 775 | Open in IMG/M |
3300012985|Ga0164308_11413529 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300012989|Ga0164305_11211537 | Not Available | 655 | Open in IMG/M |
3300014156|Ga0181518_10206898 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1017 | Open in IMG/M |
3300014158|Ga0181521_10456417 | Not Available | 619 | Open in IMG/M |
3300015358|Ga0134089_10575781 | Not Available | 501 | Open in IMG/M |
3300015371|Ga0132258_13757052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1035 | Open in IMG/M |
3300015374|Ga0132255_103720176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
3300016387|Ga0182040_11659460 | Not Available | 545 | Open in IMG/M |
3300017822|Ga0187802_10130007 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300018017|Ga0187872_10454951 | Not Available | 535 | Open in IMG/M |
3300018067|Ga0184611_1149305 | Not Available | 827 | Open in IMG/M |
3300018431|Ga0066655_11199958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 538 | Open in IMG/M |
3300018433|Ga0066667_12076165 | Not Available | 525 | Open in IMG/M |
3300020579|Ga0210407_10277194 | Not Available | 1308 | Open in IMG/M |
3300020581|Ga0210399_10069505 | Not Available | 2850 | Open in IMG/M |
3300021168|Ga0210406_10291873 | Not Available | 1328 | Open in IMG/M |
3300021168|Ga0210406_10757989 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300021168|Ga0210406_11078632 | Not Available | 592 | Open in IMG/M |
3300021168|Ga0210406_11088219 | Not Available | 589 | Open in IMG/M |
3300021171|Ga0210405_10678006 | Not Available | 798 | Open in IMG/M |
3300021178|Ga0210408_10511351 | Not Available | 954 | Open in IMG/M |
3300021178|Ga0210408_10990061 | Not Available | 651 | Open in IMG/M |
3300021181|Ga0210388_11594723 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 543 | Open in IMG/M |
3300021181|Ga0210388_11648686 | Not Available | 532 | Open in IMG/M |
3300021420|Ga0210394_11031243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
3300021432|Ga0210384_11719792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
3300021474|Ga0210390_11108432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 643 | Open in IMG/M |
3300025320|Ga0209171_10482795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
3300025477|Ga0208192_1092707 | Not Available | 548 | Open in IMG/M |
3300025898|Ga0207692_11078831 | Not Available | 531 | Open in IMG/M |
3300025905|Ga0207685_10312058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 782 | Open in IMG/M |
3300025905|Ga0207685_10452108 | Not Available | 668 | Open in IMG/M |
3300025908|Ga0207643_11058961 | Not Available | 524 | Open in IMG/M |
3300025910|Ga0207684_10518306 | Not Available | 1021 | Open in IMG/M |
3300025915|Ga0207693_11080887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 610 | Open in IMG/M |
3300025931|Ga0207644_10609326 | Not Available | 907 | Open in IMG/M |
3300025933|Ga0207706_10911185 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
3300025939|Ga0207665_10520224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 921 | Open in IMG/M |
