Basic Information | |
---|---|
Family ID | F076853 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 117 |
Average Sequence Length | 39 residues |
Representative Sequence | MCKECGCNKNAIGGTPEKLTGKPTKSPYGEYEGVGGTK |
Number of Associated Samples | 73 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 80.51 % |
% of genes near scaffold ends (potentially truncated) | 22.22 % |
% of genes from short scaffolds (< 2000 bps) | 48.72 % |
Associated GOLD sequencing projects | 62 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.18 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (35.043 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (29.060 % of family members) |
Environment Ontology (ENVO) | Unclassified (87.179 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (96.581 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.55% β-sheet: 0.00% Coil/Unstructured: 95.45% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF00535 | Glycos_transf_2 | 11.97 |
PF01391 | Collagen | 5.98 |
PF13252 | DUF4043 | 5.98 |
PF07719 | TPR_2 | 5.98 |
PF02467 | Whib | 4.27 |
PF13481 | AAA_25 | 1.71 |
PF07659 | DUF1599 | 0.85 |
PF05708 | Peptidase_C92 | 0.85 |
PF05257 | CHAP | 0.85 |
PF04233 | Phage_Mu_F | 0.85 |
PF03406 | Phage_fiber_2 | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 64.96 % |
Unclassified | root | N/A | 35.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000162|TB03JUN2009H_c021671 | Not Available | 715 | Open in IMG/M |
3300000176|TB03JUN2009E_c001142 | Not Available | 6967 | Open in IMG/M |
3300000176|TB03JUN2009E_c003601 | All Organisms → Viruses → Predicted Viral | 3397 | Open in IMG/M |
3300000203|TB18AUG2009E_c000089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 23178 | Open in IMG/M |
3300000203|TB18AUG2009E_c000151 | Not Available | 15363 | Open in IMG/M |
3300000203|TB18AUG2009E_c000305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9939 | Open in IMG/M |
3300000203|TB18AUG2009E_c001080 | All Organisms → Viruses → Predicted Viral | 4843 | Open in IMG/M |
3300000203|TB18AUG2009E_c010030 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1000438 | Not Available | 32770 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1002899 | Not Available | 11686 | Open in IMG/M |
3300000553|TBL_comb47_HYPODRAFT_10098516 | All Organisms → Viruses → Predicted Viral | 1452 | Open in IMG/M |
3300001848|RCM47_1167850 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 708 | Open in IMG/M |
3300001850|RCM37_1174032 | Not Available | 748 | Open in IMG/M |
3300001968|GOS2236_1046609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1625 | Open in IMG/M |
3300002091|JGI24028J26656_1000212 | Not Available | 22956 | Open in IMG/M |
3300002091|JGI24028J26656_1000862 | All Organisms → cellular organisms → Bacteria | 7930 | Open in IMG/M |
3300002091|JGI24028J26656_1009146 | All Organisms → Viruses → Predicted Viral | 1266 | Open in IMG/M |
3300002091|JGI24028J26656_1017213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300002092|JGI24218J26658_1002028 | All Organisms → cellular organisms → Bacteria | 5521 | Open in IMG/M |
3300002092|JGI24218J26658_1003672 | All Organisms → Viruses → Predicted Viral | 3480 | Open in IMG/M |
3300002092|JGI24218J26658_1006534 | All Organisms → Viruses → Predicted Viral | 2238 | Open in IMG/M |
3300002092|JGI24218J26658_1013225 | Not Available | 1283 | Open in IMG/M |
