NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F076024

Metagenome Family F076024

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076024
Family Type Metagenome
Number of Sequences 118
Average Sequence Length 46 residues
Representative Sequence MPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKQSDDAG
Number of Associated Samples 101
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 57.63 %
% of genes near scaffold ends (potentially truncated) 31.36 %
% of genes from short scaffolds (< 2000 bps) 91.53 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (66.102 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(12.712 % of family members)
Environment Ontology (ENVO) Unclassified
(33.898 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.220 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 45.95%    β-sheet: 0.00%    Coil/Unstructured: 54.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF13302Acetyltransf_3 8.47
PF01738DLH 5.93
PF01619Pro_dh 4.24
PF12796Ank_2 3.39
PF00248Aldo_ket_red 2.54
PF07606DUF1569 2.54
PF02687FtsX 2.54
PF13193AMP-binding_C 2.54
PF00106adh_short 1.69
PF13365Trypsin_2 1.69
PF01436NHL 0.85
PF01979Amidohydro_1 0.85
PF12680SnoaL_2 0.85
PF03060NMO 0.85
PF00486Trans_reg_C 0.85
PF13565HTH_32 0.85
PF03544TonB_C 0.85
PF13466STAS_2 0.85
PF05163DinB 0.85
PF01740STAS 0.85
PF07700HNOB 0.85
PF05591T6SS_VipA 0.85
PF14681UPRTase 0.85
PF13692Glyco_trans_1_4 0.85
PF01011PQQ 0.85
PF00916Sulfate_transp 0.85
PF00990GGDEF 0.85
PF12836HHH_3 0.85
PF07638Sigma70_ECF 0.85
PF12850Metallophos_2 0.85
PF08734GYD 0.85
PF10502Peptidase_S26 0.85
PF12867DinB_2 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG0506Proline dehydrogenaseAmino acid transport and metabolism [E] 4.24
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.85
COG0659Sulfate permease or related transporter, MFS superfamilyInorganic ion transport and metabolism [P] 0.85
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.85
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.85
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.85
COG2233Xanthine/uracil permeaseNucleotide transport and metabolism [F] 0.85
COG2252Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) familyNucleotide transport and metabolism [F] 0.85
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 0.85
COG3516Predicted component TssA of the type VI protein secretion systemIntracellular trafficking, secretion, and vesicular transport [U] 0.85
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.10 %
UnclassifiedrootN/A33.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908032|Perma_A_C_ConsensusfromContig102858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1353Open in IMG/M
2162886012|MBSR1b_contig_8370382All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium845Open in IMG/M
3300000881|JGI10215J12807_1106018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300000956|JGI10216J12902_101999534All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300000956|JGI10216J12902_109143830All Organisms → cellular organisms → Bacteria1121Open in IMG/M
3300000956|JGI10216J12902_117210001Not Available552Open in IMG/M
3300004114|Ga0062593_100255900All Organisms → cellular organisms → Bacteria1451Open in IMG/M
3300004156|Ga0062589_100635118All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium934Open in IMG/M
3300004156|Ga0062589_100925048Not Available806Open in IMG/M
3300004157|Ga0062590_101396734All Organisms → cellular organisms → Bacteria696Open in IMG/M
3300004463|Ga0063356_100614043Not Available1473Open in IMG/M
