Basic Information | |
---|---|
Family ID | F076627 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 118 |
Average Sequence Length | 46 residues |
Representative Sequence | GSVSGDLSSEVPLGSDPGSAEGYGPTLVVRGKTVSGDFRVFRAS |
Number of Associated Samples | 105 |
Number of Associated Scaffolds | 118 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.85 % |
% of genes near scaffold ends (potentially truncated) | 99.15 % |
% of genes from short scaffolds (< 2000 bps) | 94.92 % |
Associated GOLD sequencing projects | 100 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.42 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.525 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.322 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.271 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.915 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 18.06% Coil/Unstructured: 81.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 118 Family Scaffolds |
---|---|---|
PF07690 | MFS_1 | 61.86 |
PF05977 | MFS_3 | 11.86 |
PF02637 | GatB_Yqey | 5.93 |
PF02934 | GatB_N | 2.54 |
PF01636 | APH | 1.69 |
PF00072 | Response_reg | 0.85 |
PF01425 | Amidase | 0.85 |
PF02882 | THF_DHG_CYH_C | 0.85 |
PF00903 | Glyoxalase | 0.85 |
COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
---|---|---|---|
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 11.86 |
COG0064 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit | Translation, ribosomal structure and biogenesis [J] | 8.47 |
COG2511 | Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain | Translation, ribosomal structure and biogenesis [J] | 8.47 |
COG1610 | Uncharacterized conserved protein YqeY, may have tRNA amino acid amidase activity | General function prediction only [R] | 5.93 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.85 |
COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 0.85 |
COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.53 % |
Unclassified | root | N/A | 8.47 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090008|P3_DRAFT_NODE_107970_len_1027_cov_9_116845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1077 | Open in IMG/M |
2124908043|A2_c1_ConsensusfromContig13432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig1194442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
2140918007|ConsensusfromContig15602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 985 | Open in IMG/M |
2166559005|cont_contig109612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
2170459006|GBPF9FW01D4NOU | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
3300001418|JGI20188J14859_1006111 | All Organisms → cellular organisms → Bacteria | 1598 | Open in IMG/M |
3300001686|C688J18823_10647985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 673 | Open in IMG/M |
3300005176|Ga0066679_10759775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 623 | Open in IMG/M |
3300005178|Ga0066688_10954418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
3300005434|Ga0070709_11634274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 525 | Open in IMG/M |
3300005435|Ga0070714_102281095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
3300005439|Ga0070711_101726235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
3300005467|Ga0070706_101598049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 595 | Open in IMG/M |