3300002098|JGI24219J26650_1003640 | All Organisms → Viruses → Predicted Viral | 3538 | Open in IMG/M |
3300002098|JGI24219J26650_1009049 | All Organisms → Viruses → Predicted Viral | 1744 | Open in IMG/M |
3300002098|JGI24219J26650_1042089 | Not Available | 526 | Open in IMG/M |
3300002307|JGI24890J29729_1016952 | All Organisms → Viruses → Predicted Viral | 1835 | Open in IMG/M |
3300002933|G310J44882_10007829 | All Organisms → cellular organisms → Bacteria | 3387 | Open in IMG/M |
3300003375|JGI26470J50227_1012708 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
3300003375|JGI26470J50227_1013026 | All Organisms → Viruses → Predicted Viral | 2007 | Open in IMG/M |
3300003375|JGI26470J50227_1053887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300003809|Ga0007869_1016094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300003812|Ga0007861_1004645 | Not Available | 1385 | Open in IMG/M |
3300003820|Ga0007863_1011768 | Not Available | 810 | Open in IMG/M |
3300004095|Ga0007829_10084748 | Not Available | 632 | Open in IMG/M |
3300004448|Ga0065861_1007913 | Not Available | 9228 | Open in IMG/M |
3300004461|Ga0066223_1100245 | Not Available | 769 | Open in IMG/M |
3300004686|Ga0065173_1020146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1223 | Open in IMG/M |
3300004692|Ga0065171_1030533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 868 | Open in IMG/M |
3300004692|Ga0065171_1031790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 850 | Open in IMG/M |
3300004694|Ga0065170_1035607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300006071|Ga0007876_1004226 | All Organisms → Viruses → Predicted Viral | 4386 | Open in IMG/M |
3300006071|Ga0007876_1025171 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1657 | Open in IMG/M |
3300006103|Ga0007813_1003657 | All Organisms → cellular organisms → Bacteria | 4452 | Open in IMG/M |
3300006104|Ga0007882_10235099 | Not Available | 609 | Open in IMG/M |
3300006105|Ga0007819_1098701 | Not Available | 581 | Open in IMG/M |
3300006115|Ga0007816_1018303 | All Organisms → Viruses → Predicted Viral | 1644 | Open in IMG/M |
3300006120|Ga0007867_1006419 | All Organisms → cellular organisms → Bacteria | 2919 | Open in IMG/M |
3300006120|Ga0007867_1014907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 1821 | Open in IMG/M |
3300008116|Ga0114350_1054388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C455 | 1436 | Open in IMG/M |
3300008450|Ga0114880_1230459 | Not Available | 594 | Open in IMG/M |
3300009151|Ga0114962_10012265 | Not Available | 6268 | Open in IMG/M |
3300009151|Ga0114962_10035078 | Not Available | 3410 | Open in IMG/M |
3300009152|Ga0114980_10000252 | Not Available | 37917 | Open in IMG/M |
3300009154|Ga0114963_10054230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C203 | 2549 | Open in IMG/M |
3300009159|Ga0114978_10292272 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
3300009182|Ga0114959_10018722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4462 | Open in IMG/M |
3300010157|Ga0114964_10001689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16013 | Open in IMG/M |
3300010157|Ga0114964_10004075 | Not Available | 9672 | Open in IMG/M |
3300010157|Ga0114964_10041991 | Not Available | 2440 | Open in IMG/M |
3300010157|Ga0114964_10083552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1604 | Open in IMG/M |
