NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F076768

Metagenome Family F076768

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076768
Family Type Metagenome
Number of Sequences 117
Average Sequence Length 43 residues
Representative Sequence MSKVLGKGNYIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPS
Number of Associated Samples 39
Number of Associated Scaffolds 117

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Archaea
% of genes with valid RBS motifs 89.74 %
% of genes near scaffold ends (potentially truncated) 9.40 %
% of genes from short scaffolds (< 2000 bps) 62.39 %
Associated GOLD sequencing projects 38
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (58.120 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(66.667 % of family members)
Environment Ontology (ENVO) Unclassified
(68.376 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(48.718 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.68%    β-sheet: 22.54%    Coil/Unstructured: 64.79%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 117 Family Scaffolds
PF04883HK97-gp10_like 7.69
PF04860Phage_portal 3.42
PF09956DUF2190 2.56
PF00005ABC_tran 1.71
PF01978TrmB 0.85
PF04266ASCH 0.85
PF00752XPG_N 0.85
PF14947HTH_45 0.85
PF13091PLDc_2 0.85
PF00382TFIIB 0.85
PF03237Terminase_6N 0.85
PF00266Aminotran_5 0.85
PF00227Proteasome 0.85
PF00583Acetyltransf_1 0.85
PF05065Phage_capsid 0.85
PF12706Lactamase_B_2 0.85
PF00903Glyoxalase 0.85
PF08378NERD 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 117 Family Scaffolds
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 0.85
COG063820S proteasome, alpha and beta subunitsPosttranslational modification, protein turnover, chaperones [O] 0.85
COG2411Predicted RNA-binding protein, contains PUA-like ASCH domainGeneral function prediction only [R] 0.85
COG3097Uncharacterized conserved protein YqfB, UPF0267 familyFunction unknown [S] 0.85
COG3484Predicted proteasome-type proteasePosttranslational modification, protein turnover, chaperones [O] 0.85
COG4405Predicted RNA-binding protein YhfF, contains PUA-like ASCH domainGeneral function prediction only [R] 0.85
COG4653Predicted phage phi-C31 gp36 major capsid-like proteinMobilome: prophages, transposons [X] 0.85
COG5405ATP-dependent protease HslVU (ClpYQ), peptidase subunitPosttranslational modification, protein turnover, chaperones [O] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms58.12 %
UnclassifiedrootN/A41.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003218|JGI26339J46600_10127999Not Available603Open in IMG/M
3300005800|Ga0079639_1004600All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4224Open in IMG/M
3300005800|Ga0079639_1016328All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1944Open in IMG/M
3300005800|Ga0079639_1020992All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1652Open in IMG/M
3300009518|Ga0116128_1040332Not Available1507Open in IMG/M
3300009519|Ga0116108_1000543All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon21324Open in IMG/M
3300009549|Ga0116137_1048418All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1391Open in IMG/M
3300009614|Ga0116104_1000034All Organisms → cellular organisms → Archaea146857Open in IMG/M
3300009629|Ga0116119_1009634Not Available2921Open in IMG/M
3300009643|Ga0116110_1184895All Organisms → cellular organisms → Archaea → TACK group680Open in IMG/M
3300010324|Ga0129297_10000677All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon16755Open in IMG/M
3300010328|Ga0129298_10439196Not Available597Open in IMG/M