3300005467|Ga0070706_102007644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Nocardia | 524 | Open in IMG/M |
3300005529|Ga0070741_10337724 | Not Available | 1401 | Open in IMG/M |
3300005539|Ga0068853_102500973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
3300005542|Ga0070732_10825824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
3300005553|Ga0066695_10887442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 509 | Open in IMG/M |
3300005559|Ga0066700_10158283 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
3300005560|Ga0066670_10812521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
3300005560|Ga0066670_11012086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
3300005563|Ga0068855_101886344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
3300005577|Ga0068857_100805743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 897 | Open in IMG/M |
3300005578|Ga0068854_102291409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300005587|Ga0066654_10458357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 697 | Open in IMG/M |
3300005616|Ga0068852_100427403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1308 | Open in IMG/M |
3300005764|Ga0066903_101760375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1182 | Open in IMG/M |
3300005764|Ga0066903_104685950 | Not Available | 728 | Open in IMG/M |
3300005893|Ga0075278_1085857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
3300005896|Ga0075282_1065548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300006046|Ga0066652_101601496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
3300006606|Ga0074062_11641907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
3300006854|Ga0075425_102514543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
3300006954|Ga0079219_10821322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
3300007821|Ga0104323_119634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1520 | Open in IMG/M |
3300007821|Ga0104323_120892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1591 | Open in IMG/M |
3300009012|Ga0066710_100826011 | Not Available | 1422 | Open in IMG/M |
3300009012|Ga0066710_101047537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1260 | Open in IMG/M |
3300009137|Ga0066709_100770573 | Not Available | 1391 | Open in IMG/M |
3300009551|Ga0105238_11977184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 616 | Open in IMG/M |
3300010366|Ga0126379_11194625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 867 | Open in IMG/M |
3300010373|Ga0134128_11012371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 918 | Open in IMG/M |
3300010379|Ga0136449_103611293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 586 | Open in IMG/M |
3300010397|Ga0134124_13012080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 515 | Open in IMG/M |
3300011269|Ga0137392_10711996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
3300011271|Ga0137393_11201359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 644 | Open in IMG/M |
3300012005|Ga0120161_1098062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 704 | Open in IMG/M |
3300012200|Ga0137382_10287944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1144 | Open in IMG/M |
3300012201|Ga0137365_10765455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