3300010157|Ga0114964_10181644 | All Organisms → Viruses → Predicted Viral | 1015 | Open in IMG/M |
3300010157|Ga0114964_10598419 | Not Available | 517 | Open in IMG/M |
3300010158|Ga0114960_10205866 | All Organisms → Viruses → Predicted Viral | 1025 | Open in IMG/M |
3300010885|Ga0133913_10008541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 26779 | Open in IMG/M |
3300010885|Ga0133913_10121987 | All Organisms → Viruses | 6985 | Open in IMG/M |
3300012750|Ga0157568_1015891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 1034 | Open in IMG/M |
3300013285|Ga0136642_1006612 | All Organisms → Viruses → Predicted Viral | 3842 | Open in IMG/M |
3300013286|Ga0136641_1001344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10343 | Open in IMG/M |
3300013286|Ga0136641_1003925 | Not Available | 5662 | Open in IMG/M |
3300013286|Ga0136641_1074452 | Not Available | 964 | Open in IMG/M |
3300016688|Ga0180039_1063626 | Not Available | 655 | Open in IMG/M |
3300020686|Ga0214194_100167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 13041 | Open in IMG/M |
3300020686|Ga0214194_103205 | All Organisms → Viruses → Predicted Viral | 1639 | Open in IMG/M |
3300020693|Ga0214226_1012490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C455 | 907 | Open in IMG/M |
3300020710|Ga0214198_1000036 | Not Available | 42432 | Open in IMG/M |
3300020727|Ga0214246_1062462 | Not Available | 535 | Open in IMG/M |
3300020731|Ga0214170_1002839 | Not Available | 4331 | Open in IMG/M |
3300020731|Ga0214170_1019438 | All Organisms → Viruses → Predicted Viral | 1187 | Open in IMG/M |
3300021124|Ga0214199_1006642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1487 | Open in IMG/M |
3300021133|Ga0214175_1001943 | All Organisms → Viruses → Predicted Viral | 4287 | Open in IMG/M |
3300021133|Ga0214175_1012806 | All Organisms → Viruses → Predicted Viral | 1170 | Open in IMG/M |
3300021139|Ga0214166_1005779 | All Organisms → cellular organisms → Bacteria | 3970 | Open in IMG/M |
3300021139|Ga0214166_1006521 | All Organisms → Viruses → Predicted Viral | 3654 | Open in IMG/M |
3300021139|Ga0214166_1028679 | All Organisms → Viruses → Predicted Viral | 1334 | Open in IMG/M |
3300021438|Ga0213920_1000435 | Not Available | 33873 | Open in IMG/M |
3300021438|Ga0213920_1001295 | All Organisms → cellular organisms → Bacteria | 14177 | Open in IMG/M |
3300022591|Ga0236341_1000372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 28527 | Open in IMG/M |
3300022602|Ga0248169_139663 | All Organisms → Viruses → Predicted Viral | 2305 | Open in IMG/M |
3300025336|Ga0208619_108569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43 | 746 | Open in IMG/M |
3300025338|Ga0208501_100129 | All Organisms → cellular organisms → Bacteria | 3316 | Open in IMG/M |
3300025357|Ga0208383_1020064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 798 | Open in IMG/M |
3300025372|Ga0207957_1037985 | Not Available | 516 | Open in IMG/M |
3300025382|Ga0208256_1002172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3757 | Open in IMG/M |
3300025382|Ga0208256_1039568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 663 | Open in IMG/M |
3300025389|Ga0208257_1001620 | Not Available | 5285 | Open in IMG/M |
3300025396|Ga0208874_1008023 | All Organisms → Viruses → Predicted Viral | 2001 | Open in IMG/M |
3300025410|Ga0208875_1034751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300025413|Ga0208614_1002630 | Not Available | 4335 | Open in IMG/M |