3300012964|Ga0153916_10876816Not Available978Open in IMG/M
(restricted) 3300013127|Ga0172365_10023462All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4356Open in IMG/M
(restricted) 3300013127|Ga0172365_10058745Not Available2529Open in IMG/M
(restricted) 3300013127|Ga0172365_10094625All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1912Open in IMG/M
(restricted) 3300013127|Ga0172365_10134371All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1554Open in IMG/M
(restricted) 3300013127|Ga0172365_10147706Not Available1468Open in IMG/M
(restricted) 3300013127|Ga0172365_10190011Not Available1261Open in IMG/M
(restricted) 3300013127|Ga0172365_10203022All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1212Open in IMG/M
(restricted) 3300013127|Ga0172365_10211070All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1184Open in IMG/M
(restricted) 3300013127|Ga0172365_10214304All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1173Open in IMG/M
(restricted) 3300013127|Ga0172365_10357604Not Available860Open in IMG/M
(restricted) 3300013127|Ga0172365_10655145Not Available597Open in IMG/M
(restricted) 3300013128|Ga0172366_10069104All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2415Open in IMG/M
(restricted) 3300013128|Ga0172366_10160074All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1465Open in IMG/M
(restricted) 3300013128|Ga0172366_10194775All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1301Open in IMG/M
(restricted) 3300013128|Ga0172366_10235511All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1159Open in IMG/M
(restricted) 3300013128|Ga0172366_10459754All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon767Open in IMG/M
(restricted) 3300013128|Ga0172366_10629964All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon633Open in IMG/M
(restricted) 3300013128|Ga0172366_10663582Not Available614Open in IMG/M
(restricted) 3300013129|Ga0172364_10144991Not Available1624Open in IMG/M
(restricted) 3300013129|Ga0172364_10428891All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon845Open in IMG/M
(restricted) 3300013129|Ga0172364_10432451Not Available841Open in IMG/M
(restricted) 3300013129|Ga0172364_10682766All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon638Open in IMG/M
(restricted) 3300013129|Ga0172364_10909507All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon539Open in IMG/M
(restricted) 3300013130|Ga0172363_10392338All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon902Open in IMG/M
(restricted) 3300013130|Ga0172363_10763689All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon603Open in IMG/M
3300014153|Ga0181527_1134930Not Available1101Open in IMG/M
3300017929|Ga0187849_1000801All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon39364Open in IMG/M
3300017929|Ga0187849_1090110Not Available1320Open in IMG/M
3300017941|Ga0187850_10000830All Organisms → cellular organisms → Archaea37599Open in IMG/M
3300017973|Ga0187780_10138979All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1682Open in IMG/M
3300017996|Ga0187891_1259653Not Available575Open in IMG/M
3300018004|Ga0187865_1190427Not Available702Open in IMG/M
3300018005|Ga0187878_1004011All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon11642Open in IMG/M
3300018016|Ga0187880_1000429All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon35829Open in IMG/M
3300018018|Ga0187886_1003434All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon11842Open in IMG/M
3300018018|Ga0187886_1075301Not Available1468Open in IMG/M
