NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076027

Metagenome / Metatranscriptome Family F076027

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076027
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 114 residues
Representative Sequence MNDFELESKLKSVRVPERPEEYWNDFPSRVRVQLRRERREFAPQSAWRPRLAWAGGFALAVALVFVCVQFHPLQTVSLAITKQQRQFHTQLARLDVGLHKLMLNTDGMGYLLTEAN
Number of Associated Samples 79
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 31.36 %
% of genes near scaffold ends (potentially truncated) 27.12 %
% of genes from short scaffolds (< 2000 bps) 69.49 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.831 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(22.881 % of family members)
Environment Ontology (ENVO) Unclassified
(55.932 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(34.746 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 67.36%    β-sheet: 0.00%    Coil/Unstructured: 32.64%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF08281Sigma70_r4_2 38.14
PF00437T2SSE 22.88
PF00482T2SSF 4.24
PF00578AhpC-TSA 3.39
PF13482RNase_H_2 2.54
PF13580SIS_2 1.69
PF14659Phage_int_SAM_3 0.85
PF05170AsmA 0.85
PF00294PfkB 0.85
PF01343Peptidase_S49 0.85
PF01081Aldolase 0.85
PF01894UPF0047 0.85
PF00475IGPD 0.85
PF11762Arabinose_Iso_C 0.85
PF13407Peripla_BP_4 0.85
PF00480ROK 0.85
PF03144GTP_EFTU_D2 0.85
PF10825DUF2752 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.69
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.69
COG0131Imidazoleglycerol phosphate dehydratase HisBAmino acid transport and metabolism [E] 0.85
COG0432Thiamin phosphate synthase YjbQ, UPF0047 familyCoenzyme transport and metabolism [H] 0.85
COG08002-keto-3-deoxy-6-phosphogluconate aldolaseCarbohydrate transport and metabolism [G] 0.85
COG2982Uncharacterized conserved protein AsmA involved in outer membrane biogenesisCell wall/membrane/envelope biogenesis [M] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.68 %
UnclassifiedrootN/A9.32 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001213|JGIcombinedJ13530_105418728All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium794Open in IMG/M
3300004152|Ga0062386_101571785Not Available548Open in IMG/M
3300004806|Ga0007854_10145921All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300005439|Ga0070711_100001668All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia12290Open in IMG/M
3300006104|Ga0007882_10057002All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1573Open in IMG/M
3300006638|Ga0075522_10000296All Organisms → cellular organisms → Bacteria35036Open in IMG/M
3300009651|Ga0105859_1190505All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium598Open in IMG/M
3300010341|Ga0074045_10257355All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1153Open in IMG/M
3300010341|Ga0074045_10746764All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium620Open in IMG/M
3300010343|Ga0074044_10233589All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300010379|Ga0136449_104478220All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3514Open in IMG/M
3300014159|Ga0181530_10179947All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1180Open in IMG/M
3300014159|Ga0181530_10379919All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium723Open in IMG/M
3300014160|Ga0181517_10001434All Organisms → cellular organisms → Bacteria26523Open in IMG/M
3300014160|Ga0181517_10016105All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula5399Open in IMG/M
3300014160|Ga0181517_10125480All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1466Open in IMG/M
3300014161|Ga0181529_10022258All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula5174Open in IMG/M
3300014161|Ga0181529_10029472All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula4261Open in IMG/M
3300014161|Ga0181529_10213609Not Available1123Open in IMG/M
3300014161|Ga0181529_10631274Not Available557Open in IMG/M
3300014162|Ga0181538_10274996All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia921Open in IMG/M
3300014165|Ga0181523_10237590All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1044Open in IMG/M
3300014167|Ga0181528_10001522All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales14402Open in IMG/M
