Basic Information | |
---|---|
Family ID | F076993 |
Family Type | Metagenome |
Number of Sequences | 117 |
Average Sequence Length | 42 residues |
Representative Sequence | LIAAVAATIASLALAWARNGAIADLLDGVLDHVRTLFGIG |
Number of Associated Samples | 79 |
Number of Associated Scaffolds | 117 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 10.26 % |
% of genes near scaffold ends (potentially truncated) | 50.43 % |
% of genes from short scaffolds (< 2000 bps) | 79.49 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (61.538 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere (22.222 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.479 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (25.641 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 117 Family Scaffolds |
---|---|---|
PF07811 | TadE | 51.28 |
PF08751 | TrwC | 10.26 |
PF00892 | EamA | 9.40 |
PF13400 | Tad | 6.84 |
PF00482 | T2SSF | 3.42 |
PF03641 | Lysine_decarbox | 2.56 |
PF02347 | GDC-P | 0.85 |
PF13581 | HATPase_c_2 | 0.85 |
PF08241 | Methyltransf_11 | 0.85 |
PF11706 | zf-CGNR | 0.85 |
PF09369 | MZB | 0.85 |
PF13604 | AAA_30 | 0.85 |
PF13424 | TPR_12 | 0.85 |
PF03551 | PadR | 0.85 |
PF13358 | DDE_3 | 0.85 |
COG ID | Name | Functional Category | % Frequency in 117 Family Scaffolds |
---|---|---|---|
COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 2.56 |
COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 0.85 |
COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.85 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.85 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.85 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.85 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 61.54 % |
All Organisms | root | All Organisms | 38.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004016|Ga0058689_10058335 | Not Available | 733 | Open in IMG/M |
3300005457|Ga0070662_100548175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 969 | Open in IMG/M |
3300005562|Ga0058697_10062260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1460 | Open in IMG/M |
3300005562|Ga0058697_10195201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 913 | Open in IMG/M |
3300005563|Ga0068855_101927608 | Not Available | 598 | Open in IMG/M |
3300006049|Ga0075417_10614899 | Not Available | 553 | Open in IMG/M |
3300006844|Ga0075428_101318773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 759 | Open in IMG/M |
3300009094|Ga0111539_10478258 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300009147|Ga0114129_10418946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1762 | Open in IMG/M |
3300009147|Ga0114129_12215609 | Not Available | 661 | Open in IMG/M |
3300009147|Ga0114129_12387068 | Not Available | 634 | Open in IMG/M |
3300009156|Ga0111538_10378595 | Not Available | 1792 | Open in IMG/M |
3300009162|Ga0075423_11736754 | Not Available | 672 | Open in IMG/M |
3300009789|Ga0126307_10010366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6762 | Open in IMG/M |
3300009789|Ga0126307_10026543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4431 | Open in IMG/M |
3300009789|Ga0126307_10057776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3040 | Open in IMG/M |
3300009789|Ga0126307_10138005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1949 | Open in IMG/M |
3300009789|Ga0126307_11247613 | Not Available | 602 | Open in IMG/M |
3300009804|Ga0105063_1079487 | Not Available | 521 | Open in IMG/M |
3300009807|Ga0105061_1009959 | Not Available | 1177 | Open in IMG/M |
3300009811|Ga0105084_1064286 | Not Available | 661 | Open in IMG/M |
3300009817|Ga0105062_1086310 | Not Available | 609 | Open in IMG/M |
3300009821|Ga0105064_1060957 | Not Available | 737 | Open in IMG/M |
3300009840|Ga0126313_10008792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 6259 | Open in IMG/M |