3300018024|Ga0187881_10034798All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2574Open in IMG/M
3300018024|Ga0187881_10250310Not Available742Open in IMG/M
3300018088|Ga0187771_10502332Not Available1026Open in IMG/M
3300018088|Ga0187771_10553163Not Available975Open in IMG/M
3300018088|Ga0187771_11454186Not Available581Open in IMG/M
3300018088|Ga0187771_11868013Not Available510Open in IMG/M
3300018089|Ga0187774_10585321All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon719Open in IMG/M
3300022221|Ga0224506_10003845Not Available9838Open in IMG/M
3300022551|Ga0212089_10001009All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon21083Open in IMG/M
3300027825|Ga0209039_10141195Not Available1008Open in IMG/M
3300027825|Ga0209039_10141196Not Available1008Open in IMG/M
3300031463|Ga0272448_1200850Not Available1007Open in IMG/M
3300031463|Ga0272448_1247149Not Available832Open in IMG/M
3300031862|Ga0315280_10002462All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon29958Open in IMG/M
3300031862|Ga0315280_10002965All Organisms → cellular organisms → Archaea26707Open in IMG/M
3300031862|Ga0315280_10004810All Organisms → cellular organisms → Archaea → TACK group19643Open in IMG/M
3300031862|Ga0315280_10008065All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon13917Open in IMG/M
3300031862|Ga0315280_10008804All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon13142Open in IMG/M
3300031862|Ga0315280_10010177All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon11854Open in IMG/M
3300031862|Ga0315280_10018228Not Available7769Open in IMG/M
3300031862|Ga0315280_10019437All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon7397Open in IMG/M
3300031862|Ga0315280_10039389All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4323Open in IMG/M
3300031862|Ga0315280_10049076All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3643Open in IMG/M
3300031862|Ga0315280_10051240Not Available3521Open in IMG/M
3300031862|Ga0315280_10089176All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2256Open in IMG/M
3300031862|Ga0315280_10090300All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2232Open in IMG/M
3300031862|Ga0315280_10091471Not Available2209Open in IMG/M
3300031862|Ga0315280_10142043All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1527Open in IMG/M
3300031862|Ga0315280_10159166All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1384Open in IMG/M
3300031862|Ga0315280_10164112All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1348Open in IMG/M
3300031862|Ga0315280_10176215All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1269Open in IMG/M
3300031862|Ga0315280_10187543Not Available1203Open in IMG/M
3300031862|Ga0315280_10208813Not Available1098Open in IMG/M
3300031862|Ga0315280_10220049All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1050Open in IMG/M
3300031862|Ga0315280_10348558Not Available709Open in IMG/M
3300031862|Ga0315280_10376012All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon666Open in IMG/M
3300031862|Ga0315280_10387837All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon649Open in IMG/M
3300031862|Ga0315280_10419235Not Available610Open in IMG/M
3300031862|Ga0315280_10419474Not Available609Open in IMG/M
3300032020|Ga0315296_10000238All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon50876Open in IMG/M
3300032020|Ga0315296_10217542All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1131Open in IMG/M
3300032020|Ga0315296_10328951All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon857Open in IMG/M