3300025939|Ga0207665_10873437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 713 | Open in IMG/M |
3300026297|Ga0209237_1047279 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2192 | Open in IMG/M |
3300026300|Ga0209027_1128158 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
3300026328|Ga0209802_1265781 | Not Available | 578 | Open in IMG/M |
3300026515|Ga0257158_1100283 | Not Available | 572 | Open in IMG/M |
3300026552|Ga0209577_10239459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1374 | Open in IMG/M |
3300026557|Ga0179587_10125465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1579 | Open in IMG/M |
3300027273|Ga0209886_1001697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 2842 | Open in IMG/M |
3300027641|Ga0208827_1187997 | Not Available | 555 | Open in IMG/M |
3300027667|Ga0209009_1018585 | Not Available | 1681 | Open in IMG/M |
3300027846|Ga0209180_10482478 | Not Available | 696 | Open in IMG/M |
3300027894|Ga0209068_10689088 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300027908|Ga0209006_10117134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2355 | Open in IMG/M |
3300027910|Ga0209583_10108587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1080 | Open in IMG/M |
3300028906|Ga0308309_10575586 | Not Available | 977 | Open in IMG/M |
3300029636|Ga0222749_10774267 | Not Available | 525 | Open in IMG/M |
3300031231|Ga0170824_119747149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseicella → unclassified Roseicella → Roseicella sp. DB1501 | 863 | Open in IMG/M |
3300031474|Ga0170818_101368012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 872 | Open in IMG/M |
3300031573|Ga0310915_10064229 | All Organisms → cellular organisms → Bacteria | 2402 | Open in IMG/M |
3300031708|Ga0310686_111952557 | Not Available | 1333 | Open in IMG/M |
3300031719|Ga0306917_10287461 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
3300031754|Ga0307475_11418688 | Not Available | 535 | Open in IMG/M |
3300031910|Ga0306923_11657540 | Not Available | 662 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 14.29% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 7.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.72% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.04% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.52% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.52% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.52% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.52% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.52% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.68% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.68% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.68% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.84% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.84% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.84% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.84% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.84% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