NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F075470

Metagenome Family F075470

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F075470
Family Type Metagenome
Number of Sequences 119
Average Sequence Length 50 residues
Representative Sequence AQEGYLVSLIDGRLDLQKLLILSPFDQFTTLFNLAKLQHERAITIPQ
Number of Associated Samples 112
Number of Associated Scaffolds 119

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.32 %
% of genes from short scaffolds (< 2000 bps) 95.80 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.479 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(12.605 % of family members)
Environment Ontology (ENVO) Unclassified
(35.294 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.496 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.67%    β-sheet: 0.00%    Coil/Unstructured: 61.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 119 Family Scaffolds
PF00512HisKA 42.86
PF02518HATPase_c 15.13
PF00989PAS 1.68
PF13188PAS_8 1.68
PF06793UPF0262 0.84

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 119 Family Scaffolds
COG5328Uncharacterized conserved protein, UPF0262 familyFunction unknown [S] 0.84


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.48 %
UnclassifiedrootN/A2.52 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001334|A2165W6_1284720All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300001359|A3035W6_1104621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium514Open in IMG/M
3300003366|JGI25321J50212_10154986All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300004081|Ga0063454_101804754All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300004114|Ga0062593_102900373All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300005093|Ga0062594_102032262All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium615Open in IMG/M
3300005172|Ga0066683_10428436All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium814Open in IMG/M
3300005178|Ga0066688_10775420All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300005179|Ga0066684_10919180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300005181|Ga0066678_10069796All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2054Open in IMG/M
3300005328|Ga0070676_10522634All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium846Open in IMG/M
3300005328|Ga0070676_10633221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium774Open in IMG/M
3300005334|Ga0068869_101867408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium538Open in IMG/M
3300005337|Ga0070682_100742960All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300005340|Ga0070689_101991923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300005341|Ga0070691_10397264All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium776Open in IMG/M
3300005343|Ga0070687_100936285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium624Open in IMG/M
3300005344|Ga0070661_101832285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300005364|Ga0070673_100923096All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium810Open in IMG/M
3300005438|Ga0070701_11070240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300005444|Ga0070694_100762211All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300005445|Ga0070708_100938259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300005451|Ga0066681_10592733All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium683Open in IMG/M
3300005451|Ga0066681_10817387All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300005459|Ga0068867_102070096All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300005467|Ga0070706_101629059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300005534|Ga0070735_10078095All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2117Open in IMG/M
3300005536|Ga0070697_100565481All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium998Open in IMG/M