3300014168|Ga0181534_10186588All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1077Open in IMG/M
3300014199|Ga0181535_10109007All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1775Open in IMG/M
3300014200|Ga0181526_10033833All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula3294Open in IMG/M
3300014200|Ga0181526_10048728All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2707Open in IMG/M
3300014201|Ga0181537_10162044All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1535Open in IMG/M
3300014201|Ga0181537_10230601All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1272Open in IMG/M
3300014491|Ga0182014_10216462All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1025Open in IMG/M
3300014493|Ga0182016_10004756All Organisms → cellular organisms → Bacteria14897Open in IMG/M
3300014494|Ga0182017_10301774All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1003Open in IMG/M
3300014494|Ga0182017_10478706All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula765Open in IMG/M
3300014496|Ga0182011_10142471All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1656Open in IMG/M
3300014496|Ga0182011_10329668All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1008Open in IMG/M
3300014496|Ga0182011_10555524All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia734Open in IMG/M
3300014498|Ga0182019_10159507All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1435Open in IMG/M
3300014498|Ga0182019_10240462All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1187Open in IMG/M
3300014498|Ga0182019_10714671Not Available711Open in IMG/M
3300014498|Ga0182019_10833780Not Available661Open in IMG/M
3300014499|Ga0182012_10114056All Organisms → cellular organisms → Bacteria2004Open in IMG/M
3300014502|Ga0182021_10941678All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1039Open in IMG/M
3300014655|Ga0181516_10458194All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula653Open in IMG/M
3300014655|Ga0181516_10572964All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia581Open in IMG/M
3300014838|Ga0182030_10008768All Organisms → cellular organisms → Bacteria20855Open in IMG/M
3300014838|Ga0182030_10129670All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales3309Open in IMG/M
3300014839|Ga0182027_10418404All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1484Open in IMG/M
3300016701|Ga0181509_1174724All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia934Open in IMG/M
3300016705|Ga0181507_1067039All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium790Open in IMG/M
3300017988|Ga0181520_10000986All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales60185Open in IMG/M
3300017988|Ga0181520_10005636All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula19791Open in IMG/M
3300017988|Ga0181520_10005707All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula19633Open in IMG/M
3300017988|Ga0181520_10038947All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula4763Open in IMG/M
3300017988|Ga0181520_10053384All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula3817Open in IMG/M
3300017988|Ga0181520_10592337All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia771Open in IMG/M
3300017988|Ga0181520_10774096All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium649Open in IMG/M
3300017998|Ga0187870_1046407All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1887Open in IMG/M
3300018024|Ga0187881_10304106All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium661Open in IMG/M
3300018046|Ga0187851_10658575Not Available591Open in IMG/M
3300021861|Ga0213853_11135892All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium918Open in IMG/M
3300022524|Ga0224534_1001462All Organisms → cellular organisms → Bacteria12419Open in IMG/M
3300022863|Ga0224532_1048333Not Available564Open in IMG/M
3300023088|Ga0224555_1011603All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula5303Open in IMG/M
3300023090|Ga0224558_1141495All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia783Open in IMG/M
3300025862|Ga0209483_1000137All Organisms → cellular organisms → Bacteria69893Open in IMG/M
3300025916|Ga0207663_10001385All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula11252Open in IMG/M
