NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F076197

Metagenome Family F076197

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076197
Family Type Metagenome
Number of Sequences 118
Average Sequence Length 45 residues
Representative Sequence ASDETMNNVVQLVRDTRKSKDDKTLADIVDWSFAKKAQAELKIK
Number of Associated Samples 103
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.54 %
% of genes near scaffold ends (potentially truncated) 92.37 %
% of genes from short scaffolds (< 2000 bps) 93.22 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.373 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(13.559 % of family members)
Environment Ontology (ENVO) Unclassified
(32.203 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.983 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.83%    β-sheet: 0.00%    Coil/Unstructured: 54.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF09084NMT1 27.12
PF04480DUF559 18.64
PF13379NMT1_2 3.39
PF13030DUF3891 1.69
PF05016ParE_toxin 1.69
PF04392ABC_sub_bind 0.85
PF08309LVIVD 0.85
PF14236DUF4338 0.85
PF08882Acetone_carb_G 0.85
PF01850PIN 0.85
PF00892EamA 0.85
PF00753Lactamase_B 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 27.12
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 27.12
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.85
COG4647Acetone carboxylase, gamma subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.85
COG5276Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domainFunction unknown [S] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.37 %
UnclassifiedrootN/A7.63 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000655|AF_2010_repII_A100DRAFT_1062299All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium661Open in IMG/M
3300000789|JGI1027J11758_12985712All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300000891|JGI10214J12806_13001465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1042Open in IMG/M
3300000953|JGI11615J12901_10749684All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300000953|JGI11615J12901_10793544All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300003997|Ga0055466_10134553All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300005166|Ga0066674_10496222All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300005171|Ga0066677_10379811All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300005440|Ga0070705_101503754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
3300005445|Ga0070708_100631389All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1010Open in IMG/M
3300005446|Ga0066686_11068613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium520Open in IMG/M
3300005468|Ga0070707_102333994All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300005471|Ga0070698_102011145All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300005518|Ga0070699_100720122All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium912Open in IMG/M
3300005900|Ga0075272_1051472All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300006237|Ga0097621_101514159All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300006354|Ga0075021_10700933All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300006797|Ga0066659_10216866All Organisms → cellular organisms → Bacteria1411Open in IMG/M
3300006844|Ga0075428_101126286All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300006847|Ga0075431_101320216All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla682Open in IMG/M
3300006854|Ga0075425_100809321All Organisms → cellular organisms → Bacteria1073Open in IMG/M
