NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F076441

Metagenome / Metatranscriptome Family F076441

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076441
Family Type Metagenome / Metatranscriptome
Number of Sequences 118
Average Sequence Length 48 residues
Representative Sequence MSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTIGR
Number of Associated Samples 116
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 98.31 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.22 %
Associated GOLD sequencing projects 111
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.475 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(9.322 % of family members)
Environment Ontology (ENVO) Unclassified
(36.441 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(27.119 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 54.79%    β-sheet: 0.00%    Coil/Unstructured: 45.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF00437T2SSE 88.14
PF00263Secretin 2.54
PF09940DUF2172 0.85
PF01656CbiA 0.85
PF13629T2SS-T3SS_pil_N 0.85



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.47 %
All OrganismsrootAll Organisms41.53 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502000|ACOD_F64RS5002I5UZXAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria501Open in IMG/M
2140918013|NODE_178_length_1144_cov_8.841784Not Available1176Open in IMG/M
2199352025|deepsgr__Contig_52981All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales6048Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105223811Not Available612Open in IMG/M
3300000574|JGI1357J11328_10180971Not Available578Open in IMG/M
3300000955|JGI1027J12803_105321344All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300000956|JGI10216J12902_100848251Not Available865Open in IMG/M
3300001431|F14TB_106206565Not Available546Open in IMG/M
3300003890|Ga0063162_1094415All Organisms → cellular organisms → Bacteria → Terrabacteria group616Open in IMG/M
3300003992|Ga0055470_10017704Not Available1279Open in IMG/M
3300003993|Ga0055468_10146074Not Available701Open in IMG/M
3300003994|Ga0055435_10144561All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300003997|Ga0055466_10178667All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300004058|Ga0055498_10125090Not Available543Open in IMG/M
3300004463|Ga0063356_104815667Not Available580Open in IMG/M
3300004808|Ga0062381_10038640All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1309Open in IMG/M
3300005169|Ga0066810_10135507Not Available576Open in IMG/M
3300005406|Ga0070703_10313290All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300005445|Ga0070708_101697904All Organisms → cellular organisms → Bacteria → Terrabacteria group587Open in IMG/M
3300005518|Ga0070699_101233278Not Available686Open in IMG/M
3300005546|Ga0070696_100918682All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300005718|Ga0068866_10757447Not Available671Open in IMG/M
3300005764|Ga0066903_106674589All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300005873|Ga0075287_1006704All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1365Open in IMG/M
3300006173|Ga0070716_100096800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1800Open in IMG/M
3300006196|Ga0075422_10609891Not Available506Open in IMG/M
3300006791|Ga0066653_10626522Not Available548Open in IMG/M
3300006796|Ga0066665_11072893All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300006865|Ga0073934_10463340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → unclassified Paenibacillus → Paenibacillus sp. P1XP2765Open in IMG/M
3300006881|Ga0068865_101591426Not Available587Open in IMG/M