3300012208|Ga0137376_11226058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 640 | Open in IMG/M |
3300012355|Ga0137369_10386335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1013 | Open in IMG/M |
3300012362|Ga0137361_10667658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 951 | Open in IMG/M |
3300012922|Ga0137394_10691467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 859 | Open in IMG/M |
3300012924|Ga0137413_11452821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
3300012977|Ga0134087_10455369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
3300012977|Ga0134087_10707139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
3300012989|Ga0164305_11777454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 556 | Open in IMG/M |
3300013100|Ga0157373_10728568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 728 | Open in IMG/M |
3300013105|Ga0157369_11582659 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 666 | Open in IMG/M |
3300013105|Ga0157369_11628059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 656 | Open in IMG/M |
3300013294|Ga0120150_1112967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
3300013307|Ga0157372_10249155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2062 | Open in IMG/M |
3300013763|Ga0120179_1031303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1265 | Open in IMG/M |
3300013772|Ga0120158_10111684 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
3300015164|Ga0167652_1010662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2005 | Open in IMG/M |
3300017821|Ga0187812_1130014 | Not Available | 815 | Open in IMG/M |
3300017927|Ga0187824_10187792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 699 | Open in IMG/M |
3300017943|Ga0187819_10365287 | Not Available | 833 | Open in IMG/M |
3300017947|Ga0187785_10076356 | Not Available | 1302 | Open in IMG/M |
3300017959|Ga0187779_10615756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
3300017959|Ga0187779_11023004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 574 | Open in IMG/M |
3300017973|Ga0187780_10499327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 869 | Open in IMG/M |
3300018030|Ga0187869_10172229 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300018071|Ga0184618_10235939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 772 | Open in IMG/M |
3300018433|Ga0066667_11635799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 575 | Open in IMG/M |
3300020081|Ga0206354_10729508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
3300024288|Ga0179589_10505246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 561 | Open in IMG/M |
3300025501|Ga0208563_1028727 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
3300025878|Ga0209584_10152415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 871 | Open in IMG/M |
3300025906|Ga0207699_10490726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 886 | Open in IMG/M |
3300025906|Ga0207699_10745459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 718 | Open in IMG/M |
3300025910|Ga0207684_11418383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
3300025917|Ga0207660_11105697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 646 | Open in IMG/M |
3300025917|Ga0207660_11151032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