3300006854|Ga0075425_102842772All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300006854|Ga0075425_102932673Not Available523Open in IMG/M
3300006903|Ga0075426_11570724All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300006904|Ga0075424_100473170All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1337Open in IMG/M
3300006914|Ga0075436_100121991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae1824Open in IMG/M
3300006954|Ga0079219_10108698All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300006954|Ga0079219_11650738All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300009012|Ga0066710_100535886All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1769Open in IMG/M
3300009012|Ga0066710_102733637All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium702Open in IMG/M
3300009012|Ga0066710_104452042All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium523Open in IMG/M
3300009078|Ga0105106_10494293All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium880Open in IMG/M
3300009093|Ga0105240_11389027All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium738Open in IMG/M
3300009094|Ga0111539_10358183All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1698Open in IMG/M
3300009147|Ga0114129_11579275All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300009147|Ga0114129_13379585All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300009162|Ga0075423_10130437All Organisms → cellular organisms → Bacteria2639Open in IMG/M
3300009162|Ga0075423_10757096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1027Open in IMG/M
3300009162|Ga0075423_12687681All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300009174|Ga0105241_10361134All Organisms → cellular organisms → Bacteria1264Open in IMG/M
3300009553|Ga0105249_10524383All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1232Open in IMG/M
3300010046|Ga0126384_11054903All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300010047|Ga0126382_11136837All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300010304|Ga0134088_10029128All Organisms → cellular organisms → Bacteria2482Open in IMG/M
3300010358|Ga0126370_11481197All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria644Open in IMG/M
3300010361|Ga0126378_11172669Not Available867Open in IMG/M
3300010362|Ga0126377_11870117All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium676Open in IMG/M
3300010398|Ga0126383_11322763All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria811Open in IMG/M
3300011412|Ga0137424_1090824All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium617Open in IMG/M
3300012152|Ga0137347_1053243All Organisms → cellular organisms → Bacteria687Open in IMG/M
3300012204|Ga0137374_10139330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2191Open in IMG/M
3300012208|Ga0137376_10939718All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium742Open in IMG/M
3300012923|Ga0137359_10945632All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla741Open in IMG/M
3300012930|Ga0137407_11903519All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300012931|Ga0153915_11477793Not Available795Open in IMG/M
3300012948|Ga0126375_10262877All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1176Open in IMG/M
3300012971|Ga0126369_10555719All Organisms → cellular organisms → Bacteria1213Open in IMG/M
3300012972|Ga0134077_10412250All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300013100|Ga0157373_10412361Not Available969Open in IMG/M
3300013297|Ga0157378_10357364All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1429Open in IMG/M
