NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F075384

Metagenome / Metatranscriptome Family F075384

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075384
Family Type Metagenome / Metatranscriptome
Number of Sequences 119
Average Sequence Length 43 residues
Representative Sequence MSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF
Number of Associated Samples 104
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.39 %
% of genes near scaffold ends (potentially truncated) 15.13 %
% of genes from short scaffolds (< 2000 bps) 81.51 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.908 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(15.126 % of family members)
Environment Ontology (ENVO) Unclassified
(23.529 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.815 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.27%    β-sheet: 0.00%    Coil/Unstructured: 88.73%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00486Trans_reg_C 12.61
PF13185GAF_2 10.08
PF13191AAA_16 6.72
PF13492GAF_3 6.72
PF03704BTAD 5.04
PF01590GAF 3.36
PF16576HlyD_D23 2.52
PF02163Peptidase_M50 0.84
PF07995GSDH 0.84
PF07885Ion_trans_2 0.84
PF13533Biotin_lipoyl_2 0.84
PF06240COXG 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG3629DNA-binding transcriptional regulator DnrI/AfsR/EmbR, SARP family, contains BTAD domainTranscription [K] 5.04
COG3947Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domainsTranscription [K] 5.04
COG2133Glucose/arabinose dehydrogenase, beta-propeller foldCarbohydrate transport and metabolism [G] 0.84
COG3427Carbon monoxide dehydrogenase subunit CoxGEnergy production and conversion [C] 0.84

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.91 %
UnclassifiedrootN/A31.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352024|deeps__Contig_192030All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1322Open in IMG/M
3300000890|JGI11643J12802_11088671Not Available581Open in IMG/M
3300003267|soilL1_10006649All Organisms → cellular organisms → Bacteria12277Open in IMG/M
3300003319|soilL2_10230403All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium2226Open in IMG/M
3300003324|soilH2_10090600All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium5152Open in IMG/M
3300004156|Ga0062589_101396488All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300004479|Ga0062595_100001144All Organisms → cellular organisms → Bacteria5731Open in IMG/M
3300004643|Ga0062591_100117442All Organisms → cellular organisms → Bacteria1769Open in IMG/M
3300004780|Ga0062378_10006400All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1884Open in IMG/M
3300005175|Ga0066673_10170254All Organisms → cellular organisms → Bacteria1225Open in IMG/M
3300005178|Ga0066688_10678446All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300005332|Ga0066388_100310773All Organisms → cellular organisms → Bacteria2222Open in IMG/M
3300005332|Ga0066388_100647010All Organisms → cellular organisms → Bacteria1672Open in IMG/M
3300005439|Ga0070711_100392258All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300005444|Ga0070694_101071021Not Available671Open in IMG/M
3300005445|Ga0070708_101064959All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300005445|Ga0070708_101234863Not Available699Open in IMG/M
3300005467|Ga0070706_100338207All Organisms → cellular organisms → Bacteria1403Open in IMG/M
3300005468|Ga0070707_101427643All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes659Open in IMG/M
3300005468|Ga0070707_101921406Not Available559Open in IMG/M
3300005536|Ga0070697_101291636All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes651Open in IMG/M
3300005577|Ga0068857_101882327All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300005617|Ga0068859_103141233Not Available503Open in IMG/M
3300005764|Ga0066903_107146004Not Available578Open in IMG/M
3300005833|Ga0074472_10250547Not Available655Open in IMG/M
3300005873|Ga0075287_1042439All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes612Open in IMG/M
3300005884|Ga0075291_1003082All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp.1785Open in IMG/M
3300005893|Ga0075278_1037652Not Available704Open in IMG/M
3300006163|Ga0070715_10089685All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1412Open in IMG/M