3300004463|Ga0063356_102128040All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300004463|Ga0063356_105278259All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_66_21555Open in IMG/M
3300004480|Ga0062592_101081452Not Available740Open in IMG/M
3300005328|Ga0070676_11471511Not Available524Open in IMG/M
3300005336|Ga0070680_101435040All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300005364|Ga0070673_100171983All Organisms → cellular organisms → Bacteria1850Open in IMG/M
3300005440|Ga0070705_101923488All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae504Open in IMG/M
3300005444|Ga0070694_101736293Not Available531Open in IMG/M
3300005526|Ga0073909_10574162All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300005545|Ga0070695_101073988All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae658Open in IMG/M
3300005578|Ga0068854_101228517All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300005615|Ga0070702_100858201All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium707Open in IMG/M
3300005836|Ga0074470_10711031All Organisms → cellular organisms → Bacteria3774Open in IMG/M
3300005842|Ga0068858_100818891Not Available909Open in IMG/M
3300005844|Ga0068862_101168519All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300006638|Ga0075522_10078031All Organisms → cellular organisms → Bacteria1837Open in IMG/M
3300006852|Ga0075433_10726817Not Available869Open in IMG/M
3300006881|Ga0068865_101953949Not Available532Open in IMG/M
3300007004|Ga0079218_10261898Not Available1374Open in IMG/M
3300007004|Ga0079218_13412412Not Available539Open in IMG/M
3300009094|Ga0111539_13475017Not Available506Open in IMG/M
3300009156|Ga0111538_10430898Not Available1671Open in IMG/M
3300009177|Ga0105248_10082748All Organisms → cellular organisms → Bacteria3610Open in IMG/M
3300009553|Ga0105249_10755590All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → Aquabacterium commune1035Open in IMG/M
3300009777|Ga0105164_10059305All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2037Open in IMG/M
3300009811|Ga0105084_1063413All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300009813|Ga0105057_1118388All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300010159|Ga0099796_10161011All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300010379|Ga0136449_102216559All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300010403|Ga0134123_11647489Not Available691Open in IMG/M
3300011269|Ga0137392_11158806All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300011270|Ga0137391_10663676All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300011419|Ga0137446_1177853Not Available514Open in IMG/M
3300011423|Ga0137436_1087628Not Available815Open in IMG/M
3300011437|Ga0137429_1207743Not Available611Open in IMG/M
3300011445|Ga0137427_10124353All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1051Open in IMG/M
3300012038|Ga0137431_1078909Not Available914Open in IMG/M
3300012200|Ga0137382_11123639Not Available561Open in IMG/M
3300012211|Ga0137377_10277940All Organisms → cellular organisms → Bacteria1607Open in IMG/M
3300012231|Ga0137465_1200949Not Available598Open in IMG/M
3300012361|Ga0137360_11873520Not Available505Open in IMG/M
3300012363|Ga0137390_11971126Not Available510Open in IMG/M
3300012683|Ga0137398_10076772All Organisms → cellular organisms → Bacteria2051Open in IMG/M
3300012685|Ga0137397_10487961Not Available918Open in IMG/M
3300012917|Ga0137395_10501290All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae874Open in IMG/M
3300012925|Ga0137419_10548484All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300012943|Ga0164241_10415532All Organisms → cellular organisms → Bacteria → Acidobacteria965Open in IMG/M