3300025921|Ga0207652_10195930 | All Organisms → cellular organisms → Bacteria | 1818 | Open in IMG/M |
3300025922|Ga0207646_11551201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 572 | Open in IMG/M |
3300025949|Ga0207667_12103383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
3300026078|Ga0207702_11854995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
3300026142|Ga0207698_10148392 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
3300026550|Ga0209474_10202173 | Not Available | 1265 | Open in IMG/M |
3300027633|Ga0208988_1158126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
3300027842|Ga0209580_10546453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300027862|Ga0209701_10304488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 914 | Open in IMG/M |
3300027869|Ga0209579_10676689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 559 | Open in IMG/M |
3300028577|Ga0265318_10241856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 658 | Open in IMG/M |
3300028654|Ga0265322_10013988 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
3300028768|Ga0307280_10124596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 874 | Open in IMG/M |
3300028800|Ga0265338_10139906 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
3300028807|Ga0307305_10480314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 558 | Open in IMG/M |
3300028828|Ga0307312_11185271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 505 | Open in IMG/M |
3300031239|Ga0265328_10342414 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
3300031240|Ga0265320_10251004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
3300031242|Ga0265329_10003868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 6418 | Open in IMG/M |
3300031247|Ga0265340_10034004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2536 | Open in IMG/M |
3300031249|Ga0265339_10374096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 668 | Open in IMG/M |
3300031250|Ga0265331_10134109 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
3300031344|Ga0265316_10782902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
3300031719|Ga0306917_11132730 | Not Available | 609 | Open in IMG/M |
3300031753|Ga0307477_10351974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1013 | Open in IMG/M |
3300031753|Ga0307477_10678927 | Not Available | 690 | Open in IMG/M |
3300031938|Ga0308175_100648418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1141 | Open in IMG/M |
3300031939|Ga0308174_10427542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1071 | Open in IMG/M |
3300032261|Ga0306920_104269662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
3300032261|Ga0306920_104329929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
3300032828|Ga0335080_10259798 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
3300032954|Ga0335083_10320507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1353 | Open in IMG/M |