3300006914|Ga0075436_101545152All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria504Open in IMG/M
3300009081|Ga0105098_10738542Not Available526Open in IMG/M
3300009098|Ga0105245_10919165Not Available917Open in IMG/M
3300009147|Ga0114129_11725321All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300009156|Ga0111538_13679300Not Available531Open in IMG/M
3300009179|Ga0115028_10475775All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300010047|Ga0126382_11865756Not Available567Open in IMG/M
3300010154|Ga0127503_10814550Not Available869Open in IMG/M
3300010166|Ga0126306_11639030Not Available536Open in IMG/M
3300010359|Ga0126376_11546626Not Available694Open in IMG/M
3300010360|Ga0126372_12009535All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300010362|Ga0126377_10090885All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp.2763Open in IMG/M
3300011412|Ga0137424_1097911Not Available598Open in IMG/M
3300011429|Ga0137455_1102480All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300012015|Ga0120187_1047800Not Available560Open in IMG/M
3300012022|Ga0120191_10126988Not Available558Open in IMG/M
3300012179|Ga0137334_1106941All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300012211|Ga0137377_11245337All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300012226|Ga0137447_1044361All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300012355|Ga0137369_10427629Not Available949Open in IMG/M
3300012356|Ga0137371_10384905Not Available1088Open in IMG/M
3300012357|Ga0137384_10221966All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1579Open in IMG/M
3300012582|Ga0137358_10239365Not Available1236Open in IMG/M
3300012676|Ga0137341_1063448Not Available618Open in IMG/M
3300012976|Ga0134076_10439874Not Available587Open in IMG/M
3300014321|Ga0075353_1152739Not Available584Open in IMG/M
3300014324|Ga0075352_1273588Not Available528Open in IMG/M
3300014883|Ga0180086_1070528Not Available862Open in IMG/M
3300015374|Ga0132255_104118300All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300018028|Ga0184608_10268535Not Available751Open in IMG/M
3300018031|Ga0184634_10368879Not Available658Open in IMG/M
3300018059|Ga0184615_10558230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria605Open in IMG/M
3300018073|Ga0184624_10001814All Organisms → cellular organisms → Bacteria6138Open in IMG/M
3300018084|Ga0184629_10385247All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria737Open in IMG/M
3300018469|Ga0190270_12859057Not Available545Open in IMG/M
3300019208|Ga0180110_1255076Not Available511Open in IMG/M
3300019232|Ga0180114_1237137Not Available504Open in IMG/M
3300019259|Ga0184646_1510089All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1588Open in IMG/M
3300020064|Ga0180107_1113314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1883Open in IMG/M
3300020065|Ga0180113_1053957Not Available557Open in IMG/M
3300021344|Ga0193719_10147832Not Available1015Open in IMG/M
3300021560|Ga0126371_10078840All Organisms → cellular organisms → Bacteria3226Open in IMG/M
3300022756|Ga0222622_10587385Not Available803Open in IMG/M
3300025001|Ga0209618_1070790Not Available538Open in IMG/M
3300025160|Ga0209109_10542617Not Available521Open in IMG/M
3300025327|Ga0209751_10684627All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria814Open in IMG/M
3300025780|Ga0210100_1008732Not Available1167Open in IMG/M
3300025796|Ga0210113_1038257Not Available972Open in IMG/M
3300025885|Ga0207653_10236531All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300025914|Ga0207671_11310962Not Available564Open in IMG/M