3300009840|Ga0126313_10009832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5984 | Open in IMG/M |
3300009840|Ga0126313_10023097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4163 | Open in IMG/M |
3300009840|Ga0126313_10045038 | All Organisms → cellular organisms → Bacteria | 3090 | Open in IMG/M |
3300010029|Ga0105074_1009273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1531 | Open in IMG/M |
3300010037|Ga0126304_10263670 | Not Available | 1136 | Open in IMG/M |
3300010037|Ga0126304_10367392 | Not Available | 958 | Open in IMG/M |
3300010038|Ga0126315_10122260 | Not Available | 1518 | Open in IMG/M |
3300010041|Ga0126312_10192397 | Not Available | 1424 | Open in IMG/M |
3300010041|Ga0126312_10993781 | Not Available | 614 | Open in IMG/M |
3300010042|Ga0126314_10158144 | Not Available | 1582 | Open in IMG/M |
3300010042|Ga0126314_10508443 | Not Available | 875 | Open in IMG/M |
3300010166|Ga0126306_10034726 | All Organisms → cellular organisms → Bacteria | 3428 | Open in IMG/M |
3300010362|Ga0126377_10033917 | Not Available | 4341 | Open in IMG/M |
3300012350|Ga0137372_10546869 | Not Available | 856 | Open in IMG/M |
3300012354|Ga0137366_11133136 | Not Available | 536 | Open in IMG/M |
3300012355|Ga0137369_10113347 | Not Available | 2205 | Open in IMG/M |
3300012355|Ga0137369_10391852 | Not Available | 1004 | Open in IMG/M |
3300012358|Ga0137368_10343023 | Not Available | 996 | Open in IMG/M |
3300012358|Ga0137368_10815832 | Not Available | 576 | Open in IMG/M |
3300012359|Ga0137385_10106789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2480 | Open in IMG/M |
3300012360|Ga0137375_10529354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 996 | Open in IMG/M |
3300012360|Ga0137375_10755149 | Not Available | 787 | Open in IMG/M |
3300012532|Ga0137373_11148810 | Not Available | 552 | Open in IMG/M |
3300012938|Ga0162651_100090107 | Not Available | 518 | Open in IMG/M |
3300014487|Ga0182000_10083409 | Not Available | 1036 | Open in IMG/M |
3300014487|Ga0182000_10679798 | Not Available | 506 | Open in IMG/M |
3300017997|Ga0184610_1077745 | Not Available | 1024 | Open in IMG/M |
3300018028|Ga0184608_10201181 | Not Available | 872 | Open in IMG/M |
3300018052|Ga0184638_1017379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2512 | Open in IMG/M |
3300018061|Ga0184619_10319073 | Not Available | 710 | Open in IMG/M |
3300018063|Ga0184637_10000651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 25348 | Open in IMG/M |
3300018078|Ga0184612_10361346 | Not Available | 735 | Open in IMG/M |
3300018081|Ga0184625_10061522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1895 | Open in IMG/M |
3300018082|Ga0184639_10225307 | Not Available | 993 | Open in IMG/M |
3300018465|Ga0190269_10047783 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
3300018465|Ga0190269_11050404 | Not Available | 622 | Open in IMG/M |
3300018466|Ga0190268_10116836 | Not Available | 1282 | Open in IMG/M |
3300018476|Ga0190274_10019370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4434 | Open in IMG/M |
3300018476|Ga0190274_12407638 | Not Available | 624 | Open in IMG/M |
3300022694|Ga0222623_10282662 | Not Available | 638 | Open in IMG/M |
3300022756|Ga0222622_10020311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3369 | Open in IMG/M |
3300022756|Ga0222622_10617491 | Not Available | 783 | Open in IMG/M |
3300025928|Ga0207700_10319071 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
3300026702|Ga0208708_101645 | Not Available | 598 | Open in IMG/M |
3300027332|Ga0209861_1006671 | All Organisms → cellular organisms → Bacteria | 1743 | Open in IMG/M |
3300027718|Ga0209795_10206706 | Not Available | 550 | Open in IMG/M |
3300027718|Ga0209795_10226313 | Not Available | 524 | Open in IMG/M |