.84% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.84% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.84% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.84% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.84% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.84% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.84% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.84% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.84% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.84% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.84% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025477 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
L02_04025920 | 2170459007 | Grass Soil | ASAILLAELQVLAWYFLSPDMLRSEDTDTRMGSGSAR |
F12B_108409391 | 3300000443 | Soil | AILLAALQVLAWYFLSPDMFRSETTDTLMGSGSAS* |
JGI12662J13196_10001554 | 3300001081 | Forest Soil | AIRLARLKVIARYVLSPDMFRSEATDTRMGSDSAS* |
JGI12630J15595_100302443 | 3300001545 | Forest Soil | RLAADASAILLAGLKVIAWYFLSLDMFRSEATDTRMGSGSGS* |
JGI12630J15595_100846062 | 3300001545 | Forest Soil | ADGSAILLAELKVIAWYFLSPDIFWSEATDTRMGSGSAS* |
JGI12627J18819_101693731 | 3300001867 | Forest Soil | AADASAILLAALKVLAWYFLSPDMFRSETTDTRTGSGLAN* |
JGI25614J43888_100428041 | 3300002906 | Grasslands Soil | AADASAILLAGLKALAWYFLSPDMFRSEAADTLMGSGSAS* |
JGI25390J43892_100136874 | 3300002911 | Grasslands Soil | LAADASAILLAALKVLAWYFLSPDMFRSETTDTRTGSGSAN* |
JGIcombinedJ51221_100086584 | 3300003505 | Forest Soil | SLQWHRRLRLAADASAILLEGLKVLAWYILSPDIFRSEVTDTRMGSG* |
Ga0062385_105920391 | 3300004080 | Bog Forest Soil | LAADASAILLEGLKVLAWYFLSPDMFRSEATDTRMGSGSA* |
Ga0062389_1042491631 | 3300004092 | Bog Forest Soil | ADASAIPLEELKALAWYFLSPDMVRSEATDTRMGFRFSLIEDPPW* |
Ga0066820_10025321 | 3300005160 | Soil | AADASAILLPALKVLAWYFLSPDISRSEAAETRRGSDFRA* |
Ga0066674_104709641 | 3300005166 | Soil | LRLAADASAILLAALKVLAWYFLSPDMFRSETTDTLMGFGSAS* |
Ga0066688_107312531 | 3300005178 | Soil | RLRLAADASAILLAALKVLAWYFLSPDMFRSETTDTLMGSGSAS* |
Ga0070673_1001082545 | 3300005364 | Switchgrass Rhizosphere | LRLAADASAILLEGLKVLAWYILSPDTFRSEVTDTRMGSGSA* |
Ga0070673_1015620752 | 3300005364 | Switchgrass Rhizosphere | HLRLRLAADASAILLEELKVLAWYILSPDMFRGEVTDTRMGSG* |
Ga0070707_1009077771 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | QRLRLAADASAILLAALKVLAWYFLSPDMFRSETTNTLMGSGSAS* |
Ga0070707_1017956142 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RHQRLRLAADASAILLAALKVLAWYFLSPDMFRSEATDTLMGSGSAS* |
Ga0070699_1005815481 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | AADASAILLAALKVLAWYFLSPDMFRSETTNTLMGSGSAS* |
Ga0070684_1008618381 | 3300005535 | Corn Rhizosphere | RLRLAADASAILLEEVKVLAWYILSPDICRSEVTDTRMGSG* |
Ga0070697_1010259932 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRHRREARSRRLAADASAIRLAALKVIACYFLSPDMFRSETTDT |
Ga0070696_1014078513 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | RLRLAADASAILLAGLKVIARYFLSPDMFRSEATDTRMGSGSAS* |
Ga0066700_110266052 | 3300005559 | Soil | AILLAALKVLAWYFLSPDMFRSEATDTLMGSGSAS* |