3300005559|Ga0066700_10799014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300005561|Ga0066699_11271678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300005566|Ga0066693_10257557All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium692Open in IMG/M
3300005598|Ga0066706_11201910All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300005618|Ga0068864_102497677All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300005891|Ga0075283_1069275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300005896|Ga0075282_1053061All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300005903|Ga0075279_10045894All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300005904|Ga0075280_10019343All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1175Open in IMG/M
3300005952|Ga0080026_10256216All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300005993|Ga0080027_10176032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300005994|Ga0066789_10246031All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium750Open in IMG/M
3300006032|Ga0066696_10886695All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300006055|Ga0097691_1198316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium517Open in IMG/M
3300006237|Ga0097621_101041070All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium767Open in IMG/M
3300006237|Ga0097621_102416561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300006358|Ga0068871_102223704All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M
3300006794|Ga0066658_10939246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium501Open in IMG/M
3300006797|Ga0066659_11664613All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium537Open in IMG/M
3300006854|Ga0075425_102029289All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300006893|Ga0073928_10791923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium656Open in IMG/M
3300006903|Ga0075426_11378697All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300007004|Ga0079218_10883243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium875Open in IMG/M
3300007004|Ga0079218_13386243All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300009012|Ga0066710_104030009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium549Open in IMG/M
3300009088|Ga0099830_11769127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300009147|Ga0114129_13114522All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300009174|Ga0105241_11244075All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300009177|Ga0105248_11471370All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium771Open in IMG/M
3300009509|Ga0123573_11645650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium596Open in IMG/M
3300009789|Ga0126307_11558155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium536Open in IMG/M
3300010333|Ga0134080_10452659All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium602Open in IMG/M
3300010333|Ga0134080_10693779All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium504Open in IMG/M
3300010364|Ga0134066_10118891All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium792Open in IMG/M
3300010397|Ga0134124_10225974All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1711Open in IMG/M
3300010403|Ga0134123_13014840All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300011007|Ga0139299_1051661All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium919Open in IMG/M
3300011269|Ga0137392_10943217All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300011271|Ga0137393_11641285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium532Open in IMG/M
3300011445|Ga0137427_10315529All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300012040|Ga0137461_1018034All Organisms → cellular organisms → Bacteria1747Open in IMG/M
3300012045|Ga0136623_10474490All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300012189|Ga0137388_10206543All Organisms → cellular organisms → Bacteria1772Open in IMG/M
3300012189|Ga0137388_10997816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium772Open in IMG/M