3300006175|Ga0070712_100514651All Organisms → cellular organisms → Bacteria1005Open in IMG/M
3300006755|Ga0079222_10049947All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp.1936Open in IMG/M
3300006755|Ga0079222_10092255All Organisms → cellular organisms → Bacteria1565Open in IMG/M
3300006804|Ga0079221_11226867Not Available584Open in IMG/M
3300006845|Ga0075421_100310090All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp.1916Open in IMG/M
3300006847|Ga0075431_100191390All Organisms → cellular organisms → Bacteria2096Open in IMG/M
3300006852|Ga0075433_10022679All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp.5273Open in IMG/M
3300006852|Ga0075433_10452906All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300006854|Ga0075425_102836635Not Available533Open in IMG/M
3300006904|Ga0075424_100197953All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2134Open in IMG/M
3300006904|Ga0075424_101785332All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300006914|Ga0075436_100101095All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium2008Open in IMG/M
3300006954|Ga0079219_12257272Not Available525Open in IMG/M
3300009143|Ga0099792_10358937Not Available881Open in IMG/M
3300009147|Ga0114129_12500871All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes617Open in IMG/M
3300009162|Ga0075423_11269710All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes787Open in IMG/M
3300009840|Ga0126313_11024964All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes676Open in IMG/M
3300010040|Ga0126308_10209931All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1254Open in IMG/M
3300010045|Ga0126311_11435343Not Available577Open in IMG/M
3300010166|Ga0126306_11436447Not Available571Open in IMG/M
3300012212|Ga0150985_103103235Not Available534Open in IMG/M
3300012212|Ga0150985_108153382Not Available514Open in IMG/M
3300012212|Ga0150985_116758372All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes609Open in IMG/M
3300012212|Ga0150985_121948300Not Available501Open in IMG/M
3300012362|Ga0137361_10499495All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1117Open in IMG/M
3300012917|Ga0137395_10085334All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2069Open in IMG/M
3300012922|Ga0137394_10835196All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes771Open in IMG/M
3300012923|Ga0137359_10482786All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1094Open in IMG/M
3300012929|Ga0137404_11048561All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes747Open in IMG/M
3300012957|Ga0164303_10047341All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium1884Open in IMG/M
3300012958|Ga0164299_10331927All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes949Open in IMG/M
3300012960|Ga0164301_10108840All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1610Open in IMG/M
3300012960|Ga0164301_10579477All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes824Open in IMG/M
3300012985|Ga0164308_10405432All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1116Open in IMG/M
3300012986|Ga0164304_10005298All Organisms → cellular organisms → Bacteria5195Open in IMG/M
3300012988|Ga0164306_10072825All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium2159Open in IMG/M
3300012989|Ga0164305_10436325All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1013Open in IMG/M
3300012989|Ga0164305_10622301All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes871Open in IMG/M
3300013308|Ga0157375_12928467Not Available570Open in IMG/M
3300014314|Ga0075316_1211973Not Available515Open in IMG/M
3300015264|Ga0137403_10773301All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes817Open in IMG/M
3300015371|Ga0132258_13353382All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1101Open in IMG/M
3300015373|Ga0132257_101809216All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes785Open in IMG/M
3300015373|Ga0132257_103594911All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes564Open in IMG/M
3300015374|Ga0132255_100278332All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium2401Open in IMG/M
3300018466|Ga0190268_10720640All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes737Open in IMG/M
3300018482|Ga0066669_10126679All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1831Open in IMG/M