3300013308|Ga0157375_13088089All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300014154|Ga0134075_10085604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1325Open in IMG/M
3300014320|Ga0075342_1028012All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1313Open in IMG/M
3300015053|Ga0137405_1362713All Organisms → cellular organisms → Bacteria1577Open in IMG/M
3300015371|Ga0132258_11724998All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1579Open in IMG/M
3300015371|Ga0132258_12138415All Organisms → cellular organisms → Bacteria1406Open in IMG/M
3300015373|Ga0132257_100811480All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1168Open in IMG/M
3300015374|Ga0132255_106249936All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300018063|Ga0184637_10133532All Organisms → cellular organisms → Bacteria1531Open in IMG/M
3300018075|Ga0184632_10465914All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium522Open in IMG/M
3300018079|Ga0184627_10473220All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300018422|Ga0190265_11406540All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium812Open in IMG/M
3300018422|Ga0190265_12329350All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium636Open in IMG/M
3300018433|Ga0066667_10835731All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300018433|Ga0066667_11788380All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium555Open in IMG/M
3300019885|Ga0193747_1035138All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1247Open in IMG/M
3300021073|Ga0210378_10349243All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium552Open in IMG/M
3300022534|Ga0224452_1248405Not Available544Open in IMG/M
3300025165|Ga0209108_10487136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300025313|Ga0209431_10040344All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3618Open in IMG/M
3300025313|Ga0209431_11255169Not Available503Open in IMG/M
3300025314|Ga0209323_10602006All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300025318|Ga0209519_10305954All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium922Open in IMG/M
3300025322|Ga0209641_10336784All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1102Open in IMG/M
3300025324|Ga0209640_10614357All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300025325|Ga0209341_10823773All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.701Open in IMG/M
3300025567|Ga0210076_1003412All Organisms → cellular organisms → Bacteria3782Open in IMG/M
3300025912|Ga0207707_10543638All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300025925|Ga0207650_10219713Not Available1529Open in IMG/M
3300025930|Ga0207701_10458168All Organisms → cellular organisms → Bacteria1094Open in IMG/M
3300025961|Ga0207712_10617001All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium940Open in IMG/M
3300026309|Ga0209055_1100849All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1153Open in IMG/M
3300026535|Ga0256867_10219738Not Available691Open in IMG/M
3300026538|Ga0209056_10730565All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium502Open in IMG/M
3300026548|Ga0209161_10572251All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300027513|Ga0208685_1068314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium766Open in IMG/M
3300027526|Ga0209968_1056252All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300027617|Ga0210002_1030534All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium895Open in IMG/M
3300027722|Ga0209819_10252323Not Available612Open in IMG/M
3300027819|Ga0209514_10091209All Organisms → cellular organisms → Bacteria1832Open in IMG/M