3300014326|Ga0157380_10428159Not Available1264Open in IMG/M
3300014326|Ga0157380_10622582All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300014326|Ga0157380_12518345Not Available580Open in IMG/M
3300014968|Ga0157379_10212502All Organisms → cellular organisms → Bacteria → Proteobacteria1751Open in IMG/M
3300015200|Ga0173480_10480802Not Available739Open in IMG/M
3300015372|Ga0132256_102716240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300015373|Ga0132257_101393956Not Available892Open in IMG/M
3300017997|Ga0184610_1176113All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae709Open in IMG/M
3300018027|Ga0184605_10425564All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300018061|Ga0184619_10531476All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300018071|Ga0184618_10418122All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae566Open in IMG/M
3300018073|Ga0184624_10178080Not Available943Open in IMG/M
3300018075|Ga0184632_10441152All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium541Open in IMG/M
3300018422|Ga0190265_10470769All Organisms → cellular organisms → Bacteria → Proteobacteria1365Open in IMG/M
3300018422|Ga0190265_12804147Not Available582Open in IMG/M
3300018429|Ga0190272_10575042All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis980Open in IMG/M
3300018469|Ga0190270_11088105Not Available832Open in IMG/M
3300018476|Ga0190274_10427077All Organisms → cellular organisms → Bacteria1296Open in IMG/M
3300018476|Ga0190274_11533698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium758Open in IMG/M
3300018481|Ga0190271_12317582All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M
3300019361|Ga0173482_10281961All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300020059|Ga0193745_1062761All Organisms → cellular organisms → Bacteria → Acidobacteria812Open in IMG/M
3300021078|Ga0210381_10181184All Organisms → cellular organisms → Bacteria → Acidobacteria728Open in IMG/M
3300021080|Ga0210382_10010385All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3148Open in IMG/M
3300021080|Ga0210382_10014796All Organisms → cellular organisms → Bacteria2726Open in IMG/M
3300021080|Ga0210382_10043179All Organisms → cellular organisms → Bacteria1748Open in IMG/M
3300021080|Ga0210382_10125329Not Available1087Open in IMG/M
3300021432|Ga0210384_11309672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium629Open in IMG/M
3300021478|Ga0210402_11495051Not Available603Open in IMG/M
3300022756|Ga0222622_11054440All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300022756|Ga0222622_11247074All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae547Open in IMG/M
3300025173|Ga0209824_10050662All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1598Open in IMG/M
3300025311|Ga0209343_10004692All Organisms → cellular organisms → Bacteria16833Open in IMG/M
3300025553|Ga0208080_1040405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1293Open in IMG/M
3300025885|Ga0207653_10167321All Organisms → cellular organisms → Bacteria → Acidobacteria816Open in IMG/M
3300025938|Ga0207704_11468226Not Available585Open in IMG/M
3300025941|Ga0207711_10219973All Organisms → cellular organisms → Bacteria → Acidobacteria1736Open in IMG/M
3300025941|Ga0207711_11144502All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium719Open in IMG/M
3300026089|Ga0207648_11050348Not Available763Open in IMG/M
3300027903|Ga0209488_10677463All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae741Open in IMG/M
3300027903|Ga0209488_11218884Not Available506Open in IMG/M
3300028784|Ga0307282_10472038Not Available609Open in IMG/M