3300019269|Ga0184644_1617201Not Available525Open in IMG/M
3300019877|Ga0193722_1011775All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2231Open in IMG/M
3300020068|Ga0184649_1526131Not Available522Open in IMG/M
3300021445|Ga0182009_10183018All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1012Open in IMG/M
3300022756|Ga0222622_11270055All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes542Open in IMG/M
3300025906|Ga0207699_11437592Not Available510Open in IMG/M
3300025910|Ga0207684_11101488Not Available661Open in IMG/M
3300025993|Ga0208415_1018622All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes668Open in IMG/M
3300026040|Ga0208144_1031514Not Available585Open in IMG/M
3300026041|Ga0207639_10712523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia931Open in IMG/M
3300026088|Ga0207641_10147789All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2126Open in IMG/M
3300027716|Ga0209682_10008261All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2654Open in IMG/M
3300027765|Ga0209073_10169344All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes816Open in IMG/M
3300027775|Ga0209177_10302614All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes610Open in IMG/M
3300027787|Ga0209074_10014976All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2002Open in IMG/M
3300027840|Ga0209683_10235407All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes842Open in IMG/M
3300027903|Ga0209488_11137985All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes530Open in IMG/M
3300028812|Ga0247825_10165393All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1521Open in IMG/M
3300028824|Ga0307310_10554670Not Available583Open in IMG/M
3300030336|Ga0247826_11097875Not Available635Open in IMG/M
3300030336|Ga0247826_11100303Not Available634Open in IMG/M
3300030988|Ga0308183_1203033Not Available517Open in IMG/M
3300030993|Ga0308190_1129823Not Available581Open in IMG/M
3300031058|Ga0308189_10518582Not Available516Open in IMG/M
3300031114|Ga0308187_10491742Not Available503Open in IMG/M
(restricted) 3300031150|Ga0255311_1095840All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes641Open in IMG/M
3300031547|Ga0310887_10538802All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes708Open in IMG/M
3300031548|Ga0307408_100517208All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1048Open in IMG/M
3300031562|Ga0310886_10797334Not Available594Open in IMG/M
3300031824|Ga0307413_10439534All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1032Open in IMG/M
3300031824|Ga0307413_11169006All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes668Open in IMG/M
3300031852|Ga0307410_10894731All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes760Open in IMG/M
3300031901|Ga0307406_10282433All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes1267Open in IMG/M
3300031938|Ga0308175_100003057All Organisms → cellular organisms → Bacteria11543Open in IMG/M
3300031938|Ga0308175_100039022All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium4009Open in IMG/M
3300031939|Ga0308174_11235926Not Available638Open in IMG/M
3300031965|Ga0326597_10120673All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium3169Open in IMG/M
3300031996|Ga0308176_10031852All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium4121Open in IMG/M
3300032126|Ga0307415_100022398All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium3898Open in IMG/M
3300034099|Ga0373902_148327Not Available557Open in IMG/M
3300034448|Ga0370540_15623Not Available528Open in IMG/M
3300034661|Ga0314782_183475Not Available533Open in IMG/M
3300034664|Ga0314786_177049Not Available516Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil15.13%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.24%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.40%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.88%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere5.04%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil3.36%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil3.36%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.36%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere3.36%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.52%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.52%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil2.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.52%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.68%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.68%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.84%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.84%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.84%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004780Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1FreshEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300005884Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302EnvironmentalOpen in IMG/M