3300025917|Ga0207660_10021099All Organisms → cellular organisms → Bacteria → Proteobacteria4377Open in IMG/M
3300025922|Ga0207646_10125476All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2308Open in IMG/M
3300025933|Ga0207706_10534301Not Available1010Open in IMG/M
3300025934|Ga0207686_10479470Not Available962Open in IMG/M
3300025935|Ga0207709_10291466Not Available1210Open in IMG/M
3300025940|Ga0207691_11195050All Organisms → cellular organisms → Bacteria → Acidobacteria631Open in IMG/M
3300025986|Ga0207658_10600562Not Available989Open in IMG/M
3300026005|Ga0208285_1018805Not Available562Open in IMG/M
3300026045|Ga0208535_1004312All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1454Open in IMG/M
3300027614|Ga0209970_1022599Not Available1068Open in IMG/M
3300027636|Ga0214469_1205661Not Available538Open in IMG/M
3300027722|Ga0209819_10048677All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1454Open in IMG/M
3300027731|Ga0209592_1171022Not Available773Open in IMG/M
3300027873|Ga0209814_10012317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3380Open in IMG/M
3300027909|Ga0209382_12118287Not Available535Open in IMG/M
3300028802|Ga0307503_10044764All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium1653Open in IMG/M
3300030547|Ga0247656_1166552Not Available567Open in IMG/M
3300030570|Ga0247647_1206342Not Available563Open in IMG/M
3300031469|Ga0170819_14874646Not Available902Open in IMG/M
3300031716|Ga0310813_11614018Not Available606Open in IMG/M
3300031719|Ga0306917_10769014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium ADurb.Bin360756Open in IMG/M
3300031740|Ga0307468_101530449All Organisms → cellular organisms → Bacteria620Open in IMG/M
3300031847|Ga0310907_10147296Not Available1077Open in IMG/M
3300031852|Ga0307410_10114993All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1953Open in IMG/M
3300031943|Ga0310885_10298602Not Available832Open in IMG/M
3300031965|Ga0326597_11759932Not Available583Open in IMG/M
3300032012|Ga0310902_10245689Not Available1075Open in IMG/M
3300032180|Ga0307471_100067537All Organisms → cellular organisms → Bacteria3063Open in IMG/M
3300032421|Ga0310812_10318434All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300033413|Ga0316603_11057514Not Available767Open in IMG/M
3300034479|Ga0314785_001795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1197Open in IMG/M
3300034661|Ga0314782_011076Not Available1379Open in IMG/M
3300034661|Ga0314782_018399Not Available1161Open in IMG/M
3300034663|Ga0314784_120086Not Available568Open in IMG/M
3300034672|Ga0314797_014567All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1167Open in IMG/M
3300034672|Ga0314797_065465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria689Open in IMG/M
3300034673|Ga0314798_061353Not Available727Open in IMG/M
3300034675|Ga0314800_050088Not Available593Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.32%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.93%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.08%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.08%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment4.24%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.24%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.39%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.54%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.54%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.54%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial1.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.69%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.69%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.69%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.85%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.85%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.85%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.85%