3300028812|Ga0247825_10055548All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2633Open in IMG/M
3300028828|Ga0307312_10332568Not Available992Open in IMG/M
3300030006|Ga0299907_10144604All Organisms → cellular organisms → Bacteria → Acidobacteria1965Open in IMG/M
3300031538|Ga0310888_10201957Not Available1093Open in IMG/M
3300031740|Ga0307468_100193664All Organisms → cellular organisms → Bacteria1366Open in IMG/M
3300031908|Ga0310900_10289782All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300031908|Ga0310900_10585820All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300031940|Ga0310901_10532776All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300031949|Ga0214473_10078954All Organisms → cellular organisms → Bacteria → Acidobacteria3849Open in IMG/M
3300032000|Ga0310903_10812758All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300032075|Ga0310890_10622714Not Available837Open in IMG/M
3300032122|Ga0310895_10566541All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300032163|Ga0315281_10890473All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300033412|Ga0310810_11399178Not Available535Open in IMG/M
3300033811|Ga0364924_157068All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300034128|Ga0370490_0266337All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium566Open in IMG/M
3300034178|Ga0364934_0093928All Organisms → cellular organisms → Bacteria1125Open in IMG/M
3300034257|Ga0370495_0001257All Organisms → cellular organisms → Bacteria8091Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.71%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil6.78%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.08%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.08%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment4.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.24%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.39%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.39%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.54%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.54%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater1.69%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.69%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.69%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.69%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.69%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.69%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.85%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.85%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.85%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300009813Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025173Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes)EnvironmentalOpen in IMG/M
3300025311Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes)EnvironmentalOpen in IMG/M
3300025553Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034257Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Perma_A_C_037171402124908032SoilILGGMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALHSKKPSDDVG
MBSR1b_0922.000036502162886012Miscanthus RhizosphereGILGGMPPAPKMSKSERIAARLKKKKSGPSAVKRAAARQALQTKKQSDEAP
JGI10215J12807_110601823300000881SoilMPKAPKMTLTERAAARLKKKKSGPSAMKRAAARQALQKKTDA*
JGI10216J12902_10199953423300000956SoilMPPAPKLSKADRAAARLKKKKSGPSAMKRAAARQALQSKKSPDDPGSGDTPEAPK*
JGI10216J12902_10914383013300000956SoilMAKAPKMTPTERAAARLKKKKTGPSAVKRATARQALQKKTDE*
JGI10216J12902_11721000123300000956SoilMTPTERAAARLKKKSGPSALKRAKAREALQKKTDA*
Ga0062593_10025590023300004114SoilMPPAPKMSKSERIAARLKKKKSGPSAVKRAAARQALQTKKQSDEAP*