3300025423|Ga0208746_1017626 | Not Available | 1310 | Open in IMG/M |
3300025423|Ga0208746_1044900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C455 | 711 | Open in IMG/M |
3300025723|Ga0208741_10109320 | Not Available | 632 | Open in IMG/M |
3300025773|Ga0208104_1008385 | All Organisms → Viruses → Predicted Viral | 1428 | Open in IMG/M |
3300025789|Ga0208499_1020990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C455 | 1197 | Open in IMG/M |
3300027708|Ga0209188_1000496 | Not Available | 38100 | Open in IMG/M |
3300027708|Ga0209188_1001976 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15617 | Open in IMG/M |
3300027708|Ga0209188_1009712 | Not Available | 5550 | Open in IMG/M |
3300027708|Ga0209188_1019020 | All Organisms → Viruses → Predicted Viral | 3569 | Open in IMG/M |
3300027708|Ga0209188_1071276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1470 | Open in IMG/M |
3300027749|Ga0209084_1001350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20765 | Open in IMG/M |
3300027777|Ga0209829_10008003 | Not Available | 6926 | Open in IMG/M |
3300027777|Ga0209829_10063323 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1901 | Open in IMG/M |
3300027896|Ga0209777_10064231 | All Organisms → cellular organisms → Bacteria | 3251 | Open in IMG/M |
3300027973|Ga0209298_10000184 | Not Available | 38850 | Open in IMG/M |
3300028392|Ga0304729_1000345 | Not Available | 34560 | Open in IMG/M |
3300028392|Ga0304729_1016926 | All Organisms → cellular organisms → Bacteria | 3198 | Open in IMG/M |
3300028392|Ga0304729_1034168 | Not Available | 2026 | Open in IMG/M |
3300028392|Ga0304729_1148665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 29.06% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 23.93% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 17.09% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 10.26% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 4.27% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.27% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.56% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 1.71% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.71% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.71% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.85% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.85% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.85% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000162 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 hypolimnion | Environmental | Open in IMG/M |
3300000176 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 03JUN2009 epilimnion | Environmental | Open in IMG/M |
3300000203 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300000553 | Trout Bog Lake May 28 2007 Hypolimnion (Trout Bog Lake Combined Assembly 47 Hypolimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300002091 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome | Environmental | Open in IMG/M |
3300002092 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B6 metagenome | Environmental | Open in IMG/M |
3300002098 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome | Environmental | Open in IMG/M |
3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
3300003809 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH03Jun09 | Environmental | Open in IMG/M |