Hot Spring SedimentsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Sediments0.85%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.85%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.85%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.85%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.85%
Fungus GardenHost-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden0.85%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.85%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502000Fungus garden microbial communities from Atta colombica in Panama - dump bottomHost-AssociatedOpen in IMG/M
2140918013Soil microbial communities from Great Prairies - Iowa soil (MSU Assemblies)EnvironmentalOpen in IMG/M
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300003890Hot spring sediment microbial communities from Chocolate Pots, Yellowstone National Park, Wyoming that are Fe(III) reducing - Chocolate Pots Core 3, 1cmEnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005873Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300012015Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep1EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012676Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT433_2EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019208Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT231_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019232Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020064Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025001Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes)EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025780Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026005Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes)EnvironmentalOpen in IMG/M
3300026045Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300027614Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027636Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 HiSeqEnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027731Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300030547Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030570Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300034479Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034663Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034672Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034673Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034675Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ACODB_199026502040502000Fungus GardenMSLLLIAIFSFLTAVSLIVILFMLPMAVQDTPQARIKRRLTSIGRLDQASR
Iowa-Corn-GraphCirc_011680002140918013SoilMSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRR
deepsgr_006010802199352025SoilMSLLLISIFSFLAAVSLIVILFMLPMAVQDSAQARIKRRLTTIGRFDQASRAEMQSIL
INPhiseqgaiiFebDRAFT_10522381113300000364SoilMSLLLISIFSFLAAVSLIVILFMLPMAVQDSAQARIKRRLTTIGRFDQAS
JGI1357J11328_1018097113300000574GroundwaterMSLFVITIFSFLAAVSLIVIFFMLPLAVQNSPQARIKRRLTAIGRMDHASRAEIRSLLKT
JGI1027J12803_10532134433300000955SoilMSLFLISLFSFFAILSLIVIVFMVPMAVQDSAQARIRRRLTAIGRMDAASRSEIQNLLKSSVYSD
JGI10216J12902_10084825113300000956SoilMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQAR
F14TB_10620656523300001431SoilMSILLIAVFSFLTALSLIVILFMLPMAVQDSPQARIKRRLTS
Ga0063162_109441513300003890Hot Spring SedimentsMSLLLIAVFSFLSAVSLVVILFMLPMAVQETPQARIKRRLTSIGRLQHASRAEIQNLLKTSV