Ga0070763_105522051 | 3300005610 | Soil | ASAILLEGLKVLAWHILSPDMLRSEAADTRMGSGSA* |
Ga0070702_1004444361 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | HRRLRLAADASAILLEGLKVLAWYILSPDTFRSEVTDTRMGSGSA* |
Ga0075026_1002948181 | 3300006057 | Watersheds | SAILLEGLKVLAWYFLSPDMFRSEATDTRMGSDSA* |
Ga0075017_1006767511 | 3300006059 | Watersheds | RLAADVSAILLEGLKVLAWYFLSPDMFRSEVTDTRMGSGSA* |
Ga0075017_1014922771 | 3300006059 | Watersheds | STILLEGLKVFAWYILSPDMFRSEATDTRMGSRFSLN* |
Ga0075019_102627991 | 3300006086 | Watersheds | ASAILLEGLKVLAWYFLSPDLFQSQATDTRMGSDST* |
Ga0070715_105091151 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | AILLAGLKVLAWYFLSPDMFRSEATDTLMGSGSAS* |
Ga0070715_105110042 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLRLAADASAILLAALKVLAWYFLSPDMFRSETTDTLMGSGLAN* |
Ga0070716_1008801922 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RLRLAADGSAILLAGLKVIAWYFLSLDMFRSEPTDTRMGSGSAS* |
Ga0075014_1000273494 | 3300006174 | Watersheds | SAILLEGLKALAWYFLSPDMFRSEATDTRMGSGSA* |
Ga0075014_1007971991 | 3300006174 | Watersheds | ASAILLEGLKVLAWYILSPDMYRSEVTDTRMGFRFSLN* |
Ga0070712_1017479092 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | HRRLRLAADASAILLAELQVLAWYFLSPDMFRSEDTGTRMGSGSAS* |
Ga0070765_1020867791 | 3300006176 | Soil | LHPAADASAILLEGLKVLAWYVLSPDMFRSEATDTRLGFRFSLN* |
Ga0075021_110613972 | 3300006354 | Watersheds | LAANASAILLEGLKVLAWYFLSPDMFRSEATDTRMGSGSA* |
Ga0066658_106137842 | 3300006794 | Soil | SAILLAELQVLAWYFLSPDMFSNEATDTRMGSGSA* |
Ga0066660_103936592 | 3300006800 | Soil | LRLAADASAILLAELQVLAWYFLSPDMFRSETTDTRTGSGLAN* |
Ga0075428_1023903322 | 3300006844 | Populus Rhizosphere | PHLAPDASAILLRALKAFAWYVLSPDMLRSEVTDTRTGSGFID* |
Ga0105245_102368593 | 3300009098 | Miscanthus Rhizosphere | SAILLGGLKVFARCILSPDVFRSEAAETRMGSGREGNFC* |
Ga0105245_129464111 | 3300009098 | Miscanthus Rhizosphere | ADASAILLEEMKVLAWFILSPDICRSEVTDTRMGSG* |
Ga0075418_115508232 | 3300009100 | Populus Rhizosphere | LRLAADASAILLAELQVLAWYFLSPDMLRREDTDTRMGSDSAR* |
Ga0114129_121171321 | 3300009147 | Populus Rhizosphere | RLRLAADASAILLAGLQVLAWYFLSPDMFRSDATDTLMGSGSAS* |
Ga0105242_126615092 | 3300009176 | Miscanthus Rhizosphere | RHRRLRLAADASAILLAELQVLAWYFLSPDMFRSETTDTLMGSGSAS* |
Ga0134082_103315861 | 3300010303 | Grasslands Soil | TSLQRHRRLRLAADALEILLEGLKVLARYFLSPDMFRSEATDTRMGAGSA* |
Ga0074044_110749921 | 3300010343 | Bog Forest Soil | LRLAADASAILLEALKALAWYFLSPDMFRSDAAGTRMGSDTA* |
Ga0134128_129940112 | 3300010373 | Terrestrial Soil | AIRFAELQVLARCILSPDMRRSEDTDTRMGSGSAG* |
Ga0137392_106982992 | 3300011269 | Vadose Zone Soil | LRLAADASAILLAELQVLAWYFLSPDMFRSETTDTLMGSDSAS* |
Ga0137372_112174601 | 3300012350 | Vadose Zone Soil | RLAADASAILLGGLKVLAWYFLSPDIFRSEVTDTRMGAGSAS* |
Ga0137371_109803251 | 3300012356 | Vadose Zone Soil | RLRLAADASAILLAALKVLAWYFLSPDMFRSETTDTLMGSGSAN* |
Ga0137419_116782473 | 3300012925 | Vadose Zone Soil | RLRLAADASAILLLALKAFAWHFLSPDMFRSEATDTLMGSGSAS* |
Ga0137407_119212501 | 3300012930 | Vadose Zone Soil | AIRLAALKVIACYFLSPDMFRSETTDTRTGSGSAN* |
Ga0164300_103672932 | 3300012951 | Soil | ADASAILLEGLKVLAWYVLSPDMFRSEATDTRLGFRFSLN* |