3300026456|Ga0255351_1075429All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium627Open in IMG/M
3300028556|Ga0265337_1003245All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales7109Open in IMG/M
3300028556|Ga0265337_1015725All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2467Open in IMG/M
3300028558|Ga0265326_10027644All Organisms → cellular organisms → Bacteria1617Open in IMG/M
3300028563|Ga0265319_1194287All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia623Open in IMG/M
3300028573|Ga0265334_10003854All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula6767Open in IMG/M
3300028573|Ga0265334_10265691All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia589Open in IMG/M
3300028577|Ga0265318_10014790All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula3267Open in IMG/M
3300028653|Ga0265323_10065940All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1248Open in IMG/M
3300028653|Ga0265323_10096063All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium985Open in IMG/M
3300028666|Ga0265336_10037426All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1491Open in IMG/M
3300028800|Ga0265338_10026052All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula5912Open in IMG/M
3300028800|Ga0265338_10048422All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula3866Open in IMG/M
3300029911|Ga0311361_10171452All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2767Open in IMG/M
3300029913|Ga0311362_10289785All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1723Open in IMG/M
3300029913|Ga0311362_11231939Not Available553Open in IMG/M
3300029914|Ga0311359_10767090All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia681Open in IMG/M
3300029914|Ga0311359_11103389All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium527Open in IMG/M
3300029915|Ga0311358_10538834All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia898Open in IMG/M
3300029922|Ga0311363_10042539All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula7253Open in IMG/M
3300029922|Ga0311363_11395120Not Available571Open in IMG/M
3300029939|Ga0311328_10997700All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia546Open in IMG/M
3300029954|Ga0311331_11535395All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3542Open in IMG/M
3300029957|Ga0265324_10036142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens1718Open in IMG/M
3300029957|Ga0265324_10231999All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium627Open in IMG/M
3300030002|Ga0311350_11419698All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium617Open in IMG/M
3300030688|Ga0311345_10781762All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium752Open in IMG/M
3300030943|Ga0311366_10788364All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia825Open in IMG/M
3300031235|Ga0265330_10182914All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia888Open in IMG/M
3300031235|Ga0265330_10354703All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia619Open in IMG/M
3300031240|Ga0265320_10428842All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia584Open in IMG/M
3300031247|Ga0265340_10010750All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula4890Open in IMG/M
3300031247|Ga0265340_10107349All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1293Open in IMG/M
3300031344|Ga0265316_10100861All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2194Open in IMG/M
3300031344|Ga0265316_10118975All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300031344|Ga0265316_10540903All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula830Open in IMG/M
3300031524|Ga0302320_10006896All Organisms → cellular organisms → Bacteria25101Open in IMG/M
3300031524|Ga0302320_10219111All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2683Open in IMG/M
3300031524|Ga0302320_10371573All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1828Open in IMG/M
3300031711|Ga0265314_10567016All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium589Open in IMG/M
3300031726|Ga0302321_100438552All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1430Open in IMG/M
3300031726|Ga0302321_101052210All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula928Open in IMG/M
3300031902|Ga0302322_103538317Not Available535Open in IMG/M