Ga0055470_1001770413300003992Natural And Restored WetlandsMSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRRLTTI
Ga0055468_1014607413300003993Natural And Restored WetlandsMSLLVISIFAFLSAVSLIVILFMLPMAVQDTPQARIKRRLTTIG
Ga0055435_1014456113300003994Natural And Restored WetlandsMSLLVIVIFSFLAAVSLIVILFMLPMAVQDSAQARITRRLKAIGK
Ga0055466_1017866713300003997Natural And Restored WetlandsMSLLIISIFAFLSAVSLVVILFMLPMAVQDTAQARIKRRLTAIGRLDYASRA
Ga0055498_1012509023300004058Natural And Restored WetlandsMSLLLIAIFSFLAAVSLVVILFMLPMAVQDTAQARIKRRLTAIGKL
Ga0063356_10481566713300004463Arabidopsis Thaliana RhizosphereMSLLLITVFSFLAAVSLVVILFLLPMAVQDTAQARIKRRL
Ga0062381_1003864023300004808Wetland SedimentMSLLLITIFAFLAAVSLVVILFLLPMAVQDTAQARIKRRLT
Ga0066810_1013550713300005169SoilMSLLLIAIFSFLAAVSLVVILFMLPMAVQDTAQARIKRRLTAIGKLDYASKA
Ga0070703_1031329013300005406Corn, Switchgrass And Miscanthus RhizosphereMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGR
Ga0070708_10169790423300005445Corn, Switchgrass And Miscanthus RhizosphereMSLFLIALFSFFATLSLVVVICMVPMAVQNTPQARIKRRLTAIGRMDTASRAE
Ga0070699_10123327823300005518Corn, Switchgrass And Miscanthus RhizosphereMSVLLITIFAFLSAVSLIVILFMLPMAVQDTPEARIKRRLTTIGRMDNATRAEVQS
Ga0070696_10091868223300005546Corn, Switchgrass And Miscanthus RhizosphereMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTT
Ga0068866_1075744723300005718Miscanthus RhizosphereMSILLITLFSFLAAMSLIVILFILPMAVQDSPQARIKRR
Ga0066903_10667458923300005764Tropical Forest SoilMNLLLIVLFSFLAAMTLIIVMFFVPMAVQNSPQARIKRRLTTVGR
Ga0075287_100670413300005873Rice Paddy SoilMSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRRLTTIGRLD
Ga0070716_10009680033300006173Corn, Switchgrass And Miscanthus RhizosphereMSLFLIALFSFFATLSLVVVICMVPMAVQNTPQARIKRRLTAIGRMDTASRS
Ga0075422_1060989123300006196Populus RhizosphereMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIG
Ga0066653_1062652213300006791SoilMNVFVITIFSFLATVSLIAILFMLPMAVQDTPQARIRRRLTAV
Ga0066665_1107289313300006796SoilMSLLLISLFSFLAAVSLIVILFLLPMAVQDTPQARIKRRLTTIGRLGQVSRADVQSI
Ga0073934_1046334023300006865Hot Spring SedimentMSLLLIAVFSFISAVALIVILFMLPMAVQDTPQARIKRRLTSIGRLQY
Ga0068865_10159142623300006881Miscanthus RhizosphereMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGRLGQTSRAEMATI
Ga0075436_10154515223300006914Populus RhizosphereMSLFLISLFSFFAILSLIVIIFMVPMAVQDSAQARIKRRLTAIGRMDAAS
Ga0105098_1073854223300009081Freshwater SedimentMNLLLIVLFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRLTTI
Ga0105245_1091916513300009098Miscanthus RhizosphereMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGRLG
Ga0114129_1172532113300009147Populus RhizosphereMSLFLIAIFVFLSAMSLIVIVFMLPLAVKDTAQARIKRRLTTIGHM
Ga0111538_1367930013300009156Populus RhizosphereMSLLIIVLFSFLSAVSLIVILFMLPMAVQDTAQARIKRRLTAIGKLDYASKSEIQS
Ga0115028_1047577523300009179WetlandMSLLLITIFSFLAAVSLVVILFLLPMAVQDTAQARIKRRL
Ga0126382_1186575623300010047Tropical Forest SoilMSLIVIVIFSFLAAMSLIVILFMLPMAVQDSAQARIKRRLTAIGKLDYASKSE
Ga0127503_1081455023300010154SoilMSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIK
Ga0126306_1163903013300010166Serpentine SoilMSLFLIAIFVFLSAMSLIVMVFMLPMAVKDTAQARIRRRLTTIGHMTHASRSE
Ga0126376_1154662613300010359Tropical Forest SoilMNLLLIVLFSFLAALSLIIVMFFVPMAVQNSPQARIKR
Ga0126372_1200953523300010360Tropical Forest SoilMSLFLIALFSFFATLSLVVVICMVPMAVQNTPQARIKRRLTAIGRMDTASRAEIQN
Ga0126377_1009088513300010362Tropical Forest SoilMSLFLIALFSFFAILSLVVVIFMVPMAVQDTPQARIKRRLTAIGRMDTASRAEIQNLLKS
Ga0137424_109791123300011412SoilMSLFLIAIFVFLAAVSLIVIMFMLPMAVKDTAQARIKRRLTTIGHMT
Ga0137455_110248013300011429SoilMSLLLIVIFSFLAAVSLIVILFMLPMAVQDTAQARIKRRLTAIGKLDYASKSEIQSL