3300005893Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014314Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300020068Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025993Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026040Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027716Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300034099Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B1A0.3EngineeredOpen in IMG/M
3300034448Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034664Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
deeps_036528202199352024SoilMSKHDEQSRAKTPEQQPKKPVPAKDVELGVEELEEKIAPM
JGI11643J12802_1108867123300000890SoilMSKHDEQTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKV*
soilL1_1000664953300003267Sugarcane Root And Bulk SoilMSKHDEQSRTKTPEQQPKKPAPSKDVELGVEELEEKISPMKLS*
soilL2_1023040333300003319Sugarcane Root And Bulk SoilMSKHDEQSRTKTPEQQPKKPAPSKDVELGVEELEEKISPMKLR*
soilH2_1009060073300003324Sugarcane Root And Bulk SoilMSKHDEQSRSKTPEQQPKKPVPAKDVELGVEELEEKIAPMKF*
Ga0062589_10139648823300004156SoilMSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKAH*
Ga0062595_10000114453300004479SoilMSKHDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKISV*
Ga0062591_10011744233300004643SoilMSKHDEQSRAKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF*
Ga0062378_1000640023300004780Wetland SedimentMSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKVAPMKITR*
Ga0066673_1017025423300005175SoilMSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF*
Ga0066688_1067844633300005178SoilMSKHDEQSKTKTSEQQPKKPVPTKDVELGVEELEEKIAPMQFR*
Ga0066388_10031077333300005332Tropical Forest SoilMSKHDEQTRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAI*
Ga0066388_10064701023300005332Tropical Forest SoilMSKHDDQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKVF*
Ga0070711_10039225823300005439Corn, Switchgrass And Miscanthus RhizosphereMSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKLY*
Ga0070694_10107102113300005444Corn, Switchgrass And Miscanthus RhizosphereMSKHDEQTRTRTPEQQPKKPAPSKDVELGVEELEEKVAPVKFY*
Ga0070708_10106495913300005445Corn, Switchgrass And Miscanthus RhizosphereMSKHDERSQTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKLV*
Ga0070708_10123486313300005445Corn, Switchgrass And Miscanthus RhizosphereMSKHDEQARTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKAF*
Ga0070706_10033820723300005467Corn, Switchgrass And Miscanthus RhizosphereMSKHDERSQTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKMV*
Ga0070707_10142764313300005468Corn, Switchgrass And Miscanthus RhizosphereEMSAIMSKHDERSQTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKLV*
Ga0070707_10192140623300005468Corn, Switchgrass And Miscanthus RhizosphereMVKHDEQSRTRTPEQQPKKPVPAKDVELEVEELEEKIAPVKIF*
Ga0070697_10129163623300005536Corn, Switchgrass And Miscanthus RhizosphereMSKHDEQTRTRTPEQQPKKPVPSKDVELGVEELEEKIAPLKPF*
Ga0068857_10188232723300005577Corn RhizosphereMIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF*
Ga0068859_10314123323300005617Switchgrass RhizosphereMIKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMK
Ga0066903_10714600423300005764Tropical Forest SoilMSKHDEQSRTKTTEQQPKKPAPAQDVELGVEELEEKIAPMKTF*
Ga0074472_1025054733300005833Sediment (Intertidal)MSKHDEQSRTRTPQQQPKNPVPSKDVELGVEELEEKVAPMKITR*
Ga0075287_104243923300005873Rice Paddy SoilMSKHDEQSRTKTPEQQPKTPVPSKDVELGVEELEEKIAPMRLK*
Ga0075291_100308213300005884Rice Paddy SoilMSKHDEQSRTKTPEQQPKTPVPSKDVELGVEELEEKIAPMKFN*
Ga0075278_103765233300005893Rice Paddy SoilMSKHDEQSRSKTPEQQPKKPVPSKDVELGVEELEEKVAPMKVR*
Ga0070715_1008968513300006163Corn, Switchgrass And Miscanthus RhizosphereMSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKLY*