3300027843|Ga0209798_10409662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium632Open in IMG/M
3300027880|Ga0209481_10095752All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1430Open in IMG/M
3300027907|Ga0207428_10053112All Organisms → cellular organisms → Bacteria3232Open in IMG/M
3300028380|Ga0268265_12156599All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium564Open in IMG/M
(restricted) 3300031197|Ga0255310_10199093All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium560Open in IMG/M
3300031740|Ga0307468_100875368All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium776Open in IMG/M
3300031908|Ga0310900_10713543All Organisms → cellular organisms → Bacteria → Proteobacteria804Open in IMG/M
3300031946|Ga0310910_10416529All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300031962|Ga0307479_12115675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300032144|Ga0315910_10155141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1705Open in IMG/M
3300032144|Ga0315910_10326780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1167Open in IMG/M
3300032157|Ga0315912_10746380All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium779Open in IMG/M
3300032174|Ga0307470_10232194All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1205Open in IMG/M
3300032892|Ga0335081_10249747All Organisms → cellular organisms → Bacteria → Proteobacteria2396Open in IMG/M
3300033412|Ga0310810_11450876All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300033486|Ga0316624_10020187All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3731Open in IMG/M
3300033486|Ga0316624_10676035All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300033513|Ga0316628_101471886All Organisms → cellular organisms → Bacteria907Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere13.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.78%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.24%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.24%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.24%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil4.24%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.39%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.39%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.54%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.54%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.54%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.54%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.69%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.69%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.69%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.85%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.85%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.85%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.85%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.85%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005900Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300012152Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025314Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025567Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026535Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027526Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027617Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A100DRAFT_106229913300000655Forest SoilTMKNVIQLVRDTRKSKDNLGLSDIVDWTFAKKAQVELKTR*
JGI1027J11758_1298571223300000789SoilQLVRDTRKSKDNLGLSDIVDWTYAKKAQAELKIK*
JGI10214J12806_1300146543300000891SoilNVVQLVRETRKSKDDKTLADIVDWSFAKKAQAELKIK*