3300003812 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 | Environmental | Open in IMG/M |
3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
3300004686 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Oct08 (version 2) | Environmental | Open in IMG/M |
3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
3300006071 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH24Aug09 | Environmental | Open in IMG/M |
3300006103 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29Jun09 | Environmental | Open in IMG/M |
3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
3300006115 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jul09 | Environmental | Open in IMG/M |
3300006120 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012750 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES069 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300016688 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES053 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020686 | Freshwater microbial communities from Trout Bog Lake, WI - 12AUG2008 epilimnion | Environmental | Open in IMG/M |
3300020693 | Freshwater microbial communities from Trout Bog Lake, WI - 01OCT2007 hypolimnion | Environmental | Open in IMG/M |
3300020710 | Freshwater microbial communities from Trout Bog Lake, WI - 20SEP2008 epilimnion | Environmental | Open in IMG/M |
3300020727 | Freshwater microbial communities from Trout Bog Lake, WI - 29MAY2009 hypolimnion | Environmental | Open in IMG/M |
3300020731 | Freshwater microbial communities from Trout Bog Lake, WI - 27JUN2007 epilimnion | Environmental | Open in IMG/M |
3300021124 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion | Environmental | Open in IMG/M |
3300021133 | Freshwater microbial communities from Trout Bog Lake, WI - 09AUG2007 epilimnion | Environmental | Open in IMG/M |
3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
3300025336 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025338 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE09Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025357 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE10Sep07 (SPAdes) | Environmental | Open in IMG/M |
3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
3300025396 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Oct08 (SPAdes) | Environmental | Open in IMG/M |
3300025410 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH25Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025723 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025773 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE29May09 (SPAdes) | Environmental | Open in IMG/M |
3300025789 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
TB03JUN2009H_0216713 | 3300000162 | Freshwater | MCAECGCNATAIGKLNDKLTGKPTKSPYGEYEGVGGTK* |
TB03JUN2009E_00114210 | 3300000176 | Freshwater | MCAECGCNSNMVGKASDKLTGKPTKDPHGSYEGVGGTKFGK* |
TB03JUN2009E_0036017 | 3300000176 | Freshwater | MCVECGCNKTMIGKASDKLTGKPTKSPYGEYEGVGGTKNK* |
TB18AUG2009E_0000899 | 3300000203 | Freshwater | MCVECGCNSNMIGKTGDKLSGKPQDPYGQYDGVGGTK* |
TB18AUG2009E_0001517 | 3300000203 | Freshwater | MCAECGCNSTAIGKLNDKLTGKPTKTPYGQYEGVGGTNNVGNSGSK* |
TB18AUG2009E_00030517 | 3300000203 | Freshwater | MCKECGCNKTAKGGTPETLTGKPTKSPYGEYEGVGGTK* |
TB18AUG2009E_0010805 | 3300000203 | Freshwater | MCKSCGCSSNAIGGTPEKLTGKPTKTPYGQYEGVGGTKNK* |