Ga0164298_108342261 | 3300012955 | Soil | AILLPALKVLAWHFLSPDISRSEAAETRRGSDFRA* |
Ga0164303_110928381 | 3300012957 | Soil | LRRHRRRLLAVDASAILLAALKVLARRFLSPDMFRSEATDTRMGSGSAG* |
Ga0164303_114770512 | 3300012957 | Soil | LAADASAILLAGLKALAWYFLSPDMFRSEATDTLMGSGSAS* |
Ga0164299_105563661 | 3300012958 | Soil | HRRLRLAADASAILFAELQGLAWCFLSPDMRRSEDTDTRMGSGSAR* |
Ga0164308_114135291 | 3300012985 | Soil | ASTILLEGLKVFAWYVLSPDMFRSEATDTRMGSGSA* |
Ga0164305_112115372 | 3300012989 | Soil | HRRLRLAADASAILLAELQVLAWYFLSPDMFRSETTDTLMGSGSAS* |
Ga0181518_102068981 | 3300014156 | Bog | RLAADASAILLAGLKAFAWYILSPDMFRSEVTNTRMGSGSA* |
Ga0181521_104564172 | 3300014158 | Bog | RLRLAADASAILLEALKALAWYFLSPDMFRSDAAGTRMGSDTA* |
Ga0134089_105757811 | 3300015358 | Grasslands Soil | RLAADASAILLAALKVLAWYFLSPDMFRSETTDTRTGSGSAN* |
Ga0132258_137570521 | 3300015371 | Arabidopsis Rhizosphere | AVASAMLLLGLEVIARNFLSPDMFRSGATDTRLGSGSAT* |
Ga0132255_1037201762 | 3300015374 | Arabidopsis Rhizosphere | ADASAILREGLKVLAWYFLSPNMFRSEATDARLRFRFSLN* |
Ga0182040_116594601 | 3300016387 | Soil | AADASAILLAGLKVVACYFLSPDMFRSETTDTRTGSGSAN |
Ga0187802_101300073 | 3300017822 | Freshwater Sediment | DESATRPAELMELAWYILSPDMFRNEATGTRMGSGSA |
Ga0187872_104549511 | 3300018017 | Peatland | ASAILLEALKALAWYFLSPDMFRSEAMDTRMGSGTA |
Ga0184611_11493051 | 3300018067 | Groundwater Sediment | PRLAADASAILLAALKVLAWYFLSPERFRSEATDTRTGSGSK |
Ga0066655_111999582 | 3300018431 | Grasslands Soil | ASAILLAELQVLAWYFLSPDMFRSEATDTLMGSGSAS |
Ga0066667_120761651 | 3300018433 | Grasslands Soil | LRLAADASAILLAALKVLAWYFLSPDMFRSETTDTLMGSGSAN |
Ga0210407_102771942 | 3300020579 | Soil | DCALQQASAILLEGLKVLAWYILSPDIFRSEVTDTRMGSGSA |
Ga0210399_100695056 | 3300020581 | Soil | ASTILLEGLKVFAWYFLSPDMFRSEATDTQMGSRFSLN |
Ga0210406_102918732 | 3300021168 | Soil | LRLAADASAILLEGLKVLAWYILSPDIFRSEVTDTRMGSGSA |
Ga0210406_107579892 | 3300021168 | Soil | ASAILLGGLKVLAWYFLSPDMIRSEATDTRMGLRFSLIEDPP |
Ga0210406_110786322 | 3300021168 | Soil | HRRLLLAADASAILLAGLKALAWYFLSPDMFRSEATDTLMGSGSAS |
Ga0210406_110882191 | 3300021168 | Soil | ATLLAALKVIARRFLSPDMFRSEATDTRMGSGSAS |
Ga0210405_106780061 | 3300021171 | Soil | ALLLAELKVIAWYFLSLDMFRSEATDTRTASGSAS |
Ga0210408_105113511 | 3300021178 | Soil | LAADASAILLEGLKVLAWYILSPDMYRSEVTDTRMGFRFSLN |
Ga0210408_109900611 | 3300021178 | Soil | LIAPSFARLMLRLAADGSAILLAGLKVIAWYFLSLDMFRSEATDTRMGSGSAS |
Ga0210388_115947231 | 3300021181 | Soil | AADASAILLEGLKVLAWYVLSPDMFRSEATDTRLGFRFSLN |
Ga0210388_116486861 | 3300021181 | Soil | LAADASAILLEGLKVLAWYILSPDMFRSAFKDTRMDSG |
Ga0210394_110312433 | 3300021420 | Soil | AILLGGLKVFAWYVLSPDMFRSEATDSRMGLRFSLN |
Ga0210384_117197921 | 3300021432 | Soil | ASAILLEGLKVLAWDILSPDMFRSEATDTRMGSGSA |
Ga0210390_111084322 | 3300021474 | Soil | TILLEGLKVFAWYFLSPDMFRSEATDTQMGSRFSLN |
Ga0209171_104827951 | 3300025320 | Iron-Sulfur Acid Spring | GLLEGLKVLAWHILSPDMFRSEAADTRMGFRFSLN |
Ga0208192_10927071 | 3300025477 | Peatland | RLAADASAILLEALKALAWYFLSPDMFRSDAAGTRMGSDTA |
Ga0207692_110788311 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | HRRLRLAADASAILLAALKVLAWYFLSPDMFRSETTDTLMGSGLAN |