3300032954|Ga0335083_10807327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.32% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.47% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 8.47% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.78% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.78% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.08% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.39% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.39% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.39% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.39% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 2.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.54% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.54% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.54% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.69% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.69% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.69% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.69% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.85% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.85% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.85% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.85% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.85% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.85% |
Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
2170459006 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 0-10cm | Environmental | Open in IMG/M |
3300001418 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012005 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_0M | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Host-Associated | Open in IMG/M |
3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Host-Associated | Open in IMG/M |
3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
P3_DRAFT_00782260 | 2088090008 | Soil | TNLDVDAGSVSGDLSSEVPLGSDRADEAGPTLIVRGKTVSGDFRVFRAA |
A2_c1_00492010 | 2124908043 | Soil | VDAGSVSGDLASEVPLGSDPDAAGGDGPALVVRGKTVSGDFRVFRGL |
KansclcFeb2_06069540 | 2124908045 | Soil | EVGVAAGSNLDVDAGSVSGDLSSEVPLGSDPGAGVAEGPTLVVRGKTVSGDFRVYRA |
A_all_C_01982170 | 2140918007 | Soil | AAGTNLDVDAGSVSGDLASEVPLGSDPDAAGGDGPALVVRGKTVSGDFRVFRGL |
cont_0611.00006550 | 2166559005 | Simulated | RRFRPGDLTSEVPLGSDPGSGGCSWPVLVVRGKTVSGDFRVFRAV |
L01_06784920 | 2170459006 | Grass Soil | SEVPLADTPDRSDDGGPTVVVRGKTVSGDFRVFRAA |
JGI20188J14859_10061111 | 3300001418 | Arctic Peat Soil | GSVSGDLSSEVALGSDIGNIGGGGPTLVVRGKTVSGDFKVFRAA* |
C688J18823_106479852 | 3300001686 | Soil | DIEVGVAAGTNLDVDAGSVSGDLASEVPLGDTPGGNGGEGPVLVLRGKTVSGDFRVFRGQ |
Ga0066679_107597751 | 3300005176 | Soil | VAAGTNLDVDAGSVSGDLASEVPLGSDPSAIGGDGPALVVRGKTVSGDFRVFRGL* |
Ga0066688_109544182 | 3300005178 | Soil | DVDAGSVSGDLTSEVALGSDIGNIGPEGPMLVVRGKTVSGDFKVFRAA* |
Ga0070709_116342742 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GDIEVGVETGTNLDVDAGSVSGDLSSEVPLGSDSASAVGEGPTLVVRGKSVSGDFRVFRAG* |
Ga0070714_1022810951 | 3300005435 | Agricultural Soil | GVAAGTNVDVDANSVSGDLDSEVPLGSDSGGLAPGPTLVVRGKTVSGDFRLVRAS* |
Ga0070711_1017262351 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LDVDANSVSGDLDSEVALGGELEGLEEGGPTLVVRGKTVSGDFRIVRA* |
Ga0070706_1015980491 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VAPGSNLDVDAGSVSGDLASEVPLGSEPATGGDGPTVVVRGRTVSGDFKVFRAA* |
Ga0070706_1020076442 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TNLDVDAGSVSGELSSEVPLGSEPGEAGGDGPFLVVRGKTVSGDFRVFRAG* |
Ga0070741_103377241 | 3300005529 | Surface Soil | APGTNLDVDAGSVSGDLSSEVPLGSDPSYNGGEGPTLVVRGKTVSGDFRVFRAA* |
Ga0068853_1025009731 | 3300005539 | Corn Rhizosphere | VSGDLDSAVALGSEAGFEEGGPTLVVRGKTVSGDFRIVRA* |
Ga0070732_108258241 | 3300005542 | Surface Soil | SEVPLGSEPGAANGDGPVLVVRGKTVSGDFRVFRGQ* |