3300027954|Ga0209859_1006840 | Not Available | 2365 | Open in IMG/M |
3300027961|Ga0209853_1153438 | Not Available | 556 | Open in IMG/M |
3300028704|Ga0307321_1088377 | Not Available | 620 | Open in IMG/M |
3300028705|Ga0307276_10034101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1070 | Open in IMG/M |
3300028708|Ga0307295_10100583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 779 | Open in IMG/M |
3300028711|Ga0307293_10121956 | Not Available | 828 | Open in IMG/M |
3300028717|Ga0307298_10141650 | Not Available | 696 | Open in IMG/M |
3300028720|Ga0307317_10000894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8968 | Open in IMG/M |
3300028771|Ga0307320_10084596 | Not Available | 1195 | Open in IMG/M |
3300028796|Ga0307287_10295484 | Not Available | 612 | Open in IMG/M |
3300028876|Ga0307286_10340188 | Not Available | 558 | Open in IMG/M |
3300028881|Ga0307277_10208620 | Not Available | 857 | Open in IMG/M |
3300028889|Ga0247827_10839740 | Not Available | 612 | Open in IMG/M |
3300030336|Ga0247826_11524879 | Not Available | 542 | Open in IMG/M |
3300030510|Ga0268243_1158531 | Not Available | 550 | Open in IMG/M |
3300031548|Ga0307408_100028668 | All Organisms → cellular organisms → Bacteria | 3849 | Open in IMG/M |
3300031548|Ga0307408_101446728 | Not Available | 648 | Open in IMG/M |
3300031731|Ga0307405_10016389 | All Organisms → cellular organisms → Bacteria | 4041 | Open in IMG/M |
3300031731|Ga0307405_10020988 | All Organisms → cellular organisms → Bacteria | 3663 | Open in IMG/M |
3300031731|Ga0307405_10133098 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
3300031731|Ga0307405_10232742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1359 | Open in IMG/M |
3300031731|Ga0307405_10740946 | Not Available | 818 | Open in IMG/M |
3300031731|Ga0307405_11633726 | Not Available | 569 | Open in IMG/M |
3300031824|Ga0307413_10466099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1006 | Open in IMG/M |
3300031824|Ga0307413_10534260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 948 | Open in IMG/M |
3300031852|Ga0307410_10037489 | All Organisms → cellular organisms → Bacteria | 3167 | Open in IMG/M |
3300031852|Ga0307410_10081413 | All Organisms → cellular organisms → Bacteria | 2274 | Open in IMG/M |
3300031852|Ga0307410_10302701 | Not Available | 1262 | Open in IMG/M |
3300031901|Ga0307406_10002457 | All Organisms → cellular organisms → Bacteria | 10095 | Open in IMG/M |
3300031903|Ga0307407_10074705 | All Organisms → cellular organisms → Bacteria | 2029 | Open in IMG/M |
3300031903|Ga0307407_10433226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 950 | Open in IMG/M |
3300031903|Ga0307407_10887253 | Not Available | 683 | Open in IMG/M |
3300031903|Ga0307407_11215935 | Not Available | 589 | Open in IMG/M |
3300031938|Ga0308175_100862604 | Not Available | 994 | Open in IMG/M |
3300031995|Ga0307409_100164838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1943 | Open in IMG/M |
3300031996|Ga0308176_10907729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 926 | Open in IMG/M |
3300032002|Ga0307416_102880493 | Not Available | 575 | Open in IMG/M |
3300032004|Ga0307414_12273481 | Not Available | 506 | Open in IMG/M |
3300032005|Ga0307411_10460339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1066 | Open in IMG/M |
3300032005|Ga0307411_11177456 | Not Available | 694 | Open in IMG/M |
3300032005|Ga0307411_11200145 | Not Available | 688 | Open in IMG/M |
3300032126|Ga0307415_100137592 | Not Available | 1860 | Open in IMG/M |
3300032126|Ga0307415_100173846 | Not Available | 1682 | Open in IMG/M |
3300032159|Ga0268251_10042926 | Not Available | 1454 | Open in IMG/M |
3300032159|Ga0268251_10056327 | Not Available | 1304 | Open in IMG/M |