Ga0120187_104780023300012015TerrestrialMSLLLIAIFSFLSAVSLIVILFMLPMAVQDTPQARIKRRLTALRRLAYPSNAAGP
Ga0120191_1012698813300012022TerrestrialMNLLLIVLFSFLAAMTLIIVMFFVPMAVQNSPQARIKRRLTTVGRAGYTS
Ga0137334_110694123300012179SoilMSLFVITIFSFLAAVSLIVIFFMLPLAVQNTPQARIKRRLTAIGRMDHASRAEI
Ga0137377_1124533713300012211Vadose Zone SoilMNLLVIVLFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRLTTVGRAGYTSRADV
Ga0137447_104436113300012226SoilMSLFVITIFSFLAAVSLIVIFFMLPLAVQNTPQARIKRRLTAIGRMDHASRAE
Ga0137369_1042762913300012355Vadose Zone SoilMSLFLIAIFSFLSAVSLIVILFMLPMAVQDTPQARIKRRLTAIGRLDY
Ga0137371_1038490523300012356Vadose Zone SoilMNVFVITIFSFLATVSLIAILFMLPMAVQDTPQARIRRRLTAVGRLAS
Ga0137384_1022196613300012357Vadose Zone SoilMNVFVITIFSFLATVSLIAILFMLPMAVQDTPQARIRRR
Ga0137358_1023936513300012582Vadose Zone SoilMSLLLISIFSFLAAVSLIVILFMLPMAVQDSAQARIKRRLTTIGRFDQASRAE
Ga0137341_106344823300012676SoilMNLLLIALFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRLTTI
Ga0134076_1043987413300012976Grasslands SoilMNLLVIVLFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRLTTVG
Ga0075353_115273923300014321Natural And Restored WetlandsMSLFIIVIFSFLAAVSLIVILFMLPMAVQDSAQARI
Ga0075352_127358823300014324Natural And Restored WetlandsMSLFVITIFSFLAAVSLIVIFFMLPLAVQNTPHARIKRRLTAIGKMDNASRTEIQSLLKT
Ga0180086_107052823300014883SoilMSILLITIFSFLAAMSLIVILFILPMAVQDSPQARIKRRLTAIR
Ga0132255_10411830023300015374Arabidopsis RhizosphereMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTVGRLGQAS
Ga0184608_1026853523300018028Groundwater SedimentMNLLLIVLFSFLAAMSLTIVMFFVPLAVQHSPQARSKRRLTPIGRAGNAS
Ga0184634_1036887913300018031Groundwater SedimentMSLLVIVIFSFLAAMSLIVILFMLPMAVKDTAQARIKRRLTAIGKLDYASKSEIQN
Ga0184615_1055823013300018059Groundwater SedimentMSLFVITIFSFLAAVSLIVICFMLPLAVQNTPQARIKRRLSAIGRMDYASRAEIQS
Ga0184624_1000181413300018073Groundwater SedimentMSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTIGR
Ga0184629_1038524723300018084Groundwater SedimentMSLLLIVIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLSAIGKLDYASKSDIQS
Ga0190270_1285905713300018469SoilMSLILITIFSFLAAVSLVVILFLLPMAVQDTAQAR
Ga0180110_125507623300019208Groundwater SedimentMSILLITIFSFLAAMSLIVILFILPMAVQDSPQARIKRRLTA
Ga0180114_123713723300019232Groundwater SedimentMSLLLIVIFSFLAAVSLIVILFMLPMAVQDTPQARIKKRLTAVGKLDYA
Ga0184646_151008913300019259Groundwater SedimentMNILVIAIFSFLSALSLIVILFMLPMAVQDSPQARIKRRLTSIGRLDQASRA
Ga0180107_111331433300020064Groundwater SedimentMNLLLIALFSFLAAMSLIIVMFFVPMAVQNSPQARIKRR
Ga0180113_105395723300020065Groundwater SedimentMNILVIAIFSFLSALSLIVILFMLPMAVQDSPQARIKRRLTSIG
Ga0193719_1014783213300021344SoilMNLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTI
Ga0126371_1007884013300021560Tropical Forest SoilMSLFLIALFSFFAILSLVVVIFMVPMAVQDTPQARIKRRLTAIGRMDTASRAE
Ga0222622_1058738523300022756Groundwater SedimentMNLLLIVLFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRL
Ga0209618_107079013300025001SoilMSLFVITIFSFLAAVSLIVIFFMLPLAVQNTPQARIKRR
Ga0209109_1054261723300025160SoilMSLFVITIFSFLAAVSLIVIFFMLPLAVQNTPQARIKKRLTAIGRMDYASRAEIQ
Ga0209751_1068462723300025327SoilMSLFIITIFSFLAAVSLIVIFFMLPLAVQNTPQARIKRRLTAIGRMDYAS
Ga0210100_100873213300025780Natural And Restored WetlandsMSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRRLTTIG
Ga0210113_103825723300025796Natural And Restored WetlandsMSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRRLTTIGRLDSATRAEVQS
Ga0207653_1023653113300025885Corn, Switchgrass And Miscanthus RhizosphereMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGRLGQVSRA
Ga0207671_1131096223300025914Corn RhizosphereMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKR
Ga0207660_1002109913300025917Corn RhizosphereMSLFLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKR
Ga0207646_1012547633300025922Corn, Switchgrass And Miscanthus RhizosphereMSLFLIALFSFFATLSLVVVICMVPMAVQNTPQARIKRRLTAIGRMDTASRDR
Ga0207706_1053430123300025933Corn RhizosphereMSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTI
Ga0207686_1047947013300025934Miscanthus RhizosphereMGLFLIVLFSFLATMSLIVILFMLPMAVQDTPQARIR
Ga0207709_1029146613300025935Miscanthus RhizosphereMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLT
Ga0207691_1119505013300025940Miscanthus RhizosphereMSILLITLFSFLAAMSLIVILFILPMAVQDSPQARIKR
Ga0207658_1060056223300025986Switchgrass RhizosphereMSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTIGRFDQASRA
Ga0208285_101880513300026005Rice Paddy SoilMSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKR
Ga0208535_100431223300026045Natural And Restored WetlandsMSLLVISIFAFLSAVSLIVILFMLPMAVQDTPQAR
Ga0209970_102259913300027614Arabidopsis Thaliana RhizosphereMSLLLISIFAFLSAVSLIVILFMLPMAVQDSPQARIKRRLTTIGRLDSATRAEVQ
Ga0214469_120566113300027636SoilMSLFLIAVFVFLAAMSLVVIIFMLPMAVQDTAQARIKRRLTTI
Ga0209819_1004867723300027722Freshwater SedimentMNLLLIALFSFLAAVSLIIVMFFVPMAVQSSPQARIKRRLT
Ga0209592_117102223300027731Freshwater SedimentMSLILITIFSFLAAVSLVVILFLLPMAVQDTAQARIKRRLTAIGKLDYASK
Ga0209814_1001231743300027873Populus RhizosphereMNLLVIVLFSFLAAMSLIIVMFFVPMAVQNSPQARIKRRLTTVGRAGYTSR
Ga0209382_1211828713300027909Populus RhizosphereMSLFLIAIFVFLSAMSLIVILFMLPMAVKDTAQARIKRRLTTIGHMTHASRSE
Ga0307503_1004476433300028802SoilMSLILISIFSFLAAVSLVVILFLLPMAVQDTAQARIKRRLTAIGKLDY
Ga0247656_116655223300030547SoilMSLFLIAIFVFLAAVSLIVIVFMLPMAVKDTAQARIKRRLTTIGHMTHASRSELQHLLKA
Ga0247647_120634223300030570SoilMSLLIISIFAFLSAVSLIVILFVLPMAVQDSPQARIKRRLTTIGRLDRASRAEVQNILK
Ga0170819_1487464613300031469Forest SoilMSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTT
Ga0310813_1161401833300031716SoilMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTVGRLGQA
Ga0306917_1076901413300031719SoilMSLLLISIFAFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTVGRLGQSSRAE
Ga0307468_10153044923300031740Hardwood Forest SoilMSLLLIVIFAFLSMMSLIVIVFMLPMAVQDTPQARIRRRLSAIGRMDSASKA
Ga0310907_1014729623300031847SoilMSLLLIAIFSFLAAVSLVVILFMLPMAVQDTAQARIKRRLTA
Ga0307410_1011499333300031852RhizosphereMSLFLIAIFVFLSAMSLVVIIFMLPMAVKDTAQARIKRRLTTIGHMTHASRSE
Ga0310885_1029860213300031943SoilMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGRLGQASRAEMATILKT
Ga0326597_1175993223300031965SoilMSLLVIVIFSFLAAMSLIVILFMLPMAVQDSAQARI
Ga0310902_1024568923300032012SoilMNLLLIVIFSFLAAMSLIIVIFFVPMAVQNSPQARIKRRLTTIGR
Ga0307471_10006753713300032180Hardwood Forest SoilMNLLLIALFSFLALMSLIIVMFFVPMAVQNSPQARIK
Ga0310812_1031843413300032421SoilMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTVGRLGQVSRAEMA
Ga0316603_1105751413300033413SoilMSLLLITIFSFLAAVSLVVILFLLPMAVQDTAQARIKRRLTAIG
Ga0314785_001795_1039_11973300034479SoilMSLFLIAIFVFLSAMSLIVIIFMLPMAVKDTAQARIKRRLTTIGHMTHASRSE
Ga0314782_011076_3_1733300034661SoilMSLLLIVTFSFLASVSLIVILFMLPMAVQDTAQARIKRRLTAIGKLDYASKSEIQSL
Ga0314782_018399_980_11593300034661SoilMSLLLISIFSFLAAVSLIVILFMLPMAVQDSPQARIKRRLTTIGRFDQASRAEMQSILKT
Ga0314784_120086_427_5673300034663SoilMSLLVISIFAFLSAVSLIVILFMLPMAVQDTPEARIKRRLTTIGRMD
Ga0314797_014567_1019_11653300034672SoilMSLLLIAIFSFLAAVSLVVILFMLPMAVQDTALARIKRRLTAIGKLDYA
Ga0314797_065465_3_1313300034672SoilMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTI
Ga0314798_061353_612_7253300034673SoilMNLLLISIFSFLAAVSLIVILFMLPMAVQDSAQARIKR
Ga0314800_050088_3_1643300034675SoilMNLLLISIFSFLAAVSLIVILFMLPMAVQDTPQARIKRRLTTIGRLGQASRAEM


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.