TB18AUG2009E_0100303 | 3300000203 | Freshwater | MCKECGCNKNAKGGTPETLTGKPTKDKFGSYEGVGGSK* |
TBL_comb48_EPIDRAFT_100043811 | 3300000439 | Freshwater | MCVECGCNKNAVGGANDKLTGKPTKDKFGSYEGVGGTKNK* |
TBL_comb48_EPIDRAFT_10028995 | 3300000439 | Freshwater | MCKECGCNANAIGGTPEDLTGKPTKTPYGEYNGVGGTK* |
TBL_comb47_HYPODRAFT_100985161 | 3300000553 | Freshwater | MCAECGCNSNMVGKASDKLTGKPTKDPHGSYEGIGGTK |
RCM47_11678503 | 3300001848 | Marine Plankton | CGCDKNMKGKPSGKLDGKPTKTPTGQYEGVGGTNVTK* |
RCM37_11740324 | 3300001850 | Marine Plankton | MCKECGCTKNAVGGTPEKLTGKPTKDKYGSYEGVGGTKNK* |
GOS2236_10466092 | 3300001968 | Marine | MCAECGCNKNAVGGTPTPNGKPTGSPHGEYKGVGGTNKGAK* |
JGI24028J26656_100021232 | 3300002091 | Lentic | MCAECGCNKNMVGKASDKLTGKPTKDQYGSYEGVGGTK* |
JGI24028J26656_10008625 | 3300002091 | Lentic | MCVECGCNKNAKGGTPETLTGKPTKSPYGEYEGVGGTK* |
JGI24028J26656_10091462 | 3300002091 | Lentic | MCKQCGCDSNAKGGTPETLTGKPTKSPYGEYEGVGGSK* |
JGI24028J26656_10172133 | 3300002091 | Lentic | MCVECGCNKNMVGAASDKLTGKPTKSPYGEYEGVGGTKNK* |
JGI24218J26658_10020283 | 3300002092 | Lentic | MCAECGCNATAVGKLNDKLTGKPTKSPYGEYEGVGGSK* |
JGI24218J26658_10036725 | 3300002092 | Lentic | MCVECGCNDNMIGKPSDKLTGKPQDPHGQYDGVGGTK* |
JGI24218J26658_10065344 | 3300002092 | Lentic | MCVECGCNANMVGKASDKLTGKPTKDQYGSYEGVGGTK* |
JGI24218J26658_10132251 | 3300002092 | Lentic | MCIECGCQDNAVTKNTDKLTGKPQDPYGQYEGVGGTK* |
JGI24219J26650_10036404 | 3300002098 | Lentic | MCAECGCNANMVGKASDKLTGKPTKSPYGEYEGVGGTK* |
JGI24219J26650_10090495 | 3300002098 | Lentic | MCVECGCNANMVGKASDKLTGKPTKDXYGSYEGVGGTK* |
JGI24219J26650_10420892 | 3300002098 | Lentic | MCVECGCNTNAVGGTPEALTGKPTKSPYGEYEGVGGTK* |
JGI24890J29729_10169524 | 3300002307 | Lentic | VVNNMCVECGCNKNAKGGTPETLTGKPTKSPYGEYEGVGGTK* |
G310J44882_100078295 | 3300002933 | Freshwater | MCKECGCSSNAIGGTPEKLTGKPTKTPYGQYEGVGGTKNK* |
JGI26470J50227_10127085 | 3300003375 | Freshwater | MCKECGCNKNAIGGTPENLTGKPTKTPYGEYNGVGGTKNK* |
JGI26470J50227_10130264 | 3300003375 | Freshwater | MCKECGCNKNAVGKLNDKLTGKPTKTPYGEYEGVGGTKNK* |
JGI26470J50227_10538873 | 3300003375 | Freshwater | MCVECGCTKNAVGGANDKLTGKPTKDKFGSYEGVGGTKNK* |
Ga0007869_10160941 | 3300003809 | Freshwater | PTSKEGKVTMCVECGCTKNAVGGANDKLTGKPTKDKFGSYEGVGGTKNK* |
Ga0007861_10046453 | 3300003812 | Freshwater | MCAECGCNKTMVGKPSDKLTGKPTKSQYGEYEGVGGTKNK* |
Ga0007863_10117683 | 3300003820 | Freshwater | MCKECGCNKSMIGKPSIKLDGKPTKTPYGEYEGVGGTKNK* |
Ga0007829_100847483 | 3300004095 | Freshwater | VNNMCKECGCNKNAVGKLNDKLTGKPTKTPYGEYEGVGGTKNK* |
Ga0065861_10079139 | 3300004448 | Marine | MCKECGCNSTAIGKLDDKLTGKPTATPTGLYNGIGGTKK* |
Ga0066223_11002451 | 3300004461 | Marine | MRRLKKLIRKVNNMCVECGCNKTAIGGTPENLTGKPTATPYGLYKGVGGTK* |
Ga0065173_10201464 | 3300004686 | Freshwater | MCVECGCNSSMIGKASDKLTGKPTKDPRGSYEGVGGTKNK* |
Ga0065171_10305331 | 3300004692 | Freshwater | VNNMCVECGCNSNMVGKASEKLTGKPQDPYGQYDGVGGTK* |
Ga0065171_10317903 | 3300004692 | Freshwater | VNNMCVECGCNSNMVGKASDKLTGKPQDPYGQYDGVGGTK* |
Ga0065170_10356071 | 3300004694 | Freshwater | VCKECGCNSNMIGAASDKLTGKPTKTPYGQYEGVGGTKNK* |
Ga0007876_10042265 | 3300006071 | Freshwater | MCKECGCDKNAIGKLDEKLTGKPTKTPYGEYKGVGGTK* |
Ga0007876_10251716 | 3300006071 | Freshwater | MCKECGCNKTAKGGTPETLTGKPTKSPYGEYEGVGGSK* |
Ga0007813_10036575 | 3300006103 | Freshwater | MCKECGCNKNSVGSLNDKLTGKPTKDKFGSYEGVGGTKNK* |