3300032159|Ga0268251_10139514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 904 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 22.22% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 14.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.82% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.55% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 7.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.84% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.84% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 5.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.42% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.56% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.85% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.85% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.85% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.85% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
3300009807 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010029 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_10_20 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012938 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015 | Environmental | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026702 | Grasslands soil microbial communities from Kansas, USA, that are Nitrogen fertilized - NN593 (SPAdes) | Environmental | Open in IMG/M |
3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0058689_100583352 | 3300004016 | Agave | TGSQTTEYALIMVVAATIASLALAWARNGAIADLLNGVLDHVRSLFGMG* |
Ga0070662_1005481751 | 3300005457 | Corn Rhizosphere | ETGSQTTEYALIMVVAATIASLALAWARNGAIADLLTGVLDHVRSLFGIG* |
Ga0058697_100622601 | 3300005562 | Agave | SQTTEYALIMVVAATIASLALAWARNGAVADLLNGVLDHVRSLFGMG* |
Ga0058697_101952012 | 3300005562 | Agave | MSSECGSQTTEYALIMVVAATIAALALAWARNGAIAGLLDGVLDHVRALFGIG* |
Ga0068855_1019276081 | 3300005563 | Corn Rhizosphere | MVVAATIASLALAWARNGAVADLLTGVLDHVRSLFGIG* |
Ga0075417_106148992 | 3300006049 | Populus Rhizosphere | VAATIASLALAWARNGAIAGLLDGVLDHVRSLFGMG* |
Ga0075428_1013187733 | 3300006844 | Populus Rhizosphere | ATIASLALAWARNGAIADLLTGVLDHVRSLFGIG* |
Ga0111539_104782581 | 3300009094 | Populus Rhizosphere | VRLSLTLAVAATIASLALAWARNGAVAGLLDGVLDHVRSLFGMG* |
Ga0114129_104189462 | 3300009147 | Populus Rhizosphere | LIAAVAATIASLALAWARNGAVAGLLDGVLDHVRSLFGMG* |
Ga0114129_122156092 | 3300009147 | Populus Rhizosphere | LTLAVAATIASLALAWARNGAIADLLDGVLDHVRSLFGMG* |
Ga0114129_123870682 | 3300009147 | Populus Rhizosphere | ATIAALALAWARNGAIAGLLDGVLDHVRALFGIA* |
Ga0111538_103785954 | 3300009156 | Populus Rhizosphere | LIMVVAATIASLALAWARNGAVAGLLDGVLDHVRSLFGMG* |
Ga0075423_117367541 | 3300009162 | Populus Rhizosphere | LIAAVAATIASLALAWARNGAIAGLLDGVLDHVRSLFGMG |
Ga0126307_100103662 | 3300009789 | Serpentine Soil | MAAVAATIASLALAWARQGAIAELLDGVLDHVRSLFGIG* |
Ga0126307_100265431 | 3300009789 | Serpentine Soil | VAATIASLALAWARQGAIAGLLDGVLDHVRALFGIG* |
Ga0126307_100577765 | 3300009789 | Serpentine Soil | LIAAVAATIASLALAWARNGAIADLLTGVLDHVRSLFGMG* |
Ga0126307_101380052 | 3300009789 | Serpentine Soil | LIAAVSATIASLALAWARNGAIADLLTGVLDHVRSLFGIG* |
Ga0126307_112476132 | 3300009789 | Serpentine Soil | MAAVAATIASLALARARNGAIADLLTGVLDHIRSLFGMG* |
Ga0105063_10794871 | 3300009804 | Groundwater Sand | MSSEAGSQTTEYALIMVVAATIAALALAWARNGAIAGLRDGVLDHVRALFGIA* |
Ga0105061_10099593 | 3300009807 | Groundwater Sand | VAATIAALALAWARNGAIAGLLDGVLDHVRALFGIA* |
Ga0105084_10642862 | 3300009811 | Groundwater Sand | VAATIAALALAWARNGAIAGLLDGVLEHVRALFGIA* |
Ga0105062_10863102 | 3300009817 | Groundwater Sand | MSSEAGSQTTEYALIMVVAATIAALALAWARNGAIAGLLDGGLEHVRALFGIA* |
Ga0105064_10609571 | 3300009821 | Groundwater Sand | RLYYRPSLIAAVAATIAALALAWARNGAIAGLLDGVLDHVRALFGIA* |
Ga0126313_100087928 | 3300009840 | Serpentine Soil | LIAAVAATIASLALAWARNGAVADLLNGVLDHVRSLFGMG* |
Ga0126313_100098322 | 3300009840 | Serpentine Soil | LIAAVAATIASLALAWARNGAVAELLDGVLDHVRALFGIG* |