3300012960|Ga0164301_10975776All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300012975|Ga0134110_10423640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300013503|Ga0120127_10015000All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1324Open in IMG/M
3300014054|Ga0120135_1031458All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium732Open in IMG/M
3300014166|Ga0134079_10706562All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium515Open in IMG/M
3300014745|Ga0157377_10434364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium902Open in IMG/M
3300014865|Ga0180078_1065457All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300014877|Ga0180074_1038069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium995Open in IMG/M
3300014968|Ga0157379_10484290All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1145Open in IMG/M
3300015051|Ga0137414_1205444All Organisms → cellular organisms → Bacteria2898Open in IMG/M
3300015164|Ga0167652_1069461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300015193|Ga0167668_1067180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300018084|Ga0184629_10130251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1260Open in IMG/M
3300018482|Ga0066669_11721983All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300019888|Ga0193751_1159429All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium800Open in IMG/M
3300021362|Ga0213882_10386014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium591Open in IMG/M
3300021362|Ga0213882_10429272All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300021363|Ga0193699_10150396All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium958Open in IMG/M
3300024279|Ga0247692_1028010All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium864Open in IMG/M
3300025289|Ga0209002_10630329Not Available572Open in IMG/M
3300025604|Ga0207930_1115714All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium601Open in IMG/M
3300025878|Ga0209584_10349036All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium570Open in IMG/M
3300025910|Ga0207684_11264778All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium609Open in IMG/M
3300025922|Ga0207646_11892445All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300025925|Ga0207650_10286251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1343Open in IMG/M
3300025931|Ga0207644_11202424All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium637Open in IMG/M
3300025937|Ga0207669_11444145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300025938|Ga0207704_11850518All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium519Open in IMG/M
3300025939|Ga0207665_10734418All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium778Open in IMG/M
3300025942|Ga0207689_10563269All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium957Open in IMG/M
3300025960|Ga0207651_11199729All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium681Open in IMG/M
3300026041|Ga0207639_10846732All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium853Open in IMG/M
3300026088|Ga0207641_11643515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium644Open in IMG/M
3300026308|Ga0209265_1112915All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium689Open in IMG/M
3300026315|Ga0209686_1093155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1055Open in IMG/M
3300026326|Ga0209801_1129938All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1075Open in IMG/M
3300027843|Ga0209798_10166280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1100Open in IMG/M
3300027986|Ga0209168_10083717All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1660Open in IMG/M
3300031716|Ga0310813_11404120All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium648Open in IMG/M
3300031852|Ga0307410_10982983All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium727Open in IMG/M