Ga0062589_10063511823300004156SoilMPKAPKMTLTERAAARLKKKKSGPSAVKRATARQALQKKTDA*
Ga0062589_10092504823300004156SoilMPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKPSDDAG*
Ga0062590_10139673423300004157SoilMSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGTDEGA*
Ga0063356_10061404323300004463Arabidopsis Thaliana RhizosphereVWRSYTCLMAKAPKMTPTERAAARLKKKKSGPSALKRAKAREALQKKTDA*
Ga0063356_10212804023300004463Arabidopsis Thaliana RhizosphereMASAPKLSKSERAALRLKKKKSGPSAVKRATARQALQPKKESDESA*
Ga0063356_10527825923300004463Arabidopsis Thaliana RhizosphereMATAPKLSKSEREAARLKKKKSGPSAVKRATARQALQTKKPAEEGG*
Ga0062592_10108145223300004480SoilMPPAPKLSKAERAAARLKKKKSGPSAMKRAAARHALQTKKPSDEAG*
Ga0070676_1147151123300005328Miscanthus RhizosphereMPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKPSDEAG*
Ga0070680_10143504013300005336Corn RhizosphereHRGILGGMPPAPKMSKSERIAARLKKKKSGPSAVKRAAARQALQTKKQSDEAP*
Ga0070673_10017198333300005364Switchgrass RhizosphereMSKSERVAARLKKKKSGPSAVKRATARQALQTKKGTDEGS*
Ga0070705_10192348823300005440Corn, Switchgrass And Miscanthus RhizosphereDRAAARLKKKKSGPSAVKRAAARQALQTKKSSEDAEPSAGG*
Ga0070694_10173629323300005444Corn, Switchgrass And Miscanthus RhizosphereMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKT
Ga0073909_1057416223300005526Surface SoilMPAAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGTDEGA*
Ga0070695_10107398813300005545Corn, Switchgrass And Miscanthus RhizosphereRAAARLKKKKSGPSAVKRAAARQALQSKKPSDDAEPSASG*
Ga0068854_10122851723300005578Corn RhizosphereMSKSERAAARLKKKKSGPSAVKRAAARQALQAKKGTDEGS*
Ga0070702_10085820113300005615Corn, Switchgrass And Miscanthus RhizosphereMSKSERVAARLKKKKSGPSAVKRATARQALQTKKSTDEGS*
Ga0074470_1071103133300005836Sediment (Intertidal)MSKTERAAARLKKKKSGPSAMKRAAARASLQTKKSDDAAAG*
Ga0068858_10081889123300005842Switchgrass RhizosphereMPAAPKMSKSERVAARLKKKKSGPSAVKRATARQALQTKK
Ga0068862_10116851923300005844Switchgrass RhizosphereMSKSERIAARLKKKKSGPSAVKRAAARQALQTKKQSDEAP*
Ga0075522_1007803133300006638Arctic Peat SoilMASTAKLTKAERAAARLKKKKSGPSAMKRIAARAALQTKKSDEPAS*
Ga0075433_1072681723300006852Populus RhizosphereMPPAPKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKKQSDDAAGSEG*
Ga0068865_10195394913300006881Miscanthus RhizosphereMSKADKAAARLKKKKSGPSAVKRATARQALQTKKPAD
Ga0079218_1026189823300007004Agricultural SoilKLSKSERAAARLKKKKSGPSAVKRAAARQALQTKKPADTPGEG*
Ga0079218_1341241213300007004Agricultural SoilMPPAPKLSKSERAAARLKKKKSGPSAVKRTAARQALQPKKPEDAGG*
Ga0111539_1347501723300009094Populus RhizosphereMPSAPKLSKSDRAAARLKKKKSGPSAVKRAAARQALQ
Ga0111538_1043089823300009156Populus RhizosphereMAKAPKMTVTERAAARLKKKKSGPSAVKRATARQALQKKTDA*
Ga0105248_1008274813300009177Switchgrass RhizospherePAPKMSKSERAAARLKKKKSGPSAVKRAAARQALQAKKGTDEGS*
Ga0105249_1075559023300009553Switchgrass RhizosphereMASAPKLTKSERIAARLKKKKSGPSAVKRAAARQALQPKKQEDAGG*
Ga0105164_1005930513300009777WastewaterMPPATKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKKHSDDVT*
Ga0105084_106341323300009811Groundwater SandMSPATKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKK
Ga0105057_111838813300009813Groundwater SandMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKESGDAA*
Ga0099796_1016101123300010159Vadose Zone SoilMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKSSEDADPSASG*
Ga0136449_10221655923300010379Peatlands SoilMPSIPKLSKSERAAAHLKKKKSGPSAMKRAAARQALQTKKSPDGAA*
Ga0134123_1164748933300010403Terrestrial SoilMASAPKLSKSERIAARLKKKKSGPSAVKRATARQALQPKKQEDAGG*
Ga0137392_1115880623300011269Vadose Zone SoilMPSVPKLSKTERAAARLKKKKSGPSAMKRIAARAALQTKKSDDAAS*
Ga0137391_1066367623300011270Vadose Zone SoilMASVPKLSKSERAAARLKKKKSGPSAMKRIAARAALQTKKSDDAAS*