Ga0007882_102350991 | 3300006104 | Freshwater | LRRVSNMCKECGCNKNAVGKLNDKLTGKPTKTPYGEYEGVGGTKNK* |
Ga0007819_10987011 | 3300006105 | Freshwater | CKECGCNKNAIGKLDEKLTGKPTKTPYGEYKGVGGTK* |
Ga0007816_10183033 | 3300006115 | Freshwater | MCKECGCNKNAIGKLDEKLTGKPTKTPYGEYKGVGGTK* |
Ga0007867_10064195 | 3300006120 | Freshwater | MCVECGCNTTAVGKLNDKLTGKPTKTPYGQYEGVGGTNNPGNSSNK* |
Ga0007867_10149074 | 3300006120 | Freshwater | MCAECGCNKTMVGKPSDKLTGKPTKSPYGEYEGVGGTKNK* |
Ga0114350_10543881 | 3300008116 | Freshwater, Plankton | MCVECGCNKNQIGKINDKLTGKPDKAGGGYEGVGGSK* |
Ga0114880_12304592 | 3300008450 | Freshwater Lake | MCVECGCNKTQIGKINDKLTGKPDKAGGGYEGVGGSK* |
Ga0114962_1001226513 | 3300009151 | Freshwater Lake | MCKECGCNTTAKGGTPETLTGKPTKSPYGEYEGVGGSK* |
Ga0114962_100350787 | 3300009151 | Freshwater Lake | MCVECGCNKTAIGGTPENLTGKPTATPYGLYKGVGGTK* |
Ga0114980_100002527 | 3300009152 | Freshwater Lake | MCVECGCNKTAIGGTPENLTGKPTATPTGLYKGVGGTK* |
Ga0114963_100542304 | 3300009154 | Freshwater Lake | MCKECGCNKTAIGGTPDALTGKPTESPYGEYKGVGGTK* |
Ga0114978_102922722 | 3300009159 | Freshwater Lake | MCVECGCNKTQIGKINDKLTGKPDKPGGGYEGVGGSK* |
Ga0114959_100187222 | 3300009182 | Freshwater Lake | MCVACGCNSTAIGGTPDKLTGKPTESPYGEYEGVGGTK* |
Ga0114964_1000168926 | 3300010157 | Freshwater Lake | MCASCGCDSNMIGKTGDQLSGKPQDPYGQYDGVGGTK* |
Ga0114964_1000407511 | 3300010157 | Freshwater Lake | MCVECGCNASVIGGTPDKLTGKPTKSPYGEYEGVGGTK* |
Ga0114964_100419916 | 3300010157 | Freshwater Lake | MCVECGCNKTAIGGTPENLTGKPTATPTGLYKGVGGSK* |
Ga0114964_100835521 | 3300010157 | Freshwater Lake | MCVECGCNSTAIGKLNDKLTGKPTKDQYGSYEGVG |
Ga0114964_101816441 | 3300010157 | Freshwater Lake | MCVECGCNKTAIGGTPENLTGKPTATPYGLYKGVGG |
Ga0114964_105984193 | 3300010157 | Freshwater Lake | MCKECGCNKNAIGGTPEKLTGKPTKSPYGEYEGVGGTK* |
Ga0114960_102058663 | 3300010158 | Freshwater Lake | ECGCNSTAIGKLNDKLTGKPTKDQYGSYEGVGGTK* |
Ga0133913_100085415 | 3300010885 | Freshwater Lake | MCAECGCNATAIGKLNDKLTGKPTKTPYGEYEGVGGSK* |
Ga0133913_101219878 | 3300010885 | Freshwater Lake | MCVECGCNKNIIGKTNDKLTGKPDKPGGGYEGVGGSN* |
Ga0157568_10158911 | 3300012750 | Freshwater | VSNMCKECGCNKNAIGKLDEKLTGKPTKTPYGEYKGVGGTK* |
Ga0136642_10066127 | 3300013285 | Freshwater | MCAECGCNKSMIGKASDKLTGKPTKDQYGSYEGVGGTK* |
Ga0136641_10013448 | 3300013286 | Freshwater | MCVECGCNGNQIGKINDKLTGKPDKAGGGYEGVGGSK* |
Ga0136641_10039256 | 3300013286 | Freshwater | MCVECGCSANMVGKTGDKLTGKPQDPYGQYDGVGGTK* |
Ga0136641_10744525 | 3300013286 | Freshwater | MCVECGCNSSMVGKASDKLTGKPQDPYGQYDGVGGTK* |
Ga0180039_10636261 | 3300016688 | Freshwater | SYQLRRVSNMCKECGCNKNAVGKLNDKLTGKPTKTPYGEYEGVGGTKNK |
Ga0214194_1001678 | 3300020686 | Freshwater | MCAECGCNATAIGKLNDKLTGKPTKSPYGEYEGVGGTK |
Ga0214194_1032054 | 3300020686 | Freshwater | MCKECGCNKNAVGKLNDKLTGKPTKTPYGEYEGVGGTKNK |
Ga0214226_10124903 | 3300020693 | Freshwater | IMCKECGCSSNAIGGTPEKLTGKPTKTPYGQYEGVGGTKNK |
Ga0214198_10000369 | 3300020710 | Freshwater | MCVECGCNKNAVGGANDKLTGKPTKDKFGSYEGVGGTKNK |
Ga0214246_10624621 | 3300020727 | Freshwater | MCKECGCNANAIGGAPEDLTGKPTKTPYGEYNGVGGTK |
Ga0214170_10028395 | 3300020731 | Freshwater | MCAECGCNSTAIGKLNDKLTGKPTKTPYGQYEGVGGTNNVGNSGSK |
Ga0214170_10194384 | 3300020731 | Freshwater | MCKECGCNKNAIGKLDEKLTGKPTKTPYGEYKGVGGTK |
Ga0214199_10066424 | 3300021124 | Freshwater | MCKECGCNKTAKGGTPETLTGKPTKSPYGEYEGVGGSK |
Ga0214175_10019434 | 3300021133 | Freshwater | MCKSCGCSSNAIGGTPEKLTGKPTKTPYGQYEGVGGTKNK |