Ga0070712_10051465133300006175Corn, Switchgrass And Miscanthus RhizosphereMIKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAF*
Ga0079222_1004994723300006755Agricultural SoilMSKHDEQSRSKTPEQQPKKPVPAKDVELGVEELEEKIAPMKYF*
Ga0079222_1009225523300006755Agricultural SoilMIKHDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAM*
Ga0079221_1122686733300006804Agricultural SoilMSKHDEQSRSKTPEQQPKKPVPAKDVELGVEELEEKIAPMKSF*
Ga0075421_10031009023300006845Populus RhizosphereMSKHDEQSKTRTPEQQPKKQPSKDVELDVQELEEKIAPVKYY*
Ga0075431_10019139023300006847Populus RhizosphereMSKHDEQSKTRTPEQQPKKQPSKDVELDVQELEEKIAPVKIY*
Ga0075433_1002267933300006852Populus RhizosphereMIKHDEQSRTKTPEQQPKKPVPAKDVELEVEELEEKIAPVKVF*
Ga0075433_1045290613300006852Populus RhizosphereMSKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMK
Ga0075425_10283663523300006854Populus RhizosphereMIKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMKTF*
Ga0075424_10019795323300006904Populus RhizosphereAIMIKHDEQSRTKTPEQQPKKPVPAKDVELEVEELEEKIAPVKVF*
Ga0075424_10178533223300006904Populus RhizosphereMIKHDEQSRTKTPEQQPKKPIPAKDVELGVEELEEKIAPMKQF*
Ga0075436_10010109513300006914Populus RhizosphereMSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIA
Ga0079219_1225727223300006954Agricultural SoilMIKHDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKSF*
Ga0099792_1035893723300009143Vadose Zone SoilMSAIMSKHDERPQTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKFA*
Ga0114129_1250087113300009147Populus RhizosphereMSKHDEQARTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKLA*
Ga0075423_1126971023300009162Populus RhizosphereMIKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPLKAF*
Ga0126313_1102496423300009840Serpentine SoilMSAIMMKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKVAPLRI*
Ga0126308_1020993123300010040Serpentine SoilMSAIMIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKVAPLRI*
Ga0126311_1143534323300010045Serpentine SoilMSKHDEQSRTKTPEQQPKKPATSKDVELGIEELEEKIAPMKAL*
Ga0126306_1143644723300010166Serpentine SoilMSKHDEQTKTPEQQPKKPVPAKDVELGIEELEEKIAPMKY*
Ga0150985_10310323513300012212Avena Fatua RhizosphereMTKHDEQSRTKSPEQQPKKPVPAEDVELGVEELEEKIAPMKLVQ*
Ga0150985_10815338223300012212Avena Fatua RhizosphereMSAIMIKHDEQSRTKTPEQQPKKPVPAKDVELGIEELEEKVAPFRI*
Ga0150985_11675837223300012212Avena Fatua RhizosphereMSKHDEQSKTRTPEQQPKKQPSKDIELDVQELEEKIAPVKIL*
Ga0150985_12194830023300012212Avena Fatua RhizosphereMSKHDEQSRTKAPEQQPKKPVPAKDVELGVEELEEKIAPMKLA*
Ga0137361_1049949523300012362Vadose Zone SoilMSAIMSKHDERSQAKTPEQQPKKPVPSKDVELGVEELEEKIAPMKFA*
Ga0137395_1008533433300012917Vadose Zone SoilMSAIMSKHDERSQTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKFA*
Ga0137394_1083519623300012922Vadose Zone SoilMSKHDEQTKTPEQQPKKPVPAKDVELGVQELEEKIAPMSVFK*
Ga0137359_1048278633300012923Vadose Zone SoilMSAIMSKHDERSQTKTPEQQPKKAVPSKDVELGVEELEEKIAPMKFA*
Ga0137404_1104856113300012929Vadose Zone SoilETRAIMSKHDEQTRTRTPEQQPKKPVTSKDVELGVEELEEKIAPMKAF*
Ga0164303_1004734133300012957SoilMIKHDEQSRTKTTEQQPKKPVPAKDVELDVEELEEKIAPVRF*
Ga0164299_1033192733300012958SoilMIKHDEQSRTKTPEQQPKKPVPAKDVELDVEELEETIAPVRF*
Ga0164301_1010884033300012960SoilMIKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKI*
Ga0164301_1057947733300012960SoilMIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEE
Ga0164308_1040543233300012985SoilMIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKI*
Ga0164304_1000529833300012986SoilMSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKTF*
Ga0164306_1007282533300012988SoilMIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKISPMKI*
Ga0164305_1043632523300012989SoilMSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKQF*
Ga0164305_1062230133300012989SoilMIKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPM
Ga0157375_1292846723300013308Miscanthus RhizosphereMIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKAF*
Ga0075316_121197323300014314Natural And Restored WetlandsMSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKFNA*
Ga0137403_1077330123300015264Vadose Zone SoilMSKHDERSQTKTPEQQPKKPVSTNDVELGVEELEEKIAPSTLPVKPK*
Ga0132258_1335338233300015371Arabidopsis RhizosphereMSKHDEQTRTKTTEQQPKKPAPAKDVELGVEELEEKIAPMKAF*
Ga0132257_10180921613300015373Arabidopsis RhizosphereMSKHDEQSRAKTPEQQPKKPVPAKDVELGVEELEEKIAPMKSF*