Ga0207685_103120582 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | HRRLLLAANASAILLAGLKVLAWYFLSPDMFRSEATDTLMGSGSAS |
Ga0207685_104521082 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLRLAADASAILLAALKVLAWYFLSPDMFRSETTDTLMGSGLAN |
Ga0207643_110589611 | 3300025908 | Miscanthus Rhizosphere | HRWLLLAADASAILLAGLKALAWYFLSPDMFRSEATDTLMGSGSAS |
Ga0207684_105183064 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QRLRLAADASAILLAALKVLAWYFLSPDMFRSEATDTLMGSGSAS |
Ga0207693_110808872 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | HPRLRLAADASAILLEEVKVLAWYILSPDICRSEVTDTRMGSG |
Ga0207644_106093261 | 3300025931 | Switchgrass Rhizosphere | LAADASAILFAELQGLAWCFLSPDMRRSEDTDTRMGSGSAG |
Ga0207706_109111851 | 3300025933 | Corn Rhizosphere | AADASAILLAGLKVLAWYFLSPDMFWSETTDTLMGSGSAS |
Ga0207665_105202241 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LHLAADASAILLEGLKVLAWYFLSPDMFRSEATDPRMASDSA |
Ga0207665_108734371 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLRLAADASAILFAELQGLAWCFLSPDMRRSEDTDTRMGSGSAG |
Ga0209237_10472791 | 3300026297 | Grasslands Soil | LAADASAILLAALKVLAWYFLSPDMFRSETTDTRTGSGLAN |
Ga0209027_11281581 | 3300026300 | Grasslands Soil | RGRNAGFRHQRLRLAADASAILLAALKVVAWYFPAPDMFRSESTDTLMGSGSAS |
Ga0209802_12657811 | 3300026328 | Soil | SAIRLAALKVIACYFLSPDMFRSETTDTRTGSGSAN |
Ga0257158_11002831 | 3300026515 | Soil | LAADGSAILLAGSKVIAWYFLSLDMLRSEATDTRTGSGSAS |
Ga0209577_102394594 | 3300026552 | Soil | RLRLAADVSAILLEGLKALPWYFLSPDMFRSEAADPRIDSGLV |
Ga0179587_101254651 | 3300026557 | Vadose Zone Soil | RLAADASAILLAGLKALAWYFLSPDMLRSEDTDTRMGSGSAR |
Ga0209886_10016973 | 3300027273 | Groundwater Sand | RLRLAADESAILLAALKVIAWYFLSPDMFRSEATDTRTGSG |
Ga0208827_11879971 | 3300027641 | Peatlands Soil | ASAILLERLKVLAWYFLSPDMFRSEATDTRMGSGSA |
Ga0209009_10185851 | 3300027667 | Forest Soil | ADASAILLEGWKALAWYILSPDMFRSEATETRTGPGSA |
Ga0209180_104824781 | 3300027846 | Vadose Zone Soil | LRLAADASAILLAELQVLAWYFLSPDMLRSEDTDTRMGSGSAN |
Ga0209068_106890882 | 3300027894 | Watersheds | DASAILLEGLKVLAWYFLSPDMIRSEATDTRMGLRFSLIEDPP |
Ga0209006_101171341 | 3300027908 | Forest Soil | TILLAGLKVIAWYFLSPDMLRSEATDTRMGSGSAS |
Ga0209583_101085873 | 3300027910 | Watersheds | LAADVSAILLEGSKALAWYFLSPDILRSEAAETRMGSGSV |
Ga0308309_105755861 | 3300028906 | Soil | RLAADASAILLAALKVLAWYFLSPDMFRSEATDTLMGSGSAS |
Ga0222749_107742671 | 3300029636 | Soil | LRLAADASAILLEGLKVLAWYFLSPDMFRSEATDTRMGSGSA |
Ga0170824_1197471492 | 3300031231 | Forest Soil | LGEDESATRPAELKELAWYFLSPDMFRSEATDTRMGSGSA |
Ga0170818_1013680123 | 3300031474 | Forest Soil | LAADVSTILLEGWKALPWYFLSPDILRSEAADPRIDSGLV |
Ga0310915_100642296 | 3300031573 | Soil | LRLAADASAILLGGLKVVAWWFLSPDMFRSRAPDIRMGSGSAS |
Ga0310686_1119525572 | 3300031708 | Soil | RLAADASAILLEGLKVLAWYILSPDIFRSEVTDTRMGSGSA |
Ga0306917_102874611 | 3300031719 | Soil | LAADASAILLGGLKVVAWWFLSPDMFRSRAPDIRMGSGSAS |
Ga0307475_114186881 | 3300031754 | Hardwood Forest Soil | HRRLPLAADASAILLEGLKVVAWYFLSPDLFRSEATDTRMGSGTA |
Ga0306923_116575401 | 3300031910 | Soil | RLAADASAILLAGLKVVACYFLSPDMFRSETTDTRTGSGSAN |
⦗Top⦘ |