Ga0066695_108874422 | 3300005553 | Soil | LDVDAGSVSGDLSSEVPLGSEPGETEDAGPTLVLRGKTVSGDFRVFRA* |
Ga0066700_101582833 | 3300005559 | Soil | GTNLDVDAGSVSGDLTSEVPLASDPGFVGDGPTLVARGKTVSGDFRVFRAV* |
Ga0066670_108125211 | 3300005560 | Soil | AAGTNLDVDANSVSGDLNSEIPLGDDVGGLEPGPTLRVRGKTVSGDFRLVRAS* |
Ga0066670_110120861 | 3300005560 | Soil | TNLDVDAGSVSGDLDSEVALGSDIGNIGPDGPMLVVRGKTVSGDFKVFRAA* |
Ga0068855_1018863442 | 3300005563 | Corn Rhizosphere | DVDANSVSGDLDSAVALGSEAGFEEGGPTLVVRGKTVSGDFRIVRA* |
Ga0068857_1008057432 | 3300005577 | Corn Rhizosphere | HLGVAEGTNVDVDANSVSGDLSSDVPLGADPTGVHTDGPTLVVRGKTVSGDFKLVRA* |
Ga0068854_1022914092 | 3300005578 | Corn Rhizosphere | NLDVDAGSVSGDLSSDVPLGSDAGNVGDGPTLVVRGKTVSGDFKVFRAA* |
Ga0066654_104583571 | 3300005587 | Soil | TNLDVDAGSVSGDLDSEVALGSDAGNLGDGPVLVVRGKTVSGDFKVFRAA* |
Ga0068852_1004274031 | 3300005616 | Corn Rhizosphere | NSVSGDLDSEVPLGSDIGLAPGPTLVVRGKTVSGDFRLVRAGS* |
Ga0066903_1017603752 | 3300005764 | Tropical Forest Soil | AGTNLDVDAGSVSGDLASEVPLGAEPGEAGDGPTLVVRGKTVSGDFKVFRAA* |
Ga0066903_1046859501 | 3300005764 | Tropical Forest Soil | VDVDAGSASGTLSSEVPLSDSPSGDPGPTLVVRSKTVSGDFRVVRAA* |
Ga0075278_10858572 | 3300005893 | Rice Paddy Soil | SGDLTSEVPLGSEPGSATGEGPTLVVRGKTVSGDFRVFRAS* |
Ga0075282_10655481 | 3300005896 | Rice Paddy Soil | TSEVPLGSDSSAGGDDLAPLVVRGKTVSGDFRVYRAA* |
Ga0066652_1016014962 | 3300006046 | Soil | EVPLGSEPGSADGDGPTLVVRGKTVSGDFRVFRAS* |
Ga0074062_116419072 | 3300006606 | Soil | EVPLGSDPGALAVEGGPTLVVRGKTVSGDFRVFRAA* |
Ga0075425_1025145431 | 3300006854 | Populus Rhizosphere | VSGDLSSEVPLGSDPGAGMAEGPTLVVRGKTVSGDFRVYRA* |
Ga0079219_108213222 | 3300006954 | Agricultural Soil | APGTNLDVDAGSVSGDLSSDVPLGSDPGAGVAEGPALVVRGKTVSGDFRVFRA* |
Ga0104323_1196343 | 3300007821 | Soil | ELGVAAGTNLDVDAGSVSGDLASEVPLGSDPDAAGGDGPALVVRGKTVSGDFRVFRGL* |
Ga0104323_1208923 | 3300007821 | Soil | ELGVAAGTNLDVDAGSVSGDLASEVPLGSDPGALGSDGPALIVRGKTVSGDFRVFRGV* |
Ga0066710_1008260112 | 3300009012 | Grasslands Soil | EAGTSLDVDAGSVSGDLSSEVPLGSEPGSADGDGSTLVVRGKTVSGDFRVFRAS |
Ga0066710_1010475372 | 3300009012 | Grasslands Soil | AGTNLDVDAGSVSGDLDSEVPLDNDPGAAGDGPLLVVRGKTVSGDFRVFRGQ |
Ga0066709_1007705731 | 3300009137 | Grasslands Soil | GTNLDVDAGSVSGDLSSEVPLGSDAASAAGHGPTLVVRGKSVSGDFRVFRAG* |
Ga0105238_119771842 | 3300009551 | Corn Rhizosphere | GDLESEVALGSDPSGTGDGPTLVVRGKTVSGDFRLVRAS* |
Ga0126379_111946251 | 3300010366 | Tropical Forest Soil | EVPLGSEASSISDDGPTLVVRGKTVSGDFRVRRAL* |
Ga0134128_110123712 | 3300010373 | Terrestrial Soil | SGELSSEVPLGSEPCEAGGDGPVLVVRGKTVSGDFRVFRAG* |
Ga0136449_1036112931 | 3300010379 | Peatlands Soil | GSNVDVDANTVSGELSSDVPLVSVPGEGGGGPTVVVRGKTVSGDFKVLRAATPEASPAKAG* |
Ga0134124_130120801 | 3300010397 | Terrestrial Soil | LDVDAGSVSGDLASDVALGSDAAAVGEGPTVVVRGKTVSGDFKLFRAA* |
Ga0137392_107119962 | 3300011269 | Vadose Zone Soil | DAGSVSGDLTSEVPLASDPGFVGDGPTLVVRGKTVSGDFRVFRAV* |
Ga0137393_112013591 | 3300011271 | Vadose Zone Soil | NLDVDAGSVSGELASEVPLGSDPDAAGEGPMLVVRGKTVSGDFRVFRGP* |
Ga0120161_10980622 | 3300012005 | Permafrost | IELGVPTGTNLDVDAGSVSGDLASEVPLGSDPDAAAGDGPALVVRGKTVSGDFRVFRGI* |
Ga0137382_102879442 | 3300012200 | Vadose Zone Soil | VSGDLSSEVPLGSDAGSAGGDGPMLVVRGKSVSGDFRVFRAS* |
Ga0137365_107654551 | 3300012201 | Vadose Zone Soil | VSGDLSSEVPLGSEPGSADGDGPTLVVRGKTVSGDFRVFRAS* |
Ga0137376_112260581 | 3300012208 | Vadose Zone Soil | SLDVDAGSVSGDLSSEVPLGSEPGSADGDGPTLVVRGKTVSGDFRVFRAS* |