3300032020|Ga0315296_10349962Not Available821Open in IMG/M
3300032069|Ga0315282_10018642All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon9884Open in IMG/M
3300032069|Ga0315282_10044749All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon5008Open in IMG/M
3300032069|Ga0315282_10071546All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3410Open in IMG/M
3300032069|Ga0315282_10077338All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3196Open in IMG/M
3300032069|Ga0315282_10121187All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2197Open in IMG/M
3300032069|Ga0315282_10134182Not Available2019Open in IMG/M
3300032069|Ga0315282_10150854Not Available1835Open in IMG/M
3300032069|Ga0315282_10152715All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1817Open in IMG/M
3300032069|Ga0315282_10154405Not Available1801Open in IMG/M
3300032069|Ga0315282_10354078Not Available915Open in IMG/M
3300032069|Ga0315282_10424314Not Available789Open in IMG/M
3300032069|Ga0315282_10580136All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon612Open in IMG/M
3300032070|Ga0315279_10000739All Organisms → cellular organisms → Archaea60277Open in IMG/M
3300032070|Ga0315279_10001952All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon32544Open in IMG/M
3300032070|Ga0315279_10004166All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon19574Open in IMG/M
3300032118|Ga0315277_10025321All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon7143Open in IMG/M
3300032118|Ga0315277_10031345All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon6331Open in IMG/M
3300032173|Ga0315268_10129167Not Available2390Open in IMG/M
3300032173|Ga0315268_10562253Not Available1129Open in IMG/M
3300032173|Ga0315268_10768427All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon963Open in IMG/M
3300032173|Ga0315268_10848279Not Available916Open in IMG/M
3300032173|Ga0315268_11020824Not Available834Open in IMG/M
3300032829|Ga0335070_10044082Not Available4957Open in IMG/M
3300032829|Ga0335070_11884750Not Available540Open in IMG/M
3300033991|Ga0334965_0064820Not Available1691Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment66.67%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.40%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.13%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.13%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment2.56%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.56%
Thermal Hot SpringEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Thermal Hot Spring2.56%
SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment1.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.71%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.85%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.85%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003218Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1EnvironmentalOpen in IMG/M
3300005800Sediment microbial communities of hot springs in Rotorua, New Zealand ? Tikitere hot spring, NZ13EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009614Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300010324Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaGEnvironmentalOpen in IMG/M
3300010328Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300022221Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022551Boni_combined assemblyEnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300031463Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-019-1EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300032020Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18EnvironmentalOpen in IMG/M