3300032002|Ga0307416_102492638All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300032955|Ga0335076_10452575All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1167Open in IMG/M
3300033488|Ga0316621_11200027All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium573Open in IMG/M
3300034135|Ga0334929_128473All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium526Open in IMG/M
3300034779|Ga0334945_109416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil12.61%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.04%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.20%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.36%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.36%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil3.36%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.36%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.52%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere2.52%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.52%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.52%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.68%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.68%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.68%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.68%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.68%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.68%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.84%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.84%
Basal IceEnvironmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice0.84%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.84%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.84%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.84%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.84%
Sub-Biocrust SoilEnvironmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.84%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.84%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.84%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.84%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.84%
Hypolithic BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Hypolithic Biocrust0.84%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface0.84%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.84%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.84%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.84%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.84%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001334Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001359Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illuminaEnvironmentalOpen in IMG/M
3300003366Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/23EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005891Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304EnvironmentalOpen in IMG/M
3300005896Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204EnvironmentalOpen in IMG/M
3300005903Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_303EnvironmentalOpen in IMG/M
3300005904Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011007Basal ice microbial communities from Matanuska glacier, Alaska, USA - MataBEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012045Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06)EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014054Permafrost microbial communities from Nunavut, Canada - A34_5cm_12MEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014865Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10DEnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015051Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015164Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300024279Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025604Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033488Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_CEnvironmentalOpen in IMG/M