Ga0132257_10359491113300015373Arabidopsis RhizosphereMSKHDEQSKTRTPEQQPKKQPSKDVELDVQELEEKIAP
Ga0132255_10027833223300015374Arabidopsis RhizosphereMIKHDEQSRTKTTEQQPKKPVPAKDVELGVEELEEKIAPMKLV*
Ga0190268_1072064023300018466SoilMSKHDEQSKTRTPEQQPKKPSKDVELDVQELEEKIAPVKAF
Ga0066669_1012667923300018482Grasslands SoilMSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF
Ga0184644_161720123300019269Groundwater SedimentMSKHDEQSRTKTPEQQPKKPAPAKDVELGVEELEEKIAPMKAL
Ga0193722_101177533300019877SoilMSKHDDQNRTKAPEQQPKKPVPSKDVELGVEELEEKIAPMKAF
Ga0184649_152613123300020068Groundwater SedimentMSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKAL
Ga0182009_1018301823300021445SoilMIKHDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAM
Ga0222622_1127005523300022756Groundwater SedimentDEQTKTPEQQPKKPVPAKDVELGIEELEEKIAPMKF
Ga0207699_1143759213300025906Corn, Switchgrass And Miscanthus RhizosphereRSKTTEQQPKKPVQAKDVELEVEELEEKIAPMQVKSH
Ga0207684_1110148823300025910Corn, Switchgrass And Miscanthus RhizosphereMIKHDEQSRTRTPEQQPKKPVPAKDVELGVEELEEKIAPMKMV
Ga0208415_101862223300025993Rice Paddy SoilIMSKHDEQFRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKFNA
Ga0208144_103151423300026040Natural And Restored WetlandsMSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKFNA
Ga0207639_1071252313300026041Corn RhizosphereMSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKAH
Ga0207641_1014778923300026088Switchgrass RhizosphereMIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKQF
Ga0209682_1000826133300027716Wetland SedimentMSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKVAPMKITR
Ga0209073_1016934423300027765Agricultural SoilMSKHDEQSRSKTPEQQPKKPVPAKDVELGVEELEEKIAPMKYF
Ga0209177_1030261423300027775Agricultural SoilMSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKYF
Ga0209074_1001497623300027787Agricultural SoilHDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAM
Ga0209683_1023540733300027840Wetland SedimentMSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEK
Ga0209488_1113798513300027903Vadose Zone SoilMSKHDERPQTKTPEQQPKKPVPSKDIELGVEELEEKIAPMKF
Ga0247825_1016539323300028812SoilMSKHDEQSRTKTPEQQPKKPATSKDVELGVEELEEKIAPMKAL
Ga0307310_1055467013300028824SoilMSKHDEQTKTPEQQPKKPVPAKDVELGIEELEEKIAPVKFV
Ga0247826_1109787523300030336SoilMIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPVKAF
Ga0247826_1110030333300030336SoilMSKHDEQSRTKTPEQQPKKPATSKDVELGVEELEEK
Ga0308183_120303313300030988SoilMSKHDEQSKTRTPEQQPKKPVPSKDVELGVEELEEKIAPMKATL
Ga0308190_112982323300030993SoilMSKHDEQTKTPEQQPKKPVPAKDVELGIEELEEKIAPMKF
Ga0308189_1051858223300031058SoilMIKHDEQSRTKTPEQQPKKPVPAKDVELGIEELEEKVAPFRI
Ga0308187_1049174223300031114SoilMSKQEQTKTPEQQPKKPMPAKDVELGVEELEEKIAPMKAL
(restricted) Ga0255311_109584013300031150Sandy SoilMSKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKISPMKAF
Ga0310887_1053880213300031547SoilMIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKTF
Ga0307408_10051720833300031548RhizosphereMMKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKVAPLRI
Ga0310886_1079733413300031562SoilMIKHDEQSRTKTTEQQPKKPVPAKDVELDVEELEEKIAPVRF
Ga0307413_1043953423300031824RhizosphereMSKHDEQSRTKTPEQQPKKPVPADVELGVEELEEKIAPMKAR
Ga0307413_1116900623300031824RhizosphereEQSRTKTPEQQPKKPVPAKDVELGVEELEEKVAPLRI
Ga0307410_1089473113300031852RhizosphereMMKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKIAPMKAR
Ga0307406_1028243323300031901RhizosphereMSKHDEQFRTKTPEQQPKKPVPSKDVELGVEELEEKIAPMKLN
Ga0308175_100003057103300031938SoilMSKHDEQSRSKTTEQQPKKPVPAKDVELGVEELEEKIAPMKAM
Ga0308175_10003902233300031938SoilMSKHDEQSRSKTPEQQPKKPVPSKDVELGVEELEEKVAPMMVR
Ga0308174_1123592623300031939SoilMSKHDEQTRTKSTEQQPKKPVPAKDVELGVEELEEKIAPMKAM
Ga0326597_1012067323300031965SoilMSKHDEQSRTKTTEQQPKKPVPAKDVELSIEELEEKIAPMKLS
Ga0308176_1003185223300031996SoilMSKHDEQSRTKTPEQQPKKPVPSKDVELGVEELEEKVAPMMVR
Ga0307415_10002239853300032126RhizosphereMIKHDEQSRTKTPEQQPKKPVPAKDVELGVEELEEKVAPLRI
Ga0373902_148327_392_5263300034099Sediment SlurryMSKHGEQSRTKTPEQQPKKPVPAKDVELGVEELEEKISPMKTFI
Ga0370540_15623_253_3873300034448SoilMSKHDEQSRTKTPEQQPKKPATSKDVELGVEELEEKIAPMKATL
Ga0314782_183475_150_2813300034661SoilMSKHDEQSRTKTPEQQPKKPATSKDVELGVEELEEKVAPVKFY
Ga0314786_177049_1_1233300034664SoilMIKHDEQSRTKTPEQQPKKPATSKDVELGVVDLEEKIAPMK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.