Ga0137369_103863352 | 3300012355 | Vadose Zone Soil | GVEAGTNLDVDAGSVSGDLASEVPLGSEPGGAADGPTLVVRGKTVSGNFRVIRAS* |
Ga0137361_106676581 | 3300012362 | Vadose Zone Soil | TNLDVDAGSVSGELASEVPLGSDPDAAGEGPMLVVRGKTVSGDFRVFRGP* |
Ga0137394_106914671 | 3300012922 | Vadose Zone Soil | DLTSEVPLGSEPGGEPGGPMLVVRGKTVSGDFKVFRAA* |
Ga0137413_114528212 | 3300012924 | Vadose Zone Soil | DLASEAPFGSDPDVIGGGGPALVVRGKTVSGDFRVFRGL* |
Ga0134087_104553692 | 3300012977 | Grasslands Soil | TNVDVDANSVSGDLGSDVPLGSDPDGVHGEGPTLVVRGKTVSGDFRLIRAS* |
Ga0134087_107071392 | 3300012977 | Grasslands Soil | VDAGSVSGDLSSEVPLGSDAASAAGHGPTLVVRGKSVSGDFRVFRAG* |
Ga0164305_117774541 | 3300012989 | Soil | TNLDVDAGSVSGDLSSEVPLGSDPGSAEGYGPTLVVRGKTVSGDFRVFRAS* |
Ga0157373_107285681 | 3300013100 | Corn Rhizosphere | PGTSLDVDAGSVSGDLSSEVPLGSDPGAAIAAGGPTLVVRGKTVSGDFRVFRAA* |
Ga0157369_115826592 | 3300013105 | Corn Rhizosphere | VDVDANSVSGDLSSDVPLSSDPGSAGGDGPVVVVRGKTVSGDFRITRAYAA* |
Ga0157369_116280591 | 3300013105 | Corn Rhizosphere | LDSAVALGSEAGFEEGGPTLVVRGKTVSGDFRLVRAG* |
Ga0120150_11129672 | 3300013294 | Permafrost | LDVDAGSVSGDLSSEVPLGSDAASAVGDGPTLVVRGKSVSGDFRVFRAS* |
Ga0157372_102491553 | 3300013307 | Corn Rhizosphere | DAGSVSGDLSSEVPLGSEPGVADGDGPALVVRGKTVSGDFRVFRAG* |
Ga0120179_10313032 | 3300013763 | Permafrost | VDAGSVSGDLASEVPLGSDPDAAGGDGPALVVRGKTVSGDFRVFRGL* |
Ga0120158_101116841 | 3300013772 | Permafrost | VDAGSVSGDLSSEVPLGSEPGAHEGGPSLVVRGKTVSGDFRVFRAA* |
Ga0167652_10106621 | 3300015164 | Glacier Forefield Soil | DLASEVPLGSDPDAIGGSGPALVVRGKTVSGDFRVFRGL* |
Ga0187812_11300142 | 3300017821 | Freshwater Sediment | SASGDLSSEVPLSDTPGGDVGPTVVVRGNTVSGDFRVFRAA |
Ga0187824_101877922 | 3300017927 | Freshwater Sediment | TNLDVDAGSVSGDLSSEVALGSDVGEIGDGPTLVVRGKTVSGDFRVFRAA |
Ga0187819_103652872 | 3300017943 | Freshwater Sediment | DLSSEVPLSDTPGGDVGPTVVVRGNTVSGDFRVFRAA |
Ga0187785_100763561 | 3300017947 | Tropical Peatland | GSVSGDLTSEVPLGSDFGSMGDGPTLVVRGKTVSGDFKVFRAA |
Ga0187779_106157562 | 3300017959 | Tropical Peatland | VSGDLSSEVALGDSPDSTGGGPTVVVRGKTVSGDFRVFRAA |
Ga0187779_110230042 | 3300017959 | Tropical Peatland | SVSGELTSEVPLADAPVEAGDGPTVVVRGKTVSGDFRVFRAA |
Ga0187780_104993271 | 3300017973 | Tropical Peatland | TAVSGELSSEVPLASTPELVGEGDGPTVVVRGKTVSGDFHVFRAA |
Ga0187869_101722291 | 3300018030 | Peatland | AAGSSVDVDASSVSGDLSSDVPLANVPGEGESGPTVVVRGKTVSGDFKVARAA |
Ga0184618_102359392 | 3300018071 | Groundwater Sediment | NLDVDAGSVSGDLSSEVPLGSDAASAVGDGPTLVVRGKSVSGDFRVFRAG |
Ga0066667_116357992 | 3300018433 | Grasslands Soil | DAGSVSGDLTSEVPLGSDAASAAGEGPTLVVRGKSVSGDFRVFRAG |
Ga0206354_107295082 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VSGDLSSDVPLSSDPGSAGGDGPVVVVRGKTVSGDFRITRAYAA |
Ga0179589_105052461 | 3300024288 | Vadose Zone Soil | SVSGDLSSEVPLGSDPGSAEGYGPMLVVRGKTVSGDFRVFRGQ |
Ga0208563_10287272 | 3300025501 | Peatland | GSSVDVDASSVSGDLSSDVPLANVPGEGESGPTVVVRGKTVSGDFKVARAA |
Ga0209584_101524152 | 3300025878 | Arctic Peat Soil | SGDLTSEVPLGSEPGVTHDGGPMLVVRGKTISGDFRVFRAA |
Ga0207699_104907262 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LTSEVPLGSDPDGFDNGDGPTLVVRGKTVSGDFRVFRG |
Ga0207699_107454591 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | GTSLDVDANSVSGDLDSEVALGGELEGIEGDGPTLVVRGKTVSGDFRIGRA |
Ga0207684_114183831 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AGSVSGDLSSEVPLGSEPATGGNGPTVVVRGRTVSGDFKVFRAA |