3300034135Biocrust microbial communities from Mojave Desert, California, United States - 25HNCEnvironmentalOpen in IMG/M
3300034779Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 41SMSEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
A2165W6_128472023300001334PermafrostMQAVPKLTAEFLTNFDRFNLTAQEGYLVSLIDGRLDLQKLSMLSPFDPFSTLFIL
A3035W6_110462123300001359PermafrostNFDRFNLNAQEGYLISLIDGRLDLQKLLILSPFDAFTTLFNVAKLQYERAVMVPQ*
JGI25321J50212_1015498623300003366Deep SubsurfaceHFDRFNLNAQEGYLVSLIDGRLSIQKLIILSPFDPFTTIFILAKLQQEKAITVP*
Ga0063454_10180475423300004081SoilTNFDRFNLSAQEGYLVSLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAITIPQ*
Ga0062593_10290037323300004114SoilAEFLTNFDHFNLNAQEGYLVSLIDGRMDLQKLLILSPFDPFTTLFTLAKLQNERAISVPQ
Ga0062594_10203226223300005093SoilSAEFMSNFDRFNLNAQEGYLVSLIDGRLDVQKLLILSPFDPFNTIFILAKLQQEKAITVPQ*
Ga0066683_1042843633300005172SoilDRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDPFTTLFNLAKLQHERAINIPQ*
Ga0066688_1077542013300005178SoilGYLISLIDGRLALQKLLILSPFDPFTTLFNLAKLQHERAITVP*
Ga0066684_1091918023300005179SoilMSLIDGRLDLQKLLILSPFDQFTTLFTLAKLQHERAITVPQ*
Ga0066678_1006979643300005181SoilDRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDSFTTLFNLAKLQQERAITVP*
Ga0070676_1052263423300005328Miscanthus RhizosphereAQEGYLISLIDGRLQLQKLLVLSPFDQFTTLFNLAKLQHERAITIPQ*
Ga0070676_1063322123300005328Miscanthus RhizosphereDRFNLSAQEGFLVSLIDGRLDLQKLLILSPFDPFTTFFILAKLQHERAITVPQ*
Ga0068869_10186740823300005334Miscanthus RhizosphereNFDRFNLSAQEGYLVSLIDGRMDIQKLLILSPFDPFTTLFTLAKLQNERAISVPQ*
Ga0070682_10074296023300005337Corn RhizosphereYLMSLIDGRLDLQKLLILSPFDQFTTLFTLAKLQHERAITVPQ*
Ga0070689_10199192313300005340Switchgrass RhizosphereSAEFMSNFDRFNLNAQEGYLVSLIDGRLDVQKLMILSPFDPFNTIFILAKLQAERAITVPQ*
Ga0070691_1039726413300005341Corn, Switchgrass And Miscanthus RhizosphereNAQEGYLVSLIDGRMDLQKLQILSPFDPFTTMFIIAKLINERAITIPQ*
Ga0070687_10093628513300005343Switchgrass RhizosphereFDRFNLSAQEGYLVSLIDGRLDLQKLLILSPFDPFTTFFTLAKLQNERAISVPQ*
Ga0070661_10183228523300005344Corn RhizosphereGYLVSLIDGRLDLQKLVLLSPFDQFMTLFVLAKLANERAITVPQ*
Ga0070673_10092309623300005364Switchgrass RhizosphereFDKFDLNAQEGYLVSLIDGRMDLQKLQILSPFDPFNTLFILAKLAQERAITMPR*
Ga0070701_1107024013300005438Corn, Switchgrass And Miscanthus RhizosphereNFDRFNLSAQEGYLVSLIDGRFDLQKLLILSPFDQFSTFFNLAKLQQERAIIVPQ*
Ga0070694_10076221123300005444Corn, Switchgrass And Miscanthus RhizosphereNAQEGYLVSLIDGRLDVQKLLILSPFDSFNTIFILAKLQVERAITVSQ*
Ga0070708_10093825913300005445Corn, Switchgrass And Miscanthus RhizosphereSLIDGRLDLQKLVVLSPFDPFTTLFNLAKLQQERAITVP*
Ga0066681_1059273313300005451SoilQEGYLISLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAISVPQ*
Ga0066681_1081738713300005451SoilQEGYLVSLIDGRFDLQKLLILSPFDPFTTLFSLAKLQNERAISVPQ*
Ga0068867_10207009623300005459Miscanthus RhizosphereFLTNFDRFNLNAQEGYLVSLIDGRLDLQKLILLSPFDQFTTLFILAKLANERAITVPQ*
Ga0070706_10162905913300005467Corn, Switchgrass And Miscanthus RhizosphereTNFDRFNLSAQEGYLISLIDGRLALQKLLILSPFDAFTTLFNLAKLQHERAITVP*
Ga0070735_1007809543300005534Surface SoilLIDGRLDLQKLLILSPFDQFTTLFNLAKLQHERAITVPE*
Ga0070697_10056548123300005536Corn, Switchgrass And Miscanthus RhizosphereTAQEGYLISLIDGRMDMQKLLVLSPFDPFTTLFNLAKLQHERAITIPQ*
Ga0066700_1079901413300005559SoilVPRLTAEFLTNFDRFNLNAQEGYLISLIDGRLDLQKLLILSPFDPFTTLFNVAKLQYERAVMVPQ*
Ga0066699_1127167823300005561SoilAQEGYLISLIDGRLDLQKLLILSPFDPFTTLFNVAKLQYERAVMVPQ*
Ga0066693_1025755713300005566SoilRMDLQKLQILSPFDPFNTLFILAKLANERAITIPQ*
Ga0066706_1120191013300005598SoilSLIDGRMDLQKLQILSPFDPFTTMFIMAKLLQEQAITIPS*
Ga0068864_10249767723300005618Switchgrass RhizosphereDGRLDLQRLTILSPFDQFTTLFTLAKLQQERAMTMPQ*
Ga0075283_106927513300005891Rice Paddy SoilQEGYLVSLIDGRLDIQKLTILSPFDPFTTIFILAKLQQERAITVPQ*
Ga0075282_105306113300005896Rice Paddy SoilLIDGRLDLQKLLVLSPFDQFTTLFNLAKLQHERAITVP*
Ga0075279_1004589413300005903Rice Paddy SoilDGRLDLQKLLVLSPFDQFTTLFNLAKLQHERAITVP*
Ga0075280_1001934313300005904Rice Paddy SoilAVPKLTAEFLTNFDRFNLSAQEGYLVSLIDGRFDLQKLVILSPFDPFTTFFNLAKLQQERAITVPQ*
Ga0080026_1025621633300005952Permafrost SoilSAQEGFLVSLIDGRLDMQKLLILSPFDAFTTFFILAKLQNERAITVPA*