Ga0214175_10128063 | 3300021133 | Freshwater | MCKECGCDKNAIGKLDEKLTGKPTKTPYGEYKGVGGTK |
Ga0214166_10057794 | 3300021139 | Freshwater | MCVECGCTKNAVGGANDKLTGKPTKDKFGSYEGVGGTKNK |
Ga0214166_10065215 | 3300021139 | Freshwater | MCKECGCNKTAKGGTPETLTGKPTKSPYGEYEGVGGTK |
Ga0214166_10286794 | 3300021139 | Freshwater | MCKECGCNKNAVGKLNDKLTGKPTKTPYGEYEGVGGT |
Ga0213920_100043522 | 3300021438 | Freshwater | MCKECGCNDNAIGGTPDNLTGKPTASPYGLYKGVGGTDK |
Ga0213920_100129513 | 3300021438 | Freshwater | MCVECGCNKTAIGKLDDKLTGKPTATPTGLYKGVGGTKK |
Ga0236341_100037213 | 3300022591 | Freshwater | MCVQCGCNKNAVGGTPDKLTGKPTKSPYGEYEGVGGTKNK |
Ga0248169_1396633 | 3300022602 | Freshwater | MCKECGCNKNMVGKPSVKLDGKPTKTPYGQYEGVGGTKNK |
Ga0208619_1085691 | 3300025336 | Freshwater | VNNMCVECGCNSNMVGKASDKLTGKPQDPYGQYDGVGGTK |
Ga0208501_1001294 | 3300025338 | Freshwater | MCAECGCNKTMVGKPSDKLTGKPTKSQYGEYEGVGGTKNK |
Ga0208383_10200641 | 3300025357 | Freshwater | MCVECGCNKTAKGGTPETLTGKPTKSPYGEYEGVGGTK |
Ga0207957_10379852 | 3300025372 | Freshwater | EERPTSQEGKVTMCKECGCNSNAVGKISDKLTGKPTKTPYGQYEGVGGTKNK |
Ga0208256_10021728 | 3300025382 | Freshwater | MCVECGCNKTAKGGTPETLTGKPTKSPYGEYEGVGGSK |
Ga0208256_10395683 | 3300025382 | Freshwater | NMCKECGCNKNAVGKLNDKLTGKPTKTPYGEYEGVGGTKNK |
Ga0208257_10016208 | 3300025389 | Freshwater | MCKECGCDKNAIGKLDTKLTGKPTKTPYGEYKGVGGTK |
Ga0208874_10080234 | 3300025396 | Freshwater | MCVECGCNSNMIGKTGDKLSGKPQDPYGQYDGVGGTK |
Ga0208875_10347512 | 3300025410 | Freshwater | MCAECGCNKTMVGKPSDKLTGKPTKSPYGEYEGVGGTKNK |
Ga0208614_10026304 | 3300025413 | Freshwater | MCKECGCNKNSVGSLNDKLTGKPTKDKFGSYEGVGGTKNK |
Ga0208746_10176261 | 3300025423 | Freshwater | ECGCNSTAIGKLNDKLTGKPTKTPYGQYEGVGGTNNVGNSGSK |
Ga0208746_10449003 | 3300025423 | Freshwater | MCAECGCNATAIGKLNDNLTGKPTKSPYGEYEGVGGTK |
Ga0208741_101093203 | 3300025723 | Freshwater | VNNMCKECGCNKNAVGKLNDKLTGKPTKTPYGEYEGVGGTKNK |
Ga0208104_10083851 | 3300025773 | Freshwater | ECGCNSNMVGKASDKLTGKPTKDPHGSYEGVGGTKFGK |
Ga0208499_10209901 | 3300025789 | Freshwater | CKECGCNKNAIGKLDEKLTGKPTKTPYGEYKGVGGTK |
Ga0209188_100049660 | 3300027708 | Freshwater Lake | MCVECGCNKTQIGKINDKLTGKPDKPGGGYEGVGGSK |
Ga0209188_100197610 | 3300027708 | Freshwater Lake | MCVECGCNKTAIGGTPENLTGKPTATPYGLYKGVGGTK |
Ga0209188_100971210 | 3300027708 | Freshwater Lake | MCKECGCNTTAKGGTPETLTGKPTKSPYGEYEGVGGSK |
Ga0209188_10190202 | 3300027708 | Freshwater Lake | MCVACGCNSTAIGGTPDKLTGKPTESPYGEYEGVGGTK |
Ga0209188_10712764 | 3300027708 | Freshwater Lake | MCVECGCNSTAIGKLNDKLTGKPTKDQYGSYEGVGGSK |
Ga0209084_100135011 | 3300027749 | Freshwater Lake | MCASCGCDSNMIGKTGDQLSGKPQDPYGQYDGVGGTK |
Ga0209829_100080038 | 3300027777 | Freshwater Lake | MCKECGCNSNAIGGTPEDLTGKPTATPYGLYKGVGGTKK |
Ga0209829_100633235 | 3300027777 | Freshwater Lake | MCAECGCNATAIGKLNDKLTGKPTKTPYGEYEGVGGSK |
Ga0209777_100642315 | 3300027896 | Freshwater Lake Sediment | MCKECGCNANAIGGTPEDLTGKPTKTPYGEYNGVGGTK |
Ga0209298_1000018427 | 3300027973 | Freshwater Lake | MCVECGCNKTAIGGTPENLTGKPTATPTGLYKGVGGTK |
Ga0304729_100034516 | 3300028392 | Freshwater Lake | MCKECGCNKTAIGGTPDALTGKPTESPYGEYKGVGGTK |
Ga0304729_10169266 | 3300028392 | Freshwater Lake | MCVECGCNASVIGGTPDKLTGKPTKSPYGEYEGVGGTK |
Ga0304729_10341681 | 3300028392 | Freshwater Lake | SSKVRKENNMCVECGCNSTAIGKLNDKLTGKPTKDQYGSYEGVGGSK |
Ga0304729_11486651 | 3300028392 | Freshwater Lake | QQRRVNNMCAECGCNATAIGKLNDKLTGKPTKTPYGEYEGVGGSK |
⦗Top⦘ |