JGI11615J12901_1074968423300000953SoilVVQLVRDTRKSKDEKTLADIFDWSFAKKAQAELKIK*
JGI11615J12901_1079354423300000953SoilASEETMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKIK*
Ga0055466_1013455313300003997Natural And Restored WetlandsSSDETMKNVVQLVRETRKSKDDKSMEDIFDWSFAKKALAELKLK*
Ga0066674_1049622213300005166SoilASDETMKNVIQLVRETRKSKDDKTLADIVDWSFAKKAQAELKVR*
Ga0066677_1037981113300005171SoilMKNVIQLVRETRKSKDDKTLADIVDWSFAKKAQAELKVR*
Ga0070705_10150375423300005440Corn, Switchgrass And Miscanthus RhizosphereDDTMKNVVQLVRDTRKSKDDTPMSNIFDWSFARKAQEELKIR*
Ga0070708_10063138913300005445Corn, Switchgrass And Miscanthus RhizosphereTGIATDDTMKNVVQLVRDTRKSKDDTPMSNIFDWSFARKAQEELKMR*
Ga0066686_1106861313300005446SoilASDETMKNVIQLVRETRKSKDDKTLADIVDWSFAKKAQAELKIR*
Ga0070707_10233399423300005468Corn, Switchgrass And Miscanthus RhizosphereIYSRTGIATDNTMKNVVQLVRDTRKSKDDTPMSNIFDWSFARKAQEELKMR*
Ga0070698_10201114513300005471Corn, Switchgrass And Miscanthus RhizosphereYKDMVGLFSRDGMASEDTMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKIK*
Ga0070699_10072012213300005518Corn, Switchgrass And Miscanthus RhizosphereGLFSRDGMASEDTMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKIK*
Ga0075272_105147223300005900Rice Paddy SoilPEETMKNVVQLVHDTRKSKEDIPLADIVDWSFAKKAQAELKVK*
Ga0097621_10151415913300006237Miscanthus RhizosphereDMVGLFSRDGVASEETMKNVVQLVRDTRKSKDEKTLADIFDWSFAKKAQAELKIK*
Ga0075021_1070093323300006354WatershedsIQLVRDTRKSKDDKTVADIVDWSFAKRAQAELKIR*
Ga0066659_1021686613300006797SoilIASDETMKNVIQLVRETRKSKDDKTLADIVDWSFAKKAQAELKVR*
Ga0075428_10112628613300006844Populus RhizosphereSRDGVASDDTMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKIK*
Ga0075431_10132021623300006847Populus RhizosphereGLFSRDGVASEDTMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKVK*
Ga0075425_10080932113300006854Populus RhizosphereSRDGVASEETMKNVVQLVRDTRKSKDEKTLVDIFDWSFAKTAQAGLKIK*
Ga0075425_10284277223300006854Populus RhizosphereVIQLVRDTRKSKDNLGLSDIVDWTYAKKAQTELKIK*
Ga0075425_10293267313300006854Populus RhizosphereLFSRDGVASEETMKNVVQLVRDTRKSKDEKTLADIFDWSFAKKAQAELKIK*
Ga0075426_1157072423300006903Populus RhizosphereDTVGLYTRNGIASDEMMKNVIQMVRDTRKSKEEIPLSSIVDWSFAKKAQDELKLR*
Ga0075424_10047317013300006904Populus RhizosphereMKNVVQLVRDTRKSKDEKSLADIFDWSFAKKAQAELKIK*
Ga0075436_10012199113300006914Populus RhizosphereGLFSRDGVASEDTMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKLR*
Ga0079219_1010869833300006954Agricultural SoilSEDTMKNVVQLVRDTRKSKDDKTLADIFDWSFAKKAQAELKLK*
Ga0079219_1165073823300006954Agricultural SoilSEDTMKNVVQLVRDTRKSKDDKTLADIFDWSFAKKAQAELKIK*
Ga0066710_10053588613300009012Grasslands SoilTMKNVIQLVRDTRKSKDEVALSSVVDWSFAKKAQEELKIR
Ga0066710_10273363713300009012Grasslands SoilETMKNVVQLVRDTRKSKDDKTLADIVDWSFAKKAQAELKLR
Ga0066710_10445204223300009012Grasslands SoilETMKNVIQLVRETRKSKDDKTLADIVDWSFAKKAQAELKIR
Ga0105106_1049429323300009078Freshwater SedimentTMKNVVQLVRDTRKTKDDKTLADIVDWSFARRAQAELKLR*
Ga0105240_1138902723300009093Corn RhizosphereRDMVGLFSRDGIASEETMKNVVQLVRETRKSKDDKTMADIFDWSFAKKAQAELKLR*
Ga0111539_1035818333300009094Populus RhizosphereKNVVQLVRDTRKSKDEKTLVDIFDWSFAKTAQAGLKIK*
Ga0114129_1157927523300009147Populus RhizosphereDETMKNVIQLVRDTRKSKDDKTLADIVDWSFARKAQAELKLR*
Ga0114129_1337958523300009147Populus RhizosphereVGIYTRDGIASDETMKNVIQLVRDTRKSKDNLGLSDIVDWTYAKKAQEQLKIK*
Ga0075423_1013043753300009162Populus RhizosphereMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKIK*
Ga0075423_1075709623300009162Populus RhizosphereATDETMKNVVQLVRDTRKSKDDTPMSNIFDWSFAKKAQEELKIR*
Ga0075423_1268768123300009162Populus RhizosphereVGLFSRDGVASDDTMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKIK*