Ga0207660_111056972 | 3300025917 | Corn Rhizosphere | SGELSSEVPLGSEPGEAGGDGPVLVVRGKTVSGDFRVFRAG |
Ga0207660_111510321 | 3300025917 | Corn Rhizosphere | VSGDIHLGVAEGTNVDVDANSVSGDLSSDVPLGADPTGVHTDGPTLVVRGKTVSGDFKLVRA |
Ga0207652_101959301 | 3300025921 | Corn Rhizosphere | GSVSGDLSSEVPLGSDPGSAEGYGPTLVVRGKTVSGDFRVFRAS |
Ga0207646_115512011 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SVSGDLSSEVPLGSERGPASDGPTLVVRGKTVSGDFRVFRAL |
Ga0207667_121033832 | 3300025949 | Corn Rhizosphere | EPGTTLDVDANSVSGDLDSAVALGSEAGFEEGGPTLVVRGKTVSGDFRIVRA |
Ga0207702_118549952 | 3300026078 | Corn Rhizosphere | LSSEVPLGSDPGSAEGYGPTLVVRGKTVSGDFRVFRAS |
Ga0207698_101483923 | 3300026142 | Corn Rhizosphere | NSVSGDLDSEVPLGSDIGLAPGPTLVVRGKTVSGDFRLVRAGS |
Ga0209474_102021732 | 3300026550 | Soil | EVPLGSDAAAAAGEGPTLVVRGRSVSGDFRVVRAG |
Ga0208988_11581262 | 3300027633 | Forest Soil | NLDVDAGSVSGDLASEVPLGSDPDALGGDGPALVVRGKTVSGDFRVFRGL |
Ga0209580_105464531 | 3300027842 | Surface Soil | GSVSGDLTSEVPLGSEPNGFDNGDGPMLVVRGKTVSGDFRVFRG |
Ga0209701_103044881 | 3300027862 | Vadose Zone Soil | LDVDAGSVSGDLTSEVPLASDPGFVGDGPTLVVRGKTVSGDFRVFRAV |
Ga0209579_106766892 | 3300027869 | Surface Soil | DLTSEVPLGSDAGAVGDGPTLVVRGKTVSGDFKVFRAA |
Ga0265318_102418562 | 3300028577 | Rhizosphere | SDVPLASAPGESDGGGPVVIVRGKTVSGDFKVARAA |
Ga0265322_100139884 | 3300028654 | Rhizosphere | DLSSDVPLASAPDESEGGGPVVIVRGKTVSGDFKVARAA |
Ga0307280_101245962 | 3300028768 | Soil | APGTTLDVDAGSVSGDLSSEVPLGSDPGAVAVDGGPTLVVRGKTVSGDFRVFRAA |
Ga0265338_101399061 | 3300028800 | Rhizosphere | LTSEVPLGSEPGATHDGGPTLVVRGKTISGDFRVFRAA |
Ga0307305_104803142 | 3300028807 | Soil | AGSVSGDLSSEVPLGSDVASAAGDGPTLVVRGKSVSGDFRVFRAG |
Ga0307312_111852712 | 3300028828 | Soil | NLDVDAGSVSGDLDSEVPLGSEPGVGDGSGPTLVVRGKTVSGDFRVFRA |
Ga0265328_103424141 | 3300031239 | Rhizosphere | IAAGSNVDVDANSVSGDLSSEVALATDPGVAGVGDGPTVVVRGKTVSGDFRVFRAA |
Ga0265320_102510043 | 3300031240 | Rhizosphere | DLTSEVPLANDMGTLGGGPTLVVRGNTVSGDFRVFRAA |
Ga0265329_100038689 | 3300031242 | Rhizosphere | SSDVPLASAPGESDGGGPVVIVRGKTVSGDFKVARAA |
Ga0265340_100340043 | 3300031247 | Rhizosphere | AGSVSGDLTSEVPLGSEPGATHDGGPTLVVRGKTISGDFRVFRAA |
Ga0265339_103740962 | 3300031249 | Rhizosphere | DLSSDVPLASAPGESDGGGPVVIVRGKTVSGDFKVARAA |
Ga0265331_101341091 | 3300031250 | Rhizosphere | DVPLASAPGESDGGGPVVIVRGKTVSGDFKVARAA |
Ga0265316_107829021 | 3300031344 | Rhizosphere | GDLSSDVPLASAPGESDGGGPVVIVRGKTVSGDFKVARAA |
Ga0306917_111327301 | 3300031719 | Soil | LSSEVPLSGTRNDGPGPTLVVRSKTVSGDFRVVRAA |
Ga0307477_103519742 | 3300031753 | Hardwood Forest Soil | PGTNLDVDAGSVSGDLTSEVPLGSDAGAVGDGPTLVVRGRTVSGDFKVFRAA |
Ga0307477_106789272 | 3300031753 | Hardwood Forest Soil | DVDAASASGELSSEVPLSGTPGDNAGPTVVVRGNTVSGDFRVFRAA |
Ga0308175_1006484181 | 3300031938 | Soil | ANSVSGDLESDVPLASDPSGANGEGPTLVVRGKTVSGDFRLVRG |
Ga0308174_104275422 | 3300031939 | Soil | SGDIRVGVAAGTNVDVDANSVSGDLDSEVPLGTDIGLAPGPTLVVRGKTVSGDFRLVRAG |
Ga0306920_1042696622 | 3300032261 | Soil | LSSEVPLSGERSEGPGPTLVVRSKTVSGDFRVVRAA |
Ga0306920_1043299292 | 3300032261 | Soil | GDLTSEVPLSAVPSGEADPTLVVRGKTVSGDVRLVRAG |
Ga0335080_102597983 | 3300032828 | Soil | SGELSSEVPLASSPELAGAGDGPTVVVRGKTVSGDFHVFRAA |
Ga0335083_103205071 | 3300032954 | Soil | SSDVPLTSDPGEGGDGPTVILRGKTVSGDLKVFRSI |
Ga0335083_108073272 | 3300032954 | Soil | TSEVALADTPGAAGAGPTVVVRGKTVSGDFRVFRAA |
⦗Top⦘ |