3300031910|Ga0306923_11422383All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula729Open in IMG/M
3300032261|Ga0306920_102993902All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia638Open in IMG/M
3300032770|Ga0335085_11465183All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3713Open in IMG/M
3300032770|Ga0335085_11824573All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium622Open in IMG/M
3300032805|Ga0335078_10336853All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula2010Open in IMG/M
3300033433|Ga0326726_10193613All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales1874Open in IMG/M
3300033982|Ga0371487_0031398All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula3379Open in IMG/M
3300034195|Ga0370501_0228229Not Available661Open in IMG/M
3300034282|Ga0370492_0055171All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales1630Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog22.88%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere19.49%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog10.17%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen9.32%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen5.93%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.24%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog4.24%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil4.24%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.54%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.69%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.69%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.69%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.69%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.85%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.85%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.85%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.85%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300006104Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300009651Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016701Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300022863Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 1-5EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025862Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026456Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r2EnvironmentalOpen in IMG/M
3300028556Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaGHost-AssociatedOpen in IMG/M
3300028558Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaGHost-AssociatedOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028573Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaGHost-AssociatedOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300028653Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaGHost-AssociatedOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029913III_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029957Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaGHost-AssociatedOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031240Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M
3300034282Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ13530_10541872823300001213WetlandYWNDFPSRVRVQLPRERREFATQRTWRPRLAWAGGFALAVALVFVCVQFHPAQTLSLAVEKQQQQFHARLARLDAGLHRLMLNTDGMGDLLTEAN*
Ga0062386_10157178513300004152Bog Forest SoilMNDFDLESKLKRVRVPERPDKYWNDFPSRVRVQLRQARIESAPRRQWRPRLAWAGGFALSLALAFVCIEYHPLRAASAAITQNERHFHGQLARLDAGLHKLILNTDGMGYLLTEAN*
Ga0007854_1014592113300004806FreshwaterYWNDFPSQVRMQLPRPRKELSPRPAVGWRFAFAGGFALALVLVCIQFHPLQTVSLAFAKQERHFHLQLARLDTGLHRLMLNTDGMGYLLAEAN*
Ga0070711_100001668133300005439Corn, Switchgrass And Miscanthus RhizosphereMNDFELESKLRSVRVPERPEEYWNDFPSRVRVQLPRERREFAPRNAWRPRLAWAGGLALAVALVIFCIQFHPLQTVSLAITKQQRQFHAQLARLDIGLHKLMLNTDGMGYLLTEAD*
Ga0007882_1005700223300006104FreshwaterMNDFDLESKLKSLRVPGRTEAYWNDFPSQVRMQLPRPRKELSPRPAVGWRFAFAGGFALALVLVCIQFHPLQTVSLAFAKQERHFHLQLARLDTGLHRLMLNTDGMGYLLAEAN*
Ga0075522_10000296363300006638Arctic Peat SoilMNDFDLDSKLKSVPLPERPDEYWHEFPSGVRVQLRRERPESAPRRAWRPRLAWAGGFALAVALVLVCVQYHPFQTMALAITKQQRHFHAQLARLDAGLHVLMLNTDGMGYLLTEAN*
Ga0105859_119050523300009651Permafrost SoilFELESKLKSVRVPERPEEYWNDFPSRVRVQLPRARREFAPQSAWRPRLAWAGGFALAVALVFVCVQFHPLQTVSLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTE*