Ga0105241_1036113413300009174Corn RhizosphereNVVQLVRDTRKSKDEKTLADIFDWSFAKKAQAELKIK*
Ga0105249_1052438313300009553Switchgrass RhizosphereNVVQLVRDTRKTKDDKTLADIFDWSFARKAQAELKIK*
Ga0126384_1105490313300010046Tropical Forest SoilNGIASDQTMKNVIQLVRDTRKSKDNLGLSDIVDWTYAKKAQAELKIK*
Ga0126382_1113683713300010047Tropical Forest SoilNVIQLVRDTRKSKDNLGLSDIVDWTYAKKAQAELKIK*
Ga0134088_1002912813300010304Grasslands SoilIASDETMKNVIQLVRETRKSKDDKTLADIVDWSFAKKAQAELKIR*
Ga0126370_1148119713300010358Tropical Forest SoilNVVQLVRDTRKSKDDTPMSAIFDWSFAKKAQEELKIK*
Ga0126378_1117266933300010361Tropical Forest SoilYRDIVDIYTRNGIASDQTMKNVIQLVRDTRKSKDNLGLSDIVDWTYAKKAQAELKIK*
Ga0126377_1187011713300010362Tropical Forest SoilNGIASDETMKNVIQLVRDTRKSKDDKTLADIVDWTYAKKAQTELKTR*
Ga0126383_1132276323300010398Tropical Forest SoilETMKNVVQLVRDTRKSRDDTPMSAIFDWSFAKKAQEQLKIK*
Ga0137424_109082423300011412SoilYRDIVGIYTRNGIASDDTMKNVLQLVRETRKSKDELGIADITDWSFAKKAQAELKIR*
Ga0137347_105324323300012152SoilMKNVVQLVRDTRKSKDDKTLADIVDWSFAKRAQAELKIR*
Ga0137374_1013933043300012204Vadose Zone SoilEGVASDETMKNVVQLVRDTRKSKDDKTVADIVDWSFARKAQAELKIR*
Ga0137376_1093971833300012208Vadose Zone SoilQLVRETRKSKDDKTLADIVDWSFAKKAQAELKVR*
Ga0137359_1094563213300012923Vadose Zone SoilDTMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKVK*
Ga0137407_1190351923300012930Vadose Zone SoilMKNVIQLVRDTRKSKDNLGLSDIVDWTYAKKAQAELKIR*
Ga0153915_1147779313300012931Freshwater WetlandsRDIIGLYSRNGIASDETMKNVVQLVRDTRKSKEDISLSEIVDWSFAKRAQAELKRK*
Ga0126375_1026287723300012948Tropical Forest SoilDIVDIYTRNGIASDQTMKNVIQLVRDTRKSKDNLGLSDIVDWTYAKKAQAELKIK*
Ga0126369_1055571923300012971Tropical Forest SoilMVGLFSHDGIASEETMKNVVQLVRDTRKSKDDKTLPDIFDWSFAKKARAELKIK*
Ga0134077_1041225023300012972Grasslands SoilSDETMKNVIQLVRETRKSKDDKTLPDIVDWSFAKKAQAELKVR*
Ga0157373_1041236123300013100Corn RhizosphereQLVRDTRKSKDEKTLADIFDWSFAKKAQAELKIK*
Ga0157378_1035736413300013297Miscanthus RhizosphereSRDGIASDDTMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKLR*
Ga0157375_1308808923300013308Miscanthus RhizosphereMKNVVQLVRDTRKSKDEKTLADIFDWSFAKKAQAELKIK*
Ga0134075_1008560423300014154Grasslands SoilIASDETMKNVIQLVRETRKSKDEKTLADIVDWSFAKKAQAELKIR*
Ga0075342_102801213300014320Natural And Restored WetlandsSRTGIGTDETMKNVVQLVRDTRKSKDNLGLPDIVDWSFAKKAQAELKIR*
Ga0137405_136271323300015053Vadose Zone SoilMKNVVQLVRDTRKSKDDKTLADIVDWSFARKAQAELKVK*
Ga0132258_1172499833300015371Arabidopsis RhizosphereVQLVRDTRKSKDEKTLADIFDWSFAKKAQAELKIK*
Ga0132258_1213841513300015371Arabidopsis RhizosphereNVVQLVRDTRKSKDDKTLADIFDWSFAKKAQAELKIK*
Ga0132257_10081148033300015373Arabidopsis RhizosphereGLFSRDGVASDDTMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKIK*
Ga0132255_10624993623300015374Arabidopsis RhizosphereGVASEDTMKNVVQLVRDTRKSKDDKTLADIFDWSFAKKAQAELKIK*
Ga0184637_1013353253300018063Groundwater SedimentDETMKNVVQLVRDTRKSKDDKTLADIFDWSFAKRAQAELRLR
Ga0184632_1046591423300018075Groundwater SedimentAPFPTSSRKSKDDKTIADIADWSYAKKAQAELKIR
Ga0184627_1047322023300018079Groundwater SedimentMASLPTRRLKNVIQLVRDTRKSKDDKTLADIADWSFAKKAQAELKIK
Ga0190265_1140654013300018422SoilRNGVAADETMKNVLQLVRETRKSKDDLGVSDIVDWSFAKKAQAELKIR
Ga0190265_1232935023300018422SoilIYTRNGVAADETMKNVLQLVRETRKSKDDLGVSDIVDWSFAKKAQAELKIR
Ga0066667_1083573113300018433Grasslands SoilIASDETMKNVIQLVRETRKSKDDKTLADIVDWSFAKKAQAELKVR
Ga0066667_1178838013300018433Grasslands SoilIASDETMKNVIQLVRETRKSKDDKTLADIVDWSFAKKAQAELKIR
Ga0193747_103513833300019885SoilDMVGLFSRDGMASEDTMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKIK
Ga0210378_1034924313300021073Groundwater SedimentRDMVVLFSRDGVASDETMKNVVQLVRDTRKSKDDKTLADIFDWSFARKAQAELKLR