3300032069Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20EnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300033991Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bactEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI26339J46600_1012799923300003218Bog Forest SoilVSRVLTKGNYILAKVNGSKKVLTSTEMQQLINDGYDVEVVTAA*
Ga0079639_100460043300005800Thermal Hot SpringMSYWGKVIGKGNYIVAKVNGVKMVLTSAELKWLLDNGYDVEVVG*
Ga0079639_101632833300005800Thermal Hot SpringMSYWGKIIGKGNYIVAKVNGVRMTLTSAELKWFLDNGYDVEVVG*
Ga0079639_102099223300005800Thermal Hot SpringMSYWGKIIGKGNYIVAKVNGVKMVLTSSELRWFLDNGYDVEVVG*
Ga0116128_104033223300009518PeatlandVLGKGNYIVAKVNGAKMVLSSAEFQRLLDDGYDIEVVG*
Ga0116108_1000543293300009519PeatlandMSYPDKVLGKGNYIVAKVNGAKMVLSSAEFQRLLDDGYDIEVVG*
Ga0116137_104841833300009549PeatlandMSYPDKVLGRGNYIVAKVNGVKMTLTSVELQRLLCDGYDVEVTSS*
Ga0116104_1000034843300009614PeatlandVSKVLGKGNYILAKVNGTKMVLTSTEMQQLINNGYDVEVVTPT*
Ga0116119_100963413300009629PeatlandPMSYPDKVLGKGNYIVAKVNGAKMVLSSAEFQRLLDDGYDIEVVG*
Ga0116110_118489523300009643PeatlandMSYGKVLTKGNYILAKVNGVKMVLSSGELGQLICDGYDVEVVTST*
Ga0129297_10000677143300010324Lake SedimentMSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIVG*
Ga0129298_1043919613300010328Lake SedimentVSQSMSKVLGKGNFIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPS*
Ga0153916_1087681623300012964Freshwater WetlandsLSKVLGKGNYIVAKVNGTKTVLTGAEFQQLLDNGYDVEVISSF*
(restricted) Ga0172365_1002346223300013127SedimentMSYWGHVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSS*
(restricted) Ga0172365_1005874513300013127SedimentMSKVLGKGNYIVAKVNAVKMVLTSAELKQLMDNGYDVEVVTSS*
(restricted) Ga0172365_1009462523300013127SedimentMSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSF*
(restricted) Ga0172365_1013437133300013127SedimentMSKVLGKGNYIIAKVNNVKMVLTSAELKQLMDNGYDVEIVG*
(restricted) Ga0172365_1014770623300013127SedimentMSHVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSF*
(restricted) Ga0172365_1019001133300013127SedimentMSKVLGKGNYIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPT*
(restricted) Ga0172365_1020302233300013127SedimentMSYWGHVLGKGNYVVAKVNGVKMVLTSAELQQMLDNGYDVEICTPS*
(restricted) Ga0172365_1021107023300013127SedimentMNKVLGKGNYIVAKVNGVKMVLTSTELQQLLDNGYDVEVVTAS*
(restricted) Ga0172365_1021430413300013127SedimentMSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEVLSAS*
(restricted) Ga0172365_1035760433300013127SedimentMSNVLGKGNYIIAKVNGVKMVLTSAELKQLMDNGYDVEIVG*
(restricted) Ga0172365_1065514523300013127SedimentMSYWGHVLGRGNYIVAKVNGVKMVLTSAEMQRLINAGYDIEVMG*
(restricted) Ga0172366_1006910443300013128SedimentMSKVLGKGNYIVAKVNGVKMVLTSTELQQLLDNGYDVEVVTAS*
(restricted) Ga0172366_1016007443300013128SedimentMSYWGHVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVE
(restricted) Ga0172366_1019477523300013128SedimentMSYWGHVLGKGNYIVAKVNGAKMALTSAELQQLLDNGYDVEIITSP*
(restricted) Ga0172366_1023551123300013128SedimentMSNVLGKGNYIVAKVNGVKMVLTSAELKQLMDHGYDVEIITSF*
(restricted) Ga0172366_1045975433300013128SedimentMSYWGHVLGKGNYIVAKVNGVKMVLTSAEMQRLINAGYDIEVMS*
(restricted) Ga0172366_1062996423300013128SedimentMSKVLGKGNYIVAKVNNVKQVLTSAELKQLIDNGYDVEIVTLS*
(restricted) Ga0172366_1066358223300013128SedimentMSYWGHVLGRGNYIVAKVNGVKMVLTSAEMQQLINAGYDVEVITVS*
(restricted) Ga0172364_1014499123300013129SedimentMSYWGHVLGRGNYIVAKVNGVTMVLTSAEMQRLINAGYDIEVMG*
(restricted) Ga0172364_1042889123300013129SedimentMSYWGHVLGKGNYVVAKVNGVKMVLTSAELQQLLDNGYDVGICTPS*