Ga0080027_1017603223300005993Prmafrost SoilFLVSLIDGRMDISKLMILSPFDPFTTLFNLAKLENERAITIPK*
Ga0066789_1024603113300005994SoilDGRMDISKLMILSPFDPFTTLFNLAKLENERAITIPK*
Ga0066696_1088669523300006032SoilLSAEFLTNFDRFNLSAQEGYLVSLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAISVPQ*
Ga0097691_119831623300006055Arctic Peat SoilLISLIDGRMDIQKLTILSPFDPFTTVFILAKLQNERAITVPQ*
Ga0097621_10104107023300006237Miscanthus RhizosphereLTAEFLSNFDRFNLTAQEGYLISLIDGRLDLQKLLILSPFDPFTTLFNLAKLQHERAITVPQ*
Ga0097621_10241656113300006237Miscanthus RhizosphereQEGYLVSLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAITVPQ*
Ga0068871_10222370423300006358Miscanthus RhizosphereSNFDRFNLTAQEGYLISLIDGRLDLQKLLILSPFDAFTTLFNLAKLQHERAITVPQ*
Ga0066658_1093924613300006794SoilRLDLQKLQILSPFDPFNTMFIMAKLVNERAITIPQ*
Ga0066659_1166461313300006797SoilVPRLSAEFLTNFDRFNLSAQEGYLVSLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAISVPQ*
Ga0075425_10202928913300006854Populus RhizosphereLIDGRFDLQKLLILSPFDPFTTLFTLAKLQNERAISVPQ*
Ga0073928_1079192313300006893Iron-Sulfur Acid SpringLISLIDGRLDLQKMLILSPFDPFTTLFNLAKLQQERAITVP*
Ga0075426_1137869713300006903Populus RhizosphereNAQEGYLVSLIDGRLDLQKLVLLSPFDQFTTLFILAKLAQERAITVPQ*
Ga0079218_1088324323300007004Agricultural SoilAQEGYLVSLIDGRLDVSKLLILSPFDPFNTIFILAKLLREKAITVPQ*
Ga0079218_1338624313300007004Agricultural SoilVPRLSAEFMSNFDRFNLNAQEGYLVSLIDGRLDIQKLLILSPFDPFNTIFSLARLQQERAITVPQ*
Ga0066710_10403000913300009012Grasslands SoilLAVPKLTAEFLTNFDRFNLSAQEGYLISLIDGRLALQKLLILSPFDPFTTLFNLAKLQHERAITVPS
Ga0099830_1176912723300009088Vadose Zone SoilSNFDRFNLTAQEGYLISLIDGRLDLQKLVILSPFDQFNTLFNLAKLQHERAITVPQ*
Ga0114129_1311452223300009147Populus RhizosphereDRFNLSAQEGFLVSLIDGRLDLQKLLILSPFDSFTTFFILAKLQHERAITVPQ*
Ga0105241_1124407513300009174Corn RhizosphereDGRLDLQKLLILSPFDQFTTLFTLAKLQHERAITVPQ*
Ga0105248_1147137023300009177Switchgrass RhizosphereAEFLTNFDKFNLSAQEGYLVSLIDGRLQLQKLLILSPFDQFTTLFNLSKLQHERAITIPQ
Ga0123573_1164565023300009509Mangrove SedimentLNEFDKFNLSAQEGYLISQIDGRTNIEKLLKLSPFDPFTTFFSLARMYQVRAIEISE*
Ga0126307_1155815523300009789Serpentine SoilLIDGRMDVQKLMILSPFDPFNTIFILATLQHERAITVP*
Ga0134080_1045265923300010333Grasslands SoilFDLQKLLILSPFDPFTTLFTLAKLQNERAISVPQ*
Ga0134080_1069377923300010333Grasslands SoilIDGRLALQKLLILSPFDPFTTLFNLAKLQHERAITVP*
Ga0134066_1011889123300010364Grasslands SoilLIDGRLDLQKLTILSPFDAFNTFFILAKLQQERAITVPQ*
Ga0134124_1022597413300010397Terrestrial SoilNFDRFNLNAQEGYLVSLIDGRLDLQKLVLLSPFDQFTTLFILAKLAYERAITVPQ*
Ga0134123_1301484023300010403Terrestrial SoilFDRFNLSAQEGFLVSLIDGRMDISKLMILSPFDPFSTLFNLAKLQNERAITIPQ*
Ga0139299_105166123300011007Basal IceNFDQFNLSAQEGYLISLIDGRLDLQKLMIISPFDQFTTLFYFAKLQQQRAILLPQ*
Ga0137392_1094321713300011269Vadose Zone SoilLNAQEGYLVSLIDGRMDLQKLQILSPFDPFNTMFIMAKLLQEHAITIPS*
Ga0137393_1164128523300011271Vadose Zone SoilRFNLTAQEGYLISLIDGRLDLQKLAILSPFDQFNTLFNLAKLQHERAITVPQ*
Ga0137427_1031552913300011445SoilMDVQKLMILSPFDQFTTLFLLAKLEHERAITVPT*
Ga0137461_101803433300012040SoilFDRFNLNAQEGYLVSLIDGRMDLQKLLILSPFDPFTSLFTLAKLQNERAISVPQ*
Ga0136623_1047449023300012045Polar Desert SandLSDFGRFNLSAQEGYLVSLIDGRLDLQKLLILSPFDAFTTLFNIAKLNSQKAITLPT*
Ga0137388_1020654333300012189Vadose Zone SoilFDRFNLSAQEGYLISLIDGRLDLNKLLILSPFDQFATLFNLAKLQHERAITIPQ*
Ga0137388_1099781613300012189Vadose Zone SoilRLSAEFLTNFDRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDPFTTLFNLAKMQHERAITIPQ*
Ga0164301_1097577623300012960SoilRFNLNAQEGYLVSLIDGRLDLQKLTILSPFDAFNTFFILAKLQQERAITVPQ*
Ga0134110_1042364023300012975Grasslands SoilDRFNLSAQEGYLISLIDGRLALQKLLILSPFDPFTTLFNLAKLQHERAITVP*
Ga0120127_1001500033300013503PermafrostFNLSAQEGFLVSLIDGRLDLQKLLILSPFDPFTTFFILAKLQHELAITVPS*
Ga0120135_103145823300014054PermafrostGRMDLQKLLILSPFDAFTTFFILAKLQNERAITVPT*
Ga0134079_1070656223300014166Grasslands SoilRLSAEFLTNFDRFNLNAQEGYLVSLIDGRLDLQKLTILSPFDAFNTFFILAKLQQERAITVPQ*
Ga0157377_1043436413300014745Miscanthus RhizosphereGRMDVQKLMILSPFDPFNTIFILAKLQHEKAITVPS*