Ga0224452_124840513300022534Groundwater SedimentIASDDTMKNVVQLVRDTRKSKDDKTMADIFDWSFAKKAQAELKIK
Ga0209108_1048713623300025165SoilGVASNETMQNVLQLVRDTRKSKDDKTLADIADWSFAKKAQAELKLR
Ga0209431_1004034413300025313SoilRDMVGLYSRDGVAPDETMKNVIQLVRDTRKSKDDKTLADIVDWSFAKRAQAELKSR
Ga0209431_1125516923300025313SoilDMVGLYSRDGVAPDETMKNVIQLVRDTRKSKDDKTLADIVDWSFAKRAQAELKIK
Ga0209323_1060200633300025314SoilNVIQLVRDTRKSKDDKTLADIVDWSFAKRAQAELKIR
Ga0209519_1030595423300025318SoilVAPDETMKNVIQLVRDTRKFKDDKTLADIVDWSFAKRAQAELKIR
Ga0209641_1033678423300025322SoilMVSLFSRDGVAPDETMKNVVQLVRDTRKSKDDKTLADIVDWSFAKRAQAELKIR
Ga0209640_1061435743300025324SoilDGVAPDETMKNVIQLVRDTRKSKDDKTLADIVDWSFAKRAQAELKIR
Ga0209341_1082377313300025325SoilLYSRDGVAPDETMKNVIQLVRDTRKSKDDKTLADIVDWSFAKRAQAELKIK
Ga0210076_100341253300025567Natural And Restored WetlandsASDETMNNVVQLVRDTRKSKDDKTLADIVDWSFAKKAQAELKIK
Ga0207707_1054363833300025912Corn RhizosphereNVVQLVRDTRKSKDEKTLADIFDWSFAKKAQVELKIK
Ga0207650_1021971313300025925Switchgrass RhizosphereVASEETMKNVVQLVRDTRKSKDEKTLADIFDWSFAKKAQAELKIK
Ga0207701_1045816823300025930Corn, Switchgrass And Miscanthus RhizosphereSEETMKNVVQLVRDTRKSKDEKTLADIFDWSFAKKAQVELKIK
Ga0207712_1061700113300025961Switchgrass RhizosphereNVVQLVRDTRKTKDDKTLADIFDWSFARKAQAELKIK
Ga0209055_110084933300026309SoilGIASDETMKNVIQLVRETRKSKDDKTLADIVDWSFAKKAQAELKVR
Ga0256867_1021973813300026535SoilMNNVVQLARDTRKSKDDKMLAGIADWSLAKKAQAELRLR
Ga0209056_1073056513300026538SoilNVIQLVRETRKSKDEKTLADIVDWSFAKKAQAELKIR
Ga0209161_1057225113300026548SoilRDGIASDETMKNVIQLVRETRKSKDEKTLADIVDWSFAKKAQAELKIR
Ga0208685_106831413300027513SoilGLYSRTGIGTDETMKNVVQLVRDTRKFKDNLGMSDIVDWSFAKKAQAELKIK
Ga0209968_105625213300027526Arabidopsis Thaliana RhizosphereVVQLVRDTRKSKDDKTLADIVDWSFAKKAQAELKIK
Ga0210002_103053413300027617Arabidopsis Thaliana RhizosphereFSRDGVASDETMNNVVQLVRDTRKSKDDKTLADIVDWSFAKKAAAELKLR
Ga0209819_1025232323300027722Freshwater SedimentASDETMKNVIQLVRDTRKSKEEVALSNVVDWTFAKKAQAELNLK
Ga0209514_1009120913300027819GroundwaterDMVGLYSRDGVAPDETMKNVVQLVRDTRKSKDDKTLADIVDWSFAKRAQAELKIR
Ga0209798_1040966213300027843Wetland SedimentVAPDETMKNVIQLVRDTRKSKDDKTLADIVDWSFAKRAQAELKIR
Ga0209481_1009575213300027880Populus RhizosphereDGIASDETMKNVIQLVRDTRKSKDNLGLSDIVDWSFAKKAQAELKVR
Ga0207428_1005311273300027907Populus RhizosphereDGVASDDTMKNVVQLVRDTRKSKDDKTMTDIFDWSFAKKAQAELKIK
Ga0268265_1215659913300028380Switchgrass RhizosphereVQLVRDTRKSKDEKSLADIFDWSFAKKAQAELKIK
(restricted) Ga0255310_1019909313300031197Sandy SoilVQLVRETRKSKDDKTLADIVDWSFAKKAQAELKSR
Ga0307468_10087536823300031740Hardwood Forest SoilRNGIATDETMKNVVQLVRDTRKSKDDTPMSNIFDWSFARKAQEELKMR
Ga0310900_1071354333300031908SoilSDETMNNVVQLVRETRKSKDDKTLADIVDWSFAKKAQAELKIK
Ga0310910_1041652923300031946SoilMKNVIQMVRDTRKSKEEPALSSVVDWSFAKKAQEELKMR
Ga0307479_1211567513300031962Hardwood Forest SoilTIGIYSRTGIATDDTMKNVVQLVRDTRKSKDDTPMSNIFDWSFARKAQEELKMR
Ga0315910_1015514113300032144SoilGLFSRDGVASDQTMNNVVQLVRDTRKSKDDKTLADIVDWSFAKKAQAELKLR
Ga0315910_1032678013300032144SoilMNNVVQLVRDTRKSKDDKTLADIVDWSFAKRAQAELKR
Ga0315912_1074638023300032157SoilDMVGLFSKDGVASDQTMNNVVQLVRDTRKSKDDKTLADIVDWSFAKKAQAELKIR
Ga0307470_1023219423300032174Hardwood Forest SoilGIATDDTMKNVVQLVRDTRKSKDDTPMSNIFDWSFARKAQEELKMR
Ga0335081_1024974733300032892SoilIIGIYSRAGIATDETMKNVVQLVRDTRKSKDDTPMSNIFDWSFAKKAQEELKIK
Ga0310810_1145087623300033412SoilKNVVQLVRDTRKSKDEKTLADIFDWSFAKKAQAELKIK
Ga0316624_1002018713300033486SoilASDQTMNNVVQLVRDTRKSKDDKTLADIVDWSFAKKAVAELKTR
Ga0316624_1067603533300033486SoilDGIASDQTMNNVVQLVRDTRKSKDDKTLADIVDWSFAKKAQAELKIR
Ga0316628_10147188613300033513SoilDQTMNNVVQLVRDTRKSKDDKTLAEIVDWSFAKKAQAELKIR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.