(restricted) Ga0172364_1043245113300013129SedimentMSNVLGKGNYIIAKVNNVKMVLTSAELKQLMDNGYDVEIVG*
(restricted) Ga0172364_1068276613300013129SedimentMSKVLGKGNYIVAKVNGVKQVLTSAELKQLMDNGYDVEIITSF*
(restricted) Ga0172364_1090950713300013129SedimentMSKVLGKGNYIVAKVNSVKMVLTSAELKQLLDNGYDVEVVVSS*
(restricted) Ga0172363_1039233823300013130SedimentMSYWDHVLGKGNYIVTKVNGVKMVLTSAELQQLLDNGYDVEICTPS*
(restricted) Ga0172363_1076368923300013130SedimentMSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSS*
Ga0181527_113493023300014153BogMSYGKVLGKGGNYILAKVNGVKTVVSSSELQHLICDGYDVEVVTPF*
Ga0187849_1000801413300017929PeatlandMSYPDKVLGKGNYIVAKVNGAKMVLSSAEFQRLLDDGYDIEVVG
Ga0187849_109011033300017929PeatlandMSYPDKVLGKGNYILAKVNGVKMTLTSAELGRLLCDGYDVEVVSPT
Ga0187850_10000830263300017941PeatlandVSKVLGKGNYILAKVNGTKMVLTSTEMQQLINNGYDVEVVTPT
Ga0187780_1013897923300017973Tropical PeatlandMSYGKSLLRGNFILAKVNGVKTVLSSGEMQRLICEGYDVEVVAPA
Ga0187891_125965313300017996PeatlandGNYILAKVNGVKTVLSSTELQNLIREGYDLEVVTPV
Ga0187865_119042723300018004PeatlandMSYPDKVLGRGNYIVAKVNGVKMTLTSVELQRLLCDGYDVEVTSS
Ga0187878_100401123300018005PeatlandMSYPDKVLGKGNYILAKVNGVKMTLTSAELGRLLCHGYDAEVVLPT
Ga0187880_1000429233300018016PeatlandMSYGKVLTKGNYILAKVNGVKMVLSSGELGQLICDGYDVEVVTST
Ga0187886_100343453300018018PeatlandMSYPDKVLGKGNYILAKVNGVKMTLTSAELGRLLCHGYDVEVVSST
Ga0187886_107530113300018018PeatlandSPNLQRRPHEPMSYPDKVLGKGNYIVAKVNGAKMVLSSAEFQRLLDDGYDIEVVG
Ga0187881_1003479823300018024PeatlandMSYPDKVLGKGNYIVAKVNGAKMVLTSGEFQRLIDDGYDVEVVTSS
Ga0187881_1025031023300018024PeatlandVSKVLGKGNFIVAKVGGVKQVLSSAELQRFQDAGYDVEVVTF
Ga0187771_1050233233300018088Tropical PeatlandMSKVLTKGNYILAKVNGTKMVLSSAEMQQLIRDGYDVEVVTAT
Ga0187771_1055316323300018088Tropical PeatlandMSKVLTKGNFILAKVNGIKMVLSSAEMQQLIRDGYDVEVVTAS
Ga0187771_1145418613300018088Tropical PeatlandMSQVLGKGNYIVAKVNGFRQVLTSGEVKRLLHAGYDVEIIRAR
Ga0187771_1186801313300018088Tropical PeatlandVSKVLTKGNYILAKVNGSKMVLSSAEMQQLIRDGYDVEV
Ga0187774_1058532113300018089Tropical PeatlandMSKVLGKGNYILAKVNGTKMVLTSAEMQQLINNGYDVEVLTPT
Ga0224506_1000384543300022221SedimentMSKVLGKGNYIVAKVNGVKQVLTSAEMQQLINNGYDVEVVTPT
Ga0212089_10001009193300022551Lake SedimentMSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIVG
Ga0209039_1014119523300027825Bog Forest SoilVSRVLTKGNYILAKVNGSKKVLTSTEIQQLINDGYDVEVVTAT
Ga0209039_1014119623300027825Bog Forest SoilVSRVLTKGNYILAKVNGSKKVLTSTEMQQLINDGYDVEVVTAA
Ga0272448_120085013300031463SedimentVSKVLGKGNFIVARVNGVKTVLSSRELQMLLDNGEDVEVVSST
Ga0272448_124714923300031463SedimentVSKVLGKGNYVVARVNGVKTVLSSAELQRLFDSGEDVEVVSPS
Ga0315280_10002462143300031862SedimentMSYWGHVLGKGNYIVARVNSVKMVLTSAELQQLLDNGYDVEIVTPS
Ga0315280_10002965103300031862SedimentMSKVVGKGNYIVARVNGTRMVLTSTELQKLIDDGYDVEVVG
Ga0315280_1000481063300031862SedimentMSKVLGKGNYIVAKVNGVKQVLTSAEMQRLINDGYDVEVVTST
Ga0315280_10008065173300031862SedimentMSKVLGKGNFIVAKVNGVKQVLTSAEMQQLINNGYDVEVVTPT
Ga0315280_1000880493300031862SedimentMSKVLGKGNYIVAKVNGVKQVLTSAEMQQLINDGYDVEVVTPS
Ga0315280_10010177103300031862SedimentMSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSS
Ga0315280_1001822843300031862SedimentMSKVLVKGNYIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPS
Ga0315280_1001943763300031862SedimentMSKVLGKGNYIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPS
Ga0315280_1003938933300031862SedimentMSKVLGKGNYIVAKVNCVKMVLTSAELKQLMDNGYDVEVVG
Ga0315280_1004907643300031862SedimentMSHVLGKGNYIVAKVNGVKMVLTSAELQQLINNGYDVEVVTPS
Ga0315280_1005124043300031862SedimentMSYWGHVLGKGNYIVARVNGVKMVLTSAELQQLLDNGYDVEMVTPS
Ga0315280_1008917633300031862SedimentMSKVLGKGNYIVAKVNNVKMVLTSAELKQLMDNGYDVEVVTSS