Ga0074045_1025735523300010341Bog Forest SoilMNDFELESKLKNVRVPERPDEYWTDFPSRVRVQLRRERREFAPQSAWRPRLAWAGGLAMAVALVFVCVQFHPLQAASLAITKQQRHFQAQLAQLDAGLHVLMLNTDGMGYLLTEAN*
Ga0074045_1074676423300010341Bog Forest SoilMNDFELESKLKSLRVPDRPDEYWEDFPSRVRVQLRRERREFTAWRPRLAWASGFALTMALVLVCVQFRPFQTVSLAITKQQRHFHAQLAQLDNGLHKLMLNTDGMGYLLAEAN*
Ga0074044_1023358923300010343Bog Forest SoilMNDFELESKLKSVRMPEHPDEYWNDFPSRVRVQLRRGRPEFAPRHAWRPRLAWAGGFALAVALVFVCVQFHPLETVSLAVTKQQRHFHAQLVRLDAGLHVLMLNTDGMGYLLTEAN*
Ga0136449_10447822023300010379Peatlands SoilMNDRDLEAKLKSVRVPELPDEYWDDFPSRVRVQLGRERQEFRPRPAWRPGLAWAGGLALAVATLVFCLDLHVIQAVSVAIDRHEGRLHAQLARLDAGLH
Ga0181530_1017994723300014159BogMNDFELETKLKKVRVPERPDEYWDDFPSRVRVQLPRERREFAPQSAGRPRLAWACGLALAFALVFVCVEFHPFQTVSLAITKQQRQFHAQLARLDAGLHVLMLNTDGMGYLLTEAN*
Ga0181530_1037991923300014159BogMRAPQAMNDFELESKLKSVRVPERPDEYWDDFPSRVRMQLPRERREFMPQSAWRPRLAWAGGFALAVALVFVCVQFHPLQTVSLAITKQQRQFHMQLARLDVGLHKLMLNTDGMGYLLTEAN*
Ga0181517_10001434163300014160BogMNDFELESKLKSVRVPERPEEYWNDFPARVRMQLPRERREFTPQYAGRPRLAWACSLALAVALVFVCVQLHPLQTASLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTEAN*
Ga0181517_1001610523300014160BogMERKLITKKMNDFELESKLKSVRVPERPEEYWNDFPSRVRVQLRGERQEFVPQNVWRPRLAWAGGFALAVALVFACVQFHPLQTVSLAITKQQRQFHTQLAKLDVGLHKLMLNTDGMGYLLTEAN*
Ga0181517_1012548023300014160BogMNDFELESKLKSVRVPERPDEYWNDFPSRVRVQLHREHREFAPQNAWRPHLAWAGGFALAVALVFVCVQFHPLQTMSLAITKQQRHSHAQLARLDAGLHALMLNTDGMGYLLTEAN*
Ga0181529_1002225843300014161BogMERKLITKKMNDFELESKLKSVRVPERPEEYWNDFPSRVRVQLRGERQEFVPQNVWRPRLAWAGGFALAVALMFACVRFHPLQTVSLAITKQQRQFHTQLARLDVGLHKLMLNTDGMGYLLTEAN*
Ga0181529_1002947253300014161BogMNNAELESKLKCVPVPERPEEYWAEFPSRVRVQLRRERPEFVPRPTWHIRPAWAGSFALAMTLVLVCLQYHPLQAASATVTRHERHLSAQLARLDTGLHRLILNTDGMGYLLGEAN*
Ga0181529_1021360933300014161BogFELESKLKSVRVPERAKEYWNDFPSSVRMQLPRERREFTPQNAGRPHLAWAGGLALAVALVLACVQFHPLQTASLAITKQQRQLHAQLARLDTGLHKLMLNTDGMGYLLTEAN*
Ga0181529_1063127423300014161BogFELESKLKSVRVPERAKEYWNDFPSSVRMQLPRERREFTPQYAGRPRLAWACSLALAVALVFVCVQFHPLQTASLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTEAN*
Ga0181538_1027499623300014162BogMNDFELESKLKSVRVPERPDEYWDDFPSRVRMQLPRERREFMPQSAWRPRLAWAGGFALAVALVFVCVQFHPLQTVSLAITKQQRQFHMQLARLDVGLHKLMLNTDGMGYLLTEAN*
Ga0181523_1023759023300014165BogDFELESKLKSVRVPERPDEYWDDFPSRVRMQLPRERREFMPQSAWRPRLAWAGGFALAVALVFVCVQFHPLQTVSLAITKQQRQFHMQLARLDVGLHKLMLNTDGMGYLLTEAN*
Ga0181528_1000152293300014167BogMNDFELDGKLKSVAPPKRSDDYWENFPSQVRVQLHHLRPAAPSHPSGGWQFAWASCAALALILVCAEFHPLQTVSLAITKQDRHFHMELARLDSGLHKLMLNTDGMGYLLTEAN*
Ga0181534_1018658813300014168BogMNDFELESKLKSLRVPERPEEYWNDFPSRVRVQLPRERREFAPRSAWRSRLAWAGGLALAVALVFVCIQFHPLRTVSLAITKQQHQFHAQLARLDAG
Ga0181535_1010900733300014199BogMNDFELESKLKSVRVPERAKEYWNDFPSSVRMQLPRERREFTPQNAGRPHLAWAGGLALAVALVLACVQFHPLQTASLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTEAN*
Ga0181526_1003383323300014200BogMERKLITKKMNDFELESKLKSVRVPERPDEYWNDFPSRVRVQLRGERQEFVPQNVWRPRLAWAGGFALAVALEFACVQFHPLQTVSLAITKQQRQFHTQLAKLDVGLHKLMLNTDGMGYLLTEAN*
Ga0181526_1004872823300014200BogMNDFELESKLKSVRVPERPDEYWDDFPSRVRMQLPRERREFAPRSAWRPRLALAGGFALAVALVFVCVQFHPFQTASLAITKQQRQFHAQLARLDIGLHKLMLNTDGMGYLLTEAN*
Ga0181537_1016204423300014201BogREKEIETVADGQWKTTMNDFDLESKLKSVPVPARTEDYWENFPSQVRASLHHAPVEFAPRNFWLPRPVWSGGFALALALVFVCVQFHPLQTMSLAITKQQRHFHTQLARLDAGLHVLMLNTGGMGYLLADAN*
Ga0181537_1023060133300014201BogMKDFNLDAKMKSLCVPERTEEYWIDFPAQVRVQLHHSRPELSPRPFGGLRFACAGCFALALILVCFEFHPLRIVSLAITKQEHHFHMQLARLDTGLHKLMLNTDGMGYLLAEAN*
Ga0182014_1021646223300014491BogMNDFELESKLKSVPLPERPDEYWNDFPSRVRVQLPRERREFAPQSAGRPRLAWAVGLVLAVVLVFGCIRFHPLQTMSLAITKQQQHFHARLARLDAGLHVLMLNTDGMGYLLTEAN*
Ga0182016_1000475663300014493BogMNDFGLESKLKSLRVPERTQEYWNDFPSQVRVQLRRSRPEFSPRSFSSLRFACGGGFALALVMVCFQFHPLQTVSLAIAKQERHFHTQLARLDTGLHKLMLNTDGMGYLLTEAN*
Ga0182017_1030177423300014494FenMKDFELESKLKSVRVPERPDEYWNDFPARVRVQLRRERREFAPQSAWRPRLAWAGGFALAVALVFVCVQFHPLQTASLAITKQQRQFHAQLARLDTGLHVLMLNTHGMGYLLTEAN*
Ga0182017_1047870623300014494FenMNDFELESKLKSLRVPERPEEYWNDFPSRVRVQLPRERREFAPQSAWHPRLAWAGGFALAVALVLVCIQYHPFQAMSLAITKQQHQFHAQLARLDTGLHKLMLNTDGMGYLLTE*
Ga0182011_1014247133300014496FenMKDFELESKLKSVPVPERPDEYWNDFPARVRVQLRRERREFAPQSAWRPRLAWAAGFALAVALVFVCVQFHPLQTASLAITKQQRQFHAQLARLDTGLHVLMLNTHGMGYLLTEAN*
Ga0182011_1032966823300014496FenMNDFELESKLKSVRVPERPEEYWNDFPSRVRVQLPRERREFAPQSAWHPRLAWAGGFALAVALVLVCVQYHPFQAMSLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTE*