Ga0137446_117785323300011419SoilMPSAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQAKKQSDATGEGGLPPNP*
Ga0137436_108762823300011423SoilMPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKESDAPG
Ga0137429_120774323300011437SoilMPSAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQAKKQSDATG
Ga0137427_1012435323300011445SoilMPPAPKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKKSSEDPGSGDTPEAPK*
Ga0137431_107890923300012038SoilMAKAPKTTLTERAAARLKKKKSGPSALKRAKAREALQKKTDA*
Ga0137382_1112363923300012200Vadose Zone SoilVYRVRGILVGMPAAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKSSEDAEPSTSG*
Ga0137377_1027794013300012211Vadose Zone SoilMNTVQTRGILGGMPPAPKLSKSEREAARLKKKKSGPSALKRAAARQA
Ga0137465_120094913300012231SoilKLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKPSDDAG*
Ga0137360_1187352033300012361Vadose Zone SoilKKKKSGPSAVKRAAARQALQSKKSSEGADPSASG*
Ga0137390_1197112623300012363Vadose Zone SoilMPSVPKLSKSERAAARLKKKKSGPSAMKRIAARAALQTKKSDDAAS*
Ga0137398_1007677233300012683Vadose Zone SoilMPAAPKLSKSERAARLKKKKSGPSAVKRAAARQALQSKKSSEDADPSASG*
Ga0137397_1048796123300012685Vadose Zone SoilPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKQQDDVR*
Ga0137395_1050129023300012917Vadose Zone SoilYRVRGILVGMPAAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKSSEDADPSASG
Ga0137419_1054848423300012925Vadose Zone SoilMPAAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKSSEDAEPSASG*
Ga0164241_1041553233300012943SoilMAKAPKMTKTERAAARLKKKKSGPSALKRAAARKDLQ
Ga0157380_1042815923300014326Switchgrass RhizosphereMPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQSKKSSDDAGSGDTPEAPK*
Ga0157380_1062258223300014326Switchgrass RhizosphereMPKAPKMTLTERAAARLKKKKSGPSAVKRATARQALQKKTDE*
Ga0157380_1251834523300014326Switchgrass RhizosphereMAKAPKMTPTERAAARLKKKKSGPSALKRAKAREGLQKKTNA*
Ga0157379_1021250223300014968Switchgrass RhizosphereMAKAPRLSKSERIAGRLKKKTSGASAMKRAAARKELHAKKESADA*
Ga0173480_1048080223300015200SoilDRAAARLKKKKSGPSAMKRAAARQALQSKKSSDEAGSGESPEATK*
Ga0132256_10271624023300015372Arabidopsis RhizosphereAARLKKKKSGPSAVKRAAARQALQTKKSADEGERPS*
Ga0132257_10139395613300015373Arabidopsis RhizosphereMPSAPKLSKSDRAAARLKKKKSGPSAVKRAAARQALQAKKSSDEAGSGESPEATK*
Ga0184610_117611313300017997Groundwater SedimentPKLSKSDRAAARLKKKKSGPSAVKRAAARQALQSKKSSEDADPSASG
Ga0184605_1042556423300018027Groundwater SedimentMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQPKKNSDDVA
Ga0184619_1053147613300018061Groundwater SedimentLIGILGGMPPAPKVSKSERAAARLKKKKSGPSAVKRATARQALQTKKPTDEAG
Ga0184618_1041812223300018071Groundwater SedimentGILVGMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKTSDDGEPSANG
Ga0184624_1017808023300018073Groundwater SedimentMAKAPKMTVTERAAARLKKKKSGPSAVKRATARQALQKKTDA
Ga0184632_1044115223300018075Groundwater SedimentMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKQSDDAG
Ga0190265_1047076923300018422SoilMPSAPKLSKSERAAARLKKKKSGPSAVKRATARQALHAKKQPDAPGEGG
Ga0190265_1280414723300018422SoilMAKAPKMTPTERAAARLKKKKSGPSAVKRATARQALQKKTDA
Ga0190272_1057504233300018429SoilMPSAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQTKKPSEEVG
Ga0190270_1108810513300018469SoilMPSAPKLSKSERAAARLKKKKSGPSAMKRAAARQALQAKKQSDASGEGG
Ga0190274_1042707723300018476SoilMPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQSKKSSDDPGSGDTPEAPK
Ga0190274_1153369823300018476SoilMPSAPKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKKSSDEPGSGDAPDASK
Ga0190271_1231758223300018481SoilMPKAPKMTLTERAAARLKKKKTGPSAVKRATARQALQKKTDA
Ga0173482_1028196113300019361SoilMPSTPKLSKSDRAAARLKKKKSGPSAMKRAAARQALQSKKSSDEAGSGESPEATK
Ga0193745_106276123300020059SoilMSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGTDEGA
Ga0210381_1018118423300021078Groundwater SedimentMSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGTDESA
Ga0210382_1001038533300021080Groundwater SedimentMPPAPKLSKSDRAAARLKKKKSGPSAVKRATARQALQTKKPSEEGE
Ga0210382_1001479633300021080Groundwater SedimentMPPTVKAPKVSKSDRAAARLKKKKSGPSAVKRAAARQALQTKKPSDAAG
Ga0210382_1004317923300021080Groundwater SedimentMPAAPKLSKSDRAAARLKKKKSGPSAVKRAAARQALQTKKPSEDGEPSASG
Ga0210382_1012532923300021080Groundwater SedimentMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKTSEDGEPSANG
Ga0210384_1130967233300021432SoilASCRQRYTRCMASIAKLSKTERAAARLKKKKTGPSAMKRIAARAALQTKKSDEPAS
Ga0210402_1149505123300021478SoilMASIVKLSKTERAAARLKKKKTGPSAMKRIAARAALQTKKSDEPAS
Ga0222622_1105444013300022756Groundwater SedimentMASVPKLSKSDRAAARLKKKKSGPSAVKRAAARQALQTKKGTDEGA
Ga0222622_1124707423300022756Groundwater SedimentPTPKTGQGVYGVRGILVGMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKTSDDGEPSANG
Ga0209824_1005066213300025173WastewaterMPPATKLSKSERAAARLKKKKSGPSAMKRAAARQALQSKKHSDDVT
Ga0209343_1000469253300025311GroundwaterMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKQPS
Ga0208080_104040533300025553Arctic Peat SoilVRGILGGMPPAPKLSKSERAAARLKKKKSGPSAVKRAATRQALHSKKPSDDVG
Ga0207653_1016732123300025885Corn, Switchgrass And Miscanthus RhizosphereMSKSERIAARLKKKKSGPSAVKRAAARQALQTKKQSDEAP
Ga0207704_1146822613300025938Miscanthus RhizosphereMSKADKAAARLKKKKSGPSAMKRAAARQALQTKKPSDESA
Ga0207711_1021997313300025941Switchgrass RhizosphereMSKSERVAARLKKKKSGPSAVKRATARQALQTKKSTDEGS
Ga0207711_1114450233300025941Switchgrass RhizosphereKSERVAARLKKKKSGPSAVKRATARQALQTKKSTDEGS
Ga0207648_1105034813300026089Miscanthus RhizosphereMPPAPKMSKADKAAARLKKKKSGPSAVKRATARQALQTKKPADDAG
Ga0209488_1067746323300027903Vadose Zone SoilGILVGMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKSSEDADPSASG
Ga0209488_1121888423300027903Vadose Zone SoilILGVMPSAPKLSKSERAAARLKKKKSGPSAMKRATARQALQTKKDTA
Ga0307282_1047203823300028784SoilMPPAPKMSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGTDEGA
Ga0247825_1005554823300028812SoilMATAPKLSKSEREAARLKKKKSGPSAVKRATARQALQTKKPAEEGG
Ga0307312_1033256813300028828SoilMPPAPKMSKSERAAARLKKKKSGPSAVKRAAARQALQTKKGAD
Ga0299907_1014460423300030006SoilMATAPKLSKSEREAARLKKKKSGPSAVKRATARQALQPKKQSDDAG
Ga0310888_1020195713300031538SoilMPSTPKLSKSDRAAARLKKKKSGPSAMKRAAARQALQSKKS
Ga0307468_10019366423300031740Hardwood Forest SoilMPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKPSEEAG
Ga0310900_1028978233300031908SoilMPAAPKLSKSQRAEARLKKKKSGPSAMKRAAARKAL
Ga0310900_1058582013300031908SoilMPKAPKMTLTERAAARLKKKKSGPSAVKRATARQALQKKTDE
Ga0310901_1053277613300031940SoilTPKLSKSDRAAARLKKKKSGPSAMKRAAARQALQSKKSSDEAGSGESPEATK
Ga0214473_1007895453300031949SoilMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKD
Ga0310903_1081275823300032000SoilMPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQSKKSSDEAGSGESPEATK
Ga0310890_1062271413300032075SoilMPSTPKLSKSDRAAARLKKKKSGPSAMKRAAARQALQSKKSSDEAGSGES
Ga0310895_1056654113300032122SoilMPPAPKLSKADRAAARLKKKKSGPSAMKRAAARQALQSKKSSDDP
Ga0315281_1089047323300032163SedimentMAQAPKLSKSDRAAARLKKKKSGPSAVKRAAARQSLQSKKPEDVG
Ga0310810_1139917823300033412SoilMPPAPKLSKAERAAARLKKKKSGPSAMKRAAARQALQTKKPSDDAG
Ga0364924_157068_105_2453300033811SedimentMPPAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKHSDDVG
Ga0370490_0266337_395_5353300034128Untreated Peat SoilMPSAPKLSKSERAAARLKKKKSGPSAMKRAAARQALQTKKQSDAPG
Ga0364934_0093928_856_9993300034178SedimentMPPAPKLSKSERVAARLKKKKSGPSAVKRAAARQALQSKKDSAGGKS
Ga0370495_0001257_4969_51303300034257Untreated Peat SoilMPSAPKLSKSERAAARLKKKKSGPSAVKRAAARQALQSKKPSDEPGSGDTPNP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.