Ga0315280_1009030043300031862SedimentMSKVLGKGNYIIAKVNNVKMVLTSTELKQLMDNGYDVEIVG
Ga0315280_1009147143300031862SedimentMSKVLTKGNYILAKVNGSKKVLTSTEMQQLINNGYDVEVLTPT
Ga0315280_1014204313300031862SedimentMSKVLGKGNYIVAKVNGVKQVLTSAEMQRLINDGCDVEVVTPS
Ga0315280_1015916623300031862SedimentMSYWGHVLGKGNFIVARVNSVKMVLTSAELKQLLDNGYDVEVVVSS
Ga0315280_1016411223300031862SedimentMSKVLGKGNYIVAKVNGAKMVLTSAELKQLMDNGYDVEIVG
Ga0315280_1017621523300031862SedimentMSYWGHVLGKGNYIVAKVNGAKMVLTSAELQQLLDNGYDVEVLTSS
Ga0315280_1018754333300031862SedimentLGKGNYIVAKVNGVKQVLTSAEMQRLVNDGCDVEVVTPS
Ga0315280_1020881323300031862SedimentMSHVLGKGNYIVAKVNGVKQVLTSAELQQLINNGYDVEVVTPT
Ga0315280_1022004923300031862SedimentMSKVLGKGNYIVAKVNSTKMVLTNAELKQLMDNGYDVEIVSS
Ga0315280_1034855813300031862SedimentMSRVLGKGNYIVARVNATRMVLTSTELQKLIDDGYDVEVVG
Ga0315280_1037601223300031862SedimentMSKVLGKGNYIVARVNGTKMVLTSAELKQLMDNGYDVEVIASS
Ga0315280_1038783723300031862SedimentMSYWGHVLGKGNFIVAKVNGAKMVLTSAELQQLLDNGYDVEILTSS
Ga0315280_1041923513300031862SedimentMSKVLGKGNYVVAKVNSVKMVLTSAELQKLIDDGYDVEVVG
Ga0315280_1041947413300031862SedimentQSMSKVLGKGNFIVAKVNGVKQVLTSAEMQQLINNGYDVEVVTPT
Ga0315296_10000238273300032020SedimentMSKVLGKGNYIVAKVNNVKMVLTSAELKQLMDNGYDVEVVG
Ga0315296_1021754243300032020SedimentMSKVLGKGNYIVAKVNNVKMVLTSAEFKQLMDNGYDVEVVTSS
Ga0315296_1032895133300032020SedimentMSYWGHVLGKGNYIVAKVNGAKMVLTSAELKQLLDNGYDVEVLTSS
Ga0315296_1034996223300032020SedimentMSKVLGKGNYIVAKVNGVKQVLTSAEMQRLINDGYDVEVVTPS
Ga0315282_1001864263300032069SedimentMSKVLGEGNYIVARVNGTRMILTSTELQKLIDDGYDVEVVG
Ga0315282_1004474953300032069SedimentMSKVLGKGNYVVAKVNSVKQVLTSTELQKLIDDGYDVEVVG
Ga0315282_1007154623300032069SedimentMSKVVGKGNYIVAKVNSVKMVLTSAELQKLIDDGYDVEVVTSS
Ga0315282_1007733833300032069SedimentMSHVLGKGNYIVAKVNNVKMVLTSAELQQLMDNGYDVEIVASS
Ga0315282_1012118723300032069SedimentMSYWGHVLGKGNFIVAKVNGAKMVLTSAELQQLLDNGYDVEIITSS
Ga0315282_1013418223300032069SedimentMSKVLGKGNFVVARVNGTRTVLSSSELQRLLDDGEDVEVVSPS
Ga0315282_1015085443300032069SedimentMSKVLGKGNFVVARVNGVKTVLSSAELQRLLDDGEDVEVVSPS
Ga0315282_1015271533300032069SedimentVSKVLGKGNFIVAKVNGVKQVLTSAEMQQLINNGYDVEVVTPT
Ga0315282_1015440523300032069SedimentMSKVLGKGNYIVAKVNGVKQVLTSAEMQRLINDGYDVEVVMST
Ga0315282_1035407813300032069SedimentVSKVLGKGNFVVARVNGVKTVLSSAELQRLFDSGEDVEVVSPS
Ga0315282_1042431433300032069SedimentQSLSKGNYIVAKVNSTKMVLTSAELKQLMDNGYDVEIVSS
Ga0315282_1058013623300032069SedimentMSYWGHVLGKGNFIVAKVNGAKMVLTSAELQQLLD
Ga0315279_10000739723300032070SedimentLSKVLGKGNYIVAKVNGAKTVLTSAEFQQLLDNGYDVEVISSF
Ga0315279_10001952273300032070SedimentMSKVLGKGNYIVAKVNNVKQVLTSAELKQLLDNGYDVEVITPS
Ga0315279_10004166263300032070SedimentMSKVLGKGNYIVARVNGARQVLTSAELQRLIDAGYDVEIVTAF
Ga0315277_1002532133300032118SedimentVSKVLGKGNYILAKVNGTKMVLTSAEMQQLINNGYDVEVLTPT
Ga0315277_1003134543300032118SedimentVSKVLGKGNYILAKVNGVKMVLKSTEMQQLINDGYDVEVITPT
Ga0315268_1012916743300032173SedimentMSKVLGEGNYIVAKVNSVRMVLTSAELQKLIDDGYDVEVVTSS
Ga0315268_1056225323300032173SedimentVSKVLGKGNFVVARVYGVKTVLSSAELQRLFDSGEDVEVVSPS
Ga0315268_1076842723300032173SedimentMSYPDKVLGRGNYIVAKVNGAKMTLTSAELQRLLDCGCDVEVVTSS
Ga0315268_1084827913300032173SedimentMSYPDKVMGKGNYIVAKVNGVKMTLTSAELGRLLCDGYDVEVVSPT
Ga0315268_1102082423300032173SedimentMSKIVGKGNYIVAKVNSVKQVLTSAELQKLIDDGYDVEVVG
Ga0335070_1004408223300032829SoilMSKNLNDGNYLLAKVNGTKKVLTSTEMQQLINDGYDVEVVTAS
Ga0335070_1188475013300032829SoilMSRILGKGNYVLAKVNGTKMILTDRELQQLINNGYDVEVVTAT
Ga0334965_0064820_48_1793300033991SedimentMSKVLGKGNYIVAKVNGVKMVLTSAELKQLMDNGYDVEIITSF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.