Ga0182011_1055552423300014496FenMNDFELESKLKSACVPERPEEYWSDFPSRVRVQLPRERWKFAPQGAGHPRLAWAGGLALAVVLVFACVQFHPFQTTSFAITKQQRQFHAQLARLDAGLHALMLNTHGMGYLLTEQN*
Ga0182019_1015950723300014498FenMNDFELESKLKSVRVPERPEEYWNDFPSRVRMQLPRERREFAPQSAWRPRLAWAGGFALAMVMVFACIQFHPLQTASLAIARQQQHFHAHLARLNAGLHVLMLNTNGMGYLLAEAN*
Ga0182019_1024046223300014498FenMKDFELESKLKSVRVPERPDEYWNDFPARVRVQLRRERREFAPQSAWRPRLAWAAGFALAVALVFVCLEFHPLQTTTTAIAWHEQHLRAHLAQLETGLHRLMLNTDGMGYLLAEAN*
Ga0182019_1071467123300014498FenMNDFELESKLKSVRVPERPEEYWNDFPSRVRVQLRREHPEFTPHCAWRPRLAWAGGFALAVALVFVCVQFHPLQTVSLAITTQQRHFHAQLARLDAGLHKLMLNTDGMGYLLTEAD*
Ga0182019_1083378023300014498FenMNDFDLESKLKSIRVSERPDEYWNDFPSRIRVQLPHERRELAPQSGWHPRLAWAGGFALAVALVLGCIQFHPLQIMSLAIAKQERHVHLQLARLDTGLHKLMLNTDGMGYLLAEAD*
Ga0182012_1011405633300014499BogMNDFDLESKLKSVPVPARTEDYWENFPSQVRASLHHAPVEFAPRNFWLPRPVWSGGFALALALVFVCVQFHPLQTMSLAITKQQRHFHTQLARLDAGLHVLMLNTGGMGYLLADAN*
Ga0182021_1094167823300014502FenETLAVCIGRARHSVRAAAETKAARRGLRAPPNDMNDFELESKLKSVRVPERPEEYWNDFPSRVRVQLRREHPEFTPHCAWRPRLAWAGGFALAVALVFVCVQFHPLQTVSLAITTQQRHFHAQLARLDAGLHKLMLNTDGMGYLLTEAD*
Ga0181516_1045819423300014655BogMNGFELESKLKSIRVPERPEEYWDDFPSRVRVQLRRERREVAPRSAGRPRLAWAGGFALAVALMFSCVQLHPLRTMSLAITKQQRQFHAQLARLDAGLHVLILNTDGMGYLLTEAN*
Ga0181516_1057296413300014655BogMNDFDLESKLKSVRVPERSDEYWDDFPARVRMQLGRERGVFTPRPAWRPRLAWAGGLALTVAVLSVCLDFHLVKAVSVAIDRHEGRLHAQLARLDAGLHKLVLNTDGMGYLLSEPN*
Ga0182030_1000876843300014838BogMNDFDLESKLKSLRVPERTEAYWNDFTTQVRVQLHRSRPELPTRSSGGLRFAFAGCFALALILVCFQFHPLQTVSLTIAKQERHFHMQLARLDSGLHKLMLNTDGMGYLLAEAN*
Ga0182030_1012967033300014838BogMKDFNLDAKLKSLCVPERTEEYWNDFPAQVRVQLHHSRPELSPRPFGGLRFACAGCFALALILVCFEFHPLQIVSLAITKQEHHFHMQLARLDTGLHKLMLNTDGMGYLLAEAN*
Ga0182027_1041840423300014839FenMNDFKLESKLKSVRVPERPDEYWNDFPSRVRVQLRRERPEFTPQSAWRPRLAWAGGFALAVALVFVCVQFHPLQTASLAITKQQRHFQAQLARLDAGLHMLMLNTDGMGYLLTEPN*
Ga0181509_117472423300016701PeatlandMNDFELESKLKSVRVPERAKEYWNDFPSSVRMQLPRERREFTPQNAGRPHLAWAGGLALAVALVLACVQFHPLQTASLAITKQQRQLHAQLARLDTGLHKLMLNTDGMGYLLTEAN
Ga0181507_106703923300016705PeatlandDEYWDDFPSRVRMQLPRERREFMPQSAWRPRLAWAGGFALAVALVFACVQFHPLQTVSLAITKQQRQFHMQLARLDVGLHKLMLNTDGMGYLLTEAN
Ga0181520_10000986303300017988BogMNDFDLESKLKGVCVPERPEEYWNDFPSRIRVQLRREQPQMAPRPAWRTRLMWASNFALTTAVLFICIQYHPLRSTTTAIIKQERCFHAQLARLDGGLHRLMLNTDGMGYLLMDAN
Ga0181520_10005636203300017988BogMNDFELESKLKSVRVPERPDEYWNDFPSRVRVQLHREHREFAPQNAWRPHLAWAGGFALAVALVFVCVQFHPLQTMSLAITKQQRHSHAQLARLDAGLHALMLNTDGMGYLLTEAN
Ga0181520_10005707153300017988BogMERKLITKKMNDFELESKLKSVRVPERPDEYWNDFPSRVRVQLRGERQEFVPQNVWRPRLAWAGGFALAVALVFACVQFHPLQTVSLAITKQQRQFHTQLAKLDVGLHKLMLNTDGMGYLLTEAN
Ga0181520_1003894753300017988BogMNNAELESKLKCVPVPERPEEYWAEFPSRVRVQLRRERPEFVPRPTWHIRPAWAGSFALAMTLVLVCLQYHPLQAASATVTRHERHLSAQLARLDTGLHRLILNTDGMGYLLGEAN
Ga0181520_1005338463300017988BogMNDFELESKLKSVRVPERPEEYWNDFPARVRMQLPRERREFTPQYAGRPRLAWACSLALAVALVFVCVQLHPLQTASLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTE
Ga0181520_1059233713300017988BogKSVRVPERPEEYWNDFPARVRMQLPRERREFTPQSAGRPWFAWTGGFALAVVLVFVCVQFHPLQTASLAITKQQRQFHVRLARLDAGLHKLMLNTGGMGYLLTEAN
Ga0181520_1077409613300017988BogMNDFELESKLKSVRVPERAKEYWNDFPSSVRMQLPRERREFTPQNAGRPHLAWAGGLALAVALVLACVQFHPLQTASLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTEAN
Ga0187870_104640733300017998PeatlandMNDIELESKLKSVRVPERPDEYWNDFPSRVRVQLRRERPEFAPRSAWRPRLAWAGGFALAVALVFVCVQFHPLQTVSLAITTQQRHFHAQLARLDAGLHKLMLITDGMGYLLTEAD
Ga0187881_1030410613300018024PeatlandHAARITRRSTTARQKMRAPPAMNDFELESKLKSVRVPERPEEYWNDFPSRVRVQLPRERREFAPQSAWRPRLAWAGGLALAMALVFVCIQFHPLQTMSLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTE
Ga0187851_1065857513300018046PeatlandMNDFELESKLKSVRVPERPDEYWDDFPSRVRMQLPRERREFMPQSAWRPRLAWAGGFALAVALVFVCVQFHPLQTVSLAITKQQRQFHMQLARLDVGLHKLMLNTDGMGYLLTEAN
Ga0213853_1113589223300021861WatershedsMNDFELESKLRSVPMPERPDEYWEDFPARVRVQLHRERRDGVPRRAVRPQLAWAGGIALATILAFAWIQFDPLQTISLAFAKQQRHFQAQLSRLDAGLHRLMLNTDGMGYLLAEAN
Ga0224534_100146223300022524SoilMNDFELESKLKSVRVPERPEEYWNDFPSRVRVQLPRERREFVPQNAWRPRLAWAGGFALAVALLFVCIELHPFQTVSLAITKQQRHFHTQLARLDAGLHVLMLNTDGMGYLLTEAN
Ga0224532_104833313300022863SoilMNDLDLELKLKSVRVPDRPDEYWENFPSRIRVQLRRDRLEFAPQSAWRPRLAWAGGFAMAVVLAFVCVQFHPLQTVSLAIVKQQRHFHAQLARLDTGLHKLMLNTDGMGYLLAEAN