Ga0180078_106545713300014865SoilLSAEFLTNFDRFNLNAQEGYLVSLIDGRMDLQKLLILSPFDPFTSLFTLAKLQNERAISVPQ*
Ga0180074_103806913300014877SoilRFNLNAQEGYLVSLIDGRLDVQKLMILSPFDPFTTIFILAKLQNERAIVVP*
Ga0157379_1048429013300014968Switchgrass RhizosphereIDGRLDLQKLVLLSPFDQFTTLFILAKLAYERAITVPQ*
Ga0137414_120544463300015051Vadose Zone SoilGYLMSLIDGRLDLQKLLILSPFDQFTTLFNLAKLQNERAITVPQ*
Ga0167652_106946113300015164Glacier Forefield SoilLSAQEGYLVSLIDGRFDLQKLLILSPFDPFTTLFNLSKLQQERAITVPQ*
Ga0167668_106718023300015193Glacier Forefield SoilDRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDPFTTLFNLAKLQHELAINIPQ*
Ga0136617_1025713023300017789Polar Desert SandGFKLTEQEGYLISLVEGSLSIEKLLRLSPTDHFTTLFNLARLAHLKAIVFSP
Ga0184629_1013025113300018084Groundwater SedimentKLTAEFLTNFDRFNLNAQEGYLVSLIDGRMDISKLMILSPFDPFSTLFNLAKLQNERAITIPQ
Ga0066669_1172198323300018482Grasslands SoilFNLSAQEGYLVSLIDGRLDLQKLLILSPFDPFNTLFHLAKLQQERAISVPQ
Ga0193751_115942913300019888SoilAQEGYLISLIDGRLDLQKMLILSPFDPFTTLFNLAKLQQERAITVP
Ga0213882_1038601413300021362Exposed RockLTAEFLTNFDRFNLSAQEGYLVSLIDGRFDMQKLLILSPFDQFTTLFTLAKLQQERAITVPQ
Ga0213882_1042927223300021362Exposed RockLIDGRLALQKLAILSPFDPFTTYFVLAKLQNERALTIPK
Ga0193699_1015039623300021363SoilRLTPEFLSNFDRFNLTAQEGYLVSLIDGRLDLQKLLILSPFDHFTTLFNLAKLEHERAITVPA
Ga0247692_102801013300024279SoilRLDLQKLLILSPFDPFTTLFNLAKLQQERAITVPK
Ga0209002_1063032913300025289SoilEGYLVSLIDGRLDVQKLMILSPFDPFSTIFILAKLQNERAILVP
Ga0207930_111571423300025604Arctic Peat SoilVSLIDGRLDLQKLSILSPFDQFTTLFILAKLQQEGALTIPQ
Ga0209584_1034903623300025878Arctic Peat SoilMQAMPKLTPEFLSNFDRFNLTAQEGYLVSLIDGRLDLQKLLLLSPFDHFTTLFNLAKLQHERAITVPQ
Ga0207684_1126477813300025910Corn, Switchgrass And Miscanthus RhizosphereEFLTNFDRFNLTAQEGYLVSLIDGRFDLQKLLVLSPFDPFTTLFNLAKLQHERAITVPQ
Ga0207646_1189244523300025922Corn, Switchgrass And Miscanthus RhizosphereLSAEFLTNFDRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDPFTTLFNLAKLQHERAITIPQ
Ga0207650_1028625133300025925Switchgrass RhizosphereIDGRLDLQKLLILSPFDQFTTLFTLAKLQHERAITVPQ
Ga0207644_1120242413300025931Switchgrass RhizosphereEGYLVSLIDGRLDLQKLVLLSPFDQFTTLFILAKLANERAITVPR
Ga0207669_1144414523300025937Miscanthus RhizosphereIDGRMDISKLMILSPFDPFSTLFNLAKLQNERAITIPQ
Ga0207704_1185051813300025938Miscanthus RhizosphereQDGYLVSLIDGRLDLQKLILLSPFDQFTTLFILAKLANERAITVPQ
Ga0207665_1073441833300025939Corn, Switchgrass And Miscanthus RhizosphereGRLDLQKLLILSPFDPFTTLFNLAKLQQERAITVPK
Ga0207689_1056326923300025942Miscanthus RhizosphereRFNLSAQEGYLVSLIDGRMDIQKLLILSPFDPFTTLFTLAKLQNERAISVPQ
Ga0207651_1119972923300025960Switchgrass RhizosphereAQEGYLVSLIDGRMDLQKLQILSPFDPFNTLFILAKLAQERAITMPR
Ga0207639_1084673213300026041Corn RhizosphereVPKLSPEFLTNFDRFNLNAQEGYLVSLIDGRLDLQKLVLLSPFDQFTTLFILAKLANERAITVPQ
Ga0207641_1164351523300026088Switchgrass RhizosphereIDGRLDLQKLVLLSPFDQFTTLFVLAKLAHERAITVPQ
Ga0209265_111291513300026308SoilAQEGYLMSLIDGRLDLQKLLILSPFDQFTTLFTLAKLQHERAITVPQ
Ga0209686_109315513300026315SoilLSAEFLTNFDRFNLNAQEGYLVSLIDGRMDLQKLQILSPFDPFNTMFIIAKLVYERAITIPQ
Ga0209801_112993813300026326SoilDRFNLTAQEGYLISLIDGRMDLQKLLVLSPFDSFTTLFNLAKLQQERAITVP
Ga0209514_1017837513300027819GroundwaterQEGYLISLIDGRTNIEKLLKLSPFDSFTTLFNLARLQNQKAIVVP
Ga0209798_1016628013300027843Wetland SedimentAQEGYLVSLIDGRLDLQKLLILSPFDQFTTLFNLAKLQHERAITIPQ
Ga0209168_1008371743300027986Surface SoilLIDGRLDLQKLLILSPFDQFTTLFNLAKLQHERAITVPE
Ga0310813_1140412013300031716SoilRLDLQKLTILSPFDAFNTFFILAKLQQERAITVPQ
Ga0307410_1098298313300031852RhizosphereLTNFDRFNLSAQEGYLVSLIDGRLDISKLVILSPFDQFTTLFILAKLDHERAITIPQ
Ga0307416_10249263823300032002RhizosphereLIDGRLDISKLLILSPFDPFTTLFNLAKLQYERAITIPQ
Ga0335076_1045257513300032955SoilAQEGYLVSLIDGRLDLQKLTILSPFDAFNTFFILSKLQQERAITVPQ
Ga0316621_1120002723300033488SoilDFLANAQGIRAIPKLSPEFLADFGRFNLSAQEGYLISLIDGRTNIEKLLKLSPFDQFSTLFNLARLQQQKAIVVPK
Ga0334929_128473_3_1643300034135Hypolithic BiocrustDRFNLNAQEGYLVSLIDGRMDVQKLMILSPFDPFNTIFILAKLQHERAITVPS
Ga0334945_109416_3_1823300034779Sub-Biocrust SoilDFLSNFDRFNLNAQEGYLVSLIDGRLDLQKLTILSPFDPFTTLFLLAKLQHEKAITVPQ


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.