Ga0224555_101160363300023088SoilMNDIELESKLKSVRVPERTQEYWNDFPSHVRMQLPRERREFTPQYAGRPRLAWACGLALAVAVVFVCVQFHPFQTVSLAITKQQRQFHTQLARLDAGLHVLMLNTDHMGYLLTEAN
Ga0224558_114149523300023090SoilMNDFELESKLKSVPLPERPDEYWNDFPSRVRVQLPRERREFAPQSAGRPRLAWAVGLVLAVVLVFGCIRFHPLQTMSLAITKQQQHFHARLARLDAGLHVLMLNTDGMGYLLTEAN
Ga0209483_1000137323300025862Arctic Peat SoilMNDFDLDSKLKSVPLPERPDEYWHEFPSGVRVQLRRERPESAPRRAWRPRLAWAGGFALAVALVLVCVQYHPFQTMALAITKQQRHFHAQLARLDAGLHVLMLNTDGMGYLLTEAN
Ga0207663_10001385163300025916Corn, Switchgrass And Miscanthus RhizosphereMNDFELESKLRSVRVPERPEEYWNDFPSRVRVQLPRERREFAPRNAWRPRLAWAGGLALAVALVIFCIQFHPLQTVSLAITKQQRQFHAQLARLDIGLHKLMLNTDGMGYLLTEAD
Ga0255351_107542913300026456SoilYWNDFPSRVRMQLPRERREFTPQNAGRSRLAWACGLALAVALVFVCVQFHPLQTASFAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTEAN
Ga0265337_100324543300028556RhizosphereMNDLELESKLKSVRVPERPDEYWNDFPSHVRVQLRRERREFVPQSVWRPRFAWAGGFALAVALVFVCVQFHPLQTASLAITKQQRHFQAQLARLDAGLHVLMLNTDGMGYLLTEAN
Ga0265337_101572543300028556RhizosphereMNDFELESKLKSIRVPERPEEYWNEFPSSVRVQLRRERREFEPQSVRRPRLAWAGGFALAVALVFVCVQFHPLRTMSLAITKQQHQFHAQLARLDAGLHVLMLNTDGMGYLLTEAN
Ga0265326_1002764423300028558RhizosphereMNDFELESKLKSLRVPERPEEYWSDFPSRVRVQLPRERPEFAPQNAWRPQFAWAGGFALAVALVLVCVQYHPLQTVSLAITKQQHQFHAQLARLYTGLHKLMLNTDGMGYLLNE
Ga0265319_119428723300028563RhizosphereMNDFELESKLKSVPLPERTDEYWNDFPSRVRVQLRRERGEFTPQSVWRPRLAWAGGLALAVALVFVCVQFHPLQTASLAITKQQRQFHAQLARLDAGLHVL
Ga0265334_1000385423300028573RhizosphereMNDFELESKLKSLRVPERPEEYWSDFPSRVRVQLPRERPEFAPQNAWRPQFAWAGGFALAVALVLVCVQYHPLQTVSLAITKQQHQFHAQLARLDTGLHKLMLNTDGMGYLLNE
Ga0265334_1026569123300028573RhizosphereMNDFELESKLKSVPLPERTDEYWNDFPSRVRVQLRRERGEFTPQSVWRPRLAWAGGLALAVALVFVCVQFHPLQTESLAITKQQRQFHAQLARLDAGLH
Ga0265318_1001479033300028577RhizosphereMNDFELESKLKSVPLPERTDEYWNDFPSRVRVQLRRERGEFTPQSVWRPRLAWAGGLALAVALVFVCVQFHPLQTASLAITKQQRQFHAQLARLDAGLHVLMLNTDGMGYLLTEAN
Ga0265323_1006594013300028653RhizosphereDFELESKLKSVRVPERPEEYWNDFPSRVRVQLRRERREFAPQSAWRPRLAWAGGFALAVALVFVCVQFHPLQTVSLAITKQQRQFHTQLARLDVGLHKLMLNTDGMGYLLTEAN
Ga0265323_1009606313300028653RhizosphereMNDFELESKLKSVRVPERPEAYWEDFPSRVRVQLPRERREFARQRARGLRLAWAGGFAMAAALVIFCAEYHPFQTMSLAITKQQRQFHAQLARLDAGLHMLM
Ga0265336_1003742623300028666RhizosphereMNDFELESKLKSLRVPERPEEYWNDFPSRVRKQLPRERREFAPQSAWRPRLAWAGGFALAVALAVVCVQFHPLQTVSLAITKQQHQFHAQLARLDTGMHKLMLNTDGMGYLLTE
Ga0265338_1002605253300028800RhizosphereMNDFELESKLKDVRVPERTEEYWNDFPSRVRVQLRRERREFAPQSVWRPRLEWAGGLALAVALVFVCVQFHPLQTMSLAITKQQRQFHTQLVRLDAGLHKLMLNTDGMGYLLTEAN
Ga0265338_1004842233300028800RhizosphereMNDFDLESKLKNVRLPERPDGYWNDFPSRVRVQLRRERREFKPQYAHRPRLAWAGGFALAVALVFICVQFHPFQTVSLAITKQQRQFHAQLARLDAGLHVLMLNTDGMGYLLTEAN
Ga0311361_1017145233300029911BogVADGQWKTTMNDFDLESKLKSVPVPARTEDYWENFPSQVRASLHHAPVEFAPRNFWLPRPVWSGGFALALALVFVCVQFHPLQTMSLAITKQQRHFHTQLARLDAGLHVLMLNTGGMGYLLADAN
Ga0311362_1028978523300029913BogMNDLELESKLKSFRVPERTEEYWNDFPSRVRMQMPRARREFTTQNAGRPRLAWVCGLALAVALVFVCVQFHPLQTASLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTEAN
Ga0311362_1123193923300029913BogMKDFNLDAKLKSLCVPERTEEYWNDFPAQVRVQLHHSRPELSPRPFGGLRFACAGCFALALILVCFEFHPLQIVSLAITKQEHHFHMQLARLDTGLHKLMLNTDGMGYLLAEAN
Ga0311359_1076709013300029914BogMNDFDLESKLKSLRVPARTEEYWNDFPSQVRVQLRQARPELSERSFGGLRFAFAGGFALALILVCIEFHPLQTVSLAIAKQERHLHTQLARLDTGLHKLMLNTDG
Ga0311359_1110338913300029914BogMNDFELESKLKSVRVPERRGEYWDDFPSRIRVQLRRDRWESAPQSAWRPRPAWVGGFAVAMVLVYVGVHFHPFQNVSLAITKQQRHFHSQLVRLDAGLHVLMLNTDHMG
Ga0311358_1053883423300029915BogEYWNDFPSRVRMQLPRERREFTPQNAGRPRLAWVCGLALAVALVFVCVQFHPLQTASLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTEAN
Ga0311363_1004253953300029922FenMNDFDLESKLKSVPVPARTEDYWENFPSQVRASLHHAPVEFAPRNFWLPRPVWSGGFALALALVFVCVQFHPLQTMSLAITKQQRHFHTQLARLDAGLHVLMLNTGGMGYLLADAN
Ga0311363_1139512013300029922FenMNDFELESKLKSVRVPERRGEYWDDFPSRIRVQLRRDRWESAPQSAWRPRPAWVGGFAVAMVLVYVGVHFHPFQNVSLAITKQQRHFHSQLVRLDAGLHVLMLNTDHMGYLLTEAN
Ga0311328_1099770013300029939BogMNDFDLESKLKSVPVPARTEDYWENFPSQVRASLHHAPVEFAPRNFWLPRPVWSGGFALALALVFVCVQFHPLQTMSLAITKQQRHFHTQLARLDAGLHVLMLNTGGMGYL
Ga0311331_1153539513300029954BogMKDFNLDAKMKSLCVPERTEEYWNDFPAQVRVQLHHSRPELSPRPFGGLRFACAGCFALALILVCFEFHPLQIVSLAITKQEHHFHMQLARLDTGLHKLMLNTDGMGYLLAEAN
Ga0265324_1003614233300029957RhizosphereMNDFELESKLKSLRVPECPEEYWNDFPSRVRMQLPRERREFAPQSAWRPRLVWAGGFALAVALVFVCVQFHPLQTVSLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTE
Ga0265324_1023199923300029957RhizosphereMNDFELESKLKSLRVPERPEEYWSDFPSRVRVQLPRERPEFAPQNAWRPQFAWAGGFALAVALVLVCVQYHPLQTVSLAITKQQHQFHAQLARLDTGLHKLMLNTDGMGYLLTE
Ga0311350_1141969823300030002FenMNDFELESKLKGARVPERPEEYWNDFPSRVRVQLPRERRELTPQYAWHQRFALAGGFALVMALVFVSVQFHPLRMMSLAITKQQRQFHAQLARLDAGLHKLMLNT
Ga0311345_1078176213300030688BogVARVRREKEIETVADGQWKTTMNDFDLESKLKSVPVPARTEDYWENFPSQVRASLHHAPVEFAPRNFWLPRPVWSGGFALALALVFVCVQFHPLQTMSLAITKQQRHFHTQLARLDAGLHVLMLNTGGMGYLLADAN
Ga0311366_1078836413300030943FenMNDFELESKLKGARVPERPEEYWNDFPSRVRVQLPRERRELTPQYAWHQRFALAGGFALVMALVFVSVQFHPIRTMSLAITKQQRQFHTQLARLDAGLHKIMLNTDGMGYLLTEAN
Ga0265330_1018291423300031235RhizosphereMNDFELESKLKSVRVPERPEEYWNDFPSRVRVQLRRERREFAPQSAWRPRLAWAGGFALAVALVFVCVQFHPLQTVSLAITKQQRQFHTQLARLDVGLHKLMLNTDGMGYLLTEAN
Ga0265330_1035470323300031235RhizosphereMNDFELESKLKSVRVPERPEAYWEDFPSRVRVQLPRERREFAPQRARGLRLAWAGGFAMAAALVIFCAEYHPFQTMSLAITKQQRQFHAQLARLDAGLH
Ga0265320_1042884213300031240RhizosphereMNDFELESKLKSVRVPERPEEYWNDFPSRVRVQLRRERREFAPQSAWRPRLAWAGGFALAVALVFVCVQFHPLRTMSLAITKQQHQFHAQLARLDAGLHVLMLNTDGMGYLLTEAN
Ga0265340_1001075053300031247RhizosphereMNDFELESKLKSVRVPERTEAYWEDFPSRVSVQLPRERRGFAPQRAWGLRLARAGGFALAVALVFACVEFHPLRAVSLAITKQQRQIHAQLARLDTGLHKLMLNTDGMGYLLTEAN
Ga0265340_1010734923300031247RhizosphereMNDFELESKLKSVRVPERPEAYWEDFPSRVRVQLPRERREFARQRARGLRLAWAGGFAMAAALVIFCAEYHPFQTMSLAITKQQRQFHAQLARLDAGLHMLMLNTDGMGYLLTEAN
Ga0265316_1010086123300031344RhizosphereMNDFELESKLKSVRVPERPEAYWEDFPSRVRVQLPRERREFAPQRARGLRLAWAGGFAMAAALVIFCAEYHPFQTMSLAITKQQRQFHAQLARLDAGLHMLMLNTDGMGYLLTEAN
Ga0265316_1011897533300031344RhizosphereMNDFELESKLKSVRVPERPDDYWNDFPSRVRVQLPRERREVAPRSAWRPRLAWAGGFALAVALVFVCAQFHPLQTVSLAITKQQRQFHAQLARLDAGLHVLMLNTDGMGYLLTEAN
Ga0265316_1054090323300031344RhizosphereMNDFELESKLKSVRVPERPEEYWNDFPSCVRVQLPRERREFEPQSAWRPRLAWAGGFALAATLVFVCVQFHPLQTASLAITKQQRQFHTQLARLDAGLHVLMLNTDGMGYLLTEAN
Ga0302320_10006896103300031524BogMNDFDLESKLKSLRVPARTEEYWNDFPSQVRVQLRQARPELSERSFGGLRFAFAGGFALALILVCIEFHPLQTVSLAIAKQERHLHTQLARLDTGLHKLMLNTDGMGYLLAEAN
Ga0302320_1021911133300031524BogMNGFELESKLKSIRVPERPEEYWDDFPSRVRVQLRRERREVAPRSAGRPRLAWAGGFALAVALMFSCVQLHPLRTMSLAITKQQRQFHAQLARLDAGLHVLILNTDGMGYLLTEAN
Ga0302320_1037157323300031524BogMNDFELESKLKSLRVPERPEEYWDDFPSRVRVQLPRQRREFVPQNAWRPRLAWAGGLALAVALVFACVEFRPIQTMSLAITKQQRQFHSQLARLDAGLHKIMLNTDGMGYLLTEAN
Ga0265314_1056701623300031711RhizosphereERTDEYWNDFPSRVQLRRERREFTAQSAWRPRLAWAGGLALTVALVFVCVQFHPLQTASLAITKQQRQFHAQIARLDAGLHVLMLNTDGMGYLLTEAN
Ga0302321_10043855213300031726FenMNDFDLESKLKSVRVPERPEEYWSDFPSRVRVQLPRERREYTPQYAWHQRFALAGGLAMVMALVFVSVQFHPLRTMSLAITKQQRQFHAQLARLDAGLH
Ga0302321_10105221023300031726FenMNDFELESKLKSARVPERPDEYWNDFPSRVRVQLPRQRREFAPQSVWRPRLAWAGGLALAVVLVLACIEFRPIQTVSLAITKQQRQFHTQLARLDAGLHKIMLNTDGMGYLLTEAN
Ga0302322_10353831713300031902FenMNDFELESKLKSVRVPERPDEYWNDFPSRVRVQLRRERHEFAPRRAWHPRLAWAGGFALAVALVFVCVQFHPLHTVSLAIATQQRHFHAQLARLDAGLHKLMLITDGMGYLLTEAD
Ga0306923_1142238323300031910SoilMNDFELESKLKSVRVPERPDEYWNDFPAQVRGQLHRARPELPPRQFNGWRFAWAGGFTLALILICFRFHPIETVSLAITKQECHFHMQLARLDTGLHKLMLNTDGMGYLLAEAN
Ga0306920_10299390223300032261SoilMNDFELESKLKSVRVPERPDEYWNDFPAQVRGQLHRARPELPPRQFNGWRFAWAGGFTLALILICFRFHPIETVSLAITKQECHFHMQLARLDTGLHKLMLNTDGM
Ga0335085_1146518313300032770SoilMNDFELESKLKGVRVPERSEEYWNDFPSRVRVQLPRERPEFAPHSAGRPRLAWAGGFALAVALVFACVQYHPLQTVSLAMTKQQRHFHAQLARLDAGLHVLMLNTDGMGYLLTDAN
Ga0335085_1182457323300032770SoilMNDFDLESRLKSARVPERPDEYWEDFPSRIRVQLRRERREFARQSAWRPRFGWAGGFALAVALVFVCIEFHPLQTMSHAITKQQRHFHAQLARLDTGLHKLMLNTDGVGYL
Ga0335078_1033685343300032805SoilMNDFDLESKLKSVRVPERSDEYWKDFPSRVRVQLPRERREFALQSPWRPRLAWAGGFALAVALVFVCVRFHPFQTVSLAITKQQRHFHTQLARLDAGLHV
Ga0326726_1019361323300033433Peat SoilMNDFELVSKLKSVRLPERPEEYWNDFPSRVRVQLPRVRREFMPQSAWHPRFAWAGGLALAMALVFVSVQFHPLRTMSLAITKQQRQFHVQLARLDIGLHKLMLNTDGMGYLLTETD
Ga0371487_0031398_2138_24883300033982Peat SoilMNDFELESKLKSVRVPERAKEYWNDFPSSIRMQLPRERREFTPQNAGRPHLAWAGGLALAVALVLACVQFHPLQTASLAITKQQRQFHAQLARLDTGLHKLMLNTDGMGYLLTEAN
Ga0370501_0228229_3_4013300034195Untreated Peat SoilREKEIKAPAGCHWRKTMNDFELESKLKSVRVPERPEEYWNDFPSRVRVQLRRERPEFAPQSAWRPRLAWAGGFALAVALVFVCVQFHPLQTMSLAITKQQRHFQAQLARLDAGLHVLMLNTDGMGYLLTEAN
Ga0370492_0055171_424_7683300034282Untreated Peat SoilMNDFDLESKLGNLRVPERTEEYWNDFPLQVRMQLHRSRSELSPRSFGGLRFACAGCFALALILVCFQFHPLQTVSLAITIQERHFHMQLARLDTGLHKLMLNTDGMGYLLAEAN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.