Ga0126313_100230972 | 3300009840 | Serpentine Soil | LIAAVAATIASLALAWARKGAVAGLLDGVLDQVRSLFGIG* |
Ga0126313_100450384 | 3300009840 | Serpentine Soil | LIAAVAATIASLALAWARQGAIAELLDGVLDHVRSLFGIG* |
Ga0105074_10092732 | 3300010029 | Groundwater Sand | VAATIAALALAWARNGAIAGLLDGVLDHVRALFGIT* |
Ga0126304_102636701 | 3300010037 | Serpentine Soil | MAAVSATIASLALAWARNGAIADLLTGVLDHIRSLFGIG* |
Ga0126304_103673921 | 3300010037 | Serpentine Soil | VARYYRPSLIAAVSATIASLALAWARNGAIADLLTGVLDHIRSLFGIG* |
Ga0126315_101222603 | 3300010038 | Serpentine Soil | LIAAVAATIASLALAWARQGAIAGLLDGVLDHVRALFGIG* |
Ga0126312_101923971 | 3300010041 | Serpentine Soil | VAATIASLALAWARNGAIAELLDGVLDHVRTLFGIS* |
Ga0126312_109937811 | 3300010041 | Serpentine Soil | LIAAVAATIASLALAWARNGAVAELLDGVLDHVRTL |
Ga0126314_101581442 | 3300010042 | Serpentine Soil | LIAAVSATIASLALAWARNGAIADLLTGVLDHIRSLFGIG* |
Ga0126314_105084434 | 3300010042 | Serpentine Soil | YYGLSLIAAVAATIASLALAWARNGAIGDLLDGVLDHVRSLFGMG* |
Ga0126306_100347261 | 3300010166 | Serpentine Soil | LIPAVAATIASLALAWARNGAIADLLDGVLDHVRTLFGIS* |
Ga0126377_100339174 | 3300010362 | Tropical Forest Soil | MEYALLLIVAATIAVLALSWARQGAIKDLLDAVLDKVQDLFGIG* |
Ga0137372_105468692 | 3300012350 | Vadose Zone Soil | SEEGSQTTEYALLIVVSATIASLALAWARNGAVAGLLDAVLKQVRGLFGVA* |
Ga0137366_111331361 | 3300012354 | Vadose Zone Soil | SETVEYALMMLVAASIAGLALAWARHGAVVALLDGVIKHVRSLFGIA* |
Ga0137369_101133471 | 3300012355 | Vadose Zone Soil | MVLAATIAALALAWARNGAVAGLLDTVLRQVRGMLGIG* |
Ga0137369_103918522 | 3300012355 | Vadose Zone Soil | LIAAVAATIAALALAWARNGAIAGLLDGVLDHVRALFG |
Ga0137368_103430231 | 3300012358 | Vadose Zone Soil | LIAAVAATIAALALAWARNGAIAGLLDGVLDHVRAL |
Ga0137368_108158321 | 3300012358 | Vadose Zone Soil | VSPTYDLSLIVALAATIAALALAWARNGAVAGLLDTVLRQVRGMLGIG* |
Ga0137385_101067892 | 3300012359 | Vadose Zone Soil | LIVVLAATIAALALAWARNGAVASLLDTVMRQVRGMLGAG* |
Ga0137375_105293541 | 3300012360 | Vadose Zone Soil | LIMVLAATIAALALAWARNGAVAGLLDTVLRQVRGMLGIG* |
Ga0137375_107551492 | 3300012360 | Vadose Zone Soil | LIAAVAATIAALALAWARNGAIAGLLDGVLDHVRALFGIA* |
Ga0137373_111488102 | 3300012532 | Vadose Zone Soil | VSATIASLALAWARKGAIAGLLDVVMRQVRSLFGIG* |
Ga0162651_1000901071 | 3300012938 | Soil | MAAVSATIASLALAWARNGAIADLLTGVLDHVRSLFGIG* |
Ga0182000_100834091 | 3300014487 | Soil | LILVVAATIASLALAWARQGAIADLLDGVLDHVRSLFGIG* |
Ga0182000_106797982 | 3300014487 | Soil | MAAVAATIASLALAWARKGAVADLLNGVLDHVRSLFGMG* |
Ga0184610_10777453 | 3300017997 | Groundwater Sediment | MAAVAATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0184608_102011812 | 3300018028 | Groundwater Sediment | LMAAVAATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0184638_10173792 | 3300018052 | Groundwater Sediment | VAATIAALALAWARNGAIAGLLDGVLDHVRALFGIA |
Ga0184619_103190731 | 3300018061 | Groundwater Sediment | SQTTEYALIMVVSATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0184637_100006513 | 3300018063 | Groundwater Sediment | VWQQAWPYGLSLIMVLAATIAALALAWARNGAVAGLLDTVLRQVRGMLGIG |
Ga0184612_103613462 | 3300018078 | Groundwater Sediment | MAAVAATIASLALAWARNGAIADLLDGVLDHVRTLFGMG |
Ga0184625_100615222 | 3300018081 | Groundwater Sediment | MRGRYYRPSLIAAVAATIASLALAWARNGAIADLLDGVLDHVRSLFGMG |
Ga0184639_102253071 | 3300018082 | Groundwater Sediment | LIMVVAATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0190269_100477831 | 3300018465 | Soil | LIVAVAATIASLALAWARNGAIADLLDGVLDHVRSLFGMG |
Ga0190269_110504041 | 3300018465 | Soil | RGRYYRPSLIAAVTATIASLALAWARNGAIADLLTGVLDHVRSLFGMG |
Ga0190268_101168363 | 3300018466 | Soil | SLIAAVAATIASLALAWARNGAIGDLLDGVLDHVRSLFGMG |
Ga0190274_100193708 | 3300018476 | Soil | VAATIASLALAWARNGAIADLLDGVLDHVRTLFGIS |
Ga0190274_124076382 | 3300018476 | Soil | YALIMVVAATIASLALAWARNGAVADLLNGVLDHVRSLFGIG |
Ga0222623_102826621 | 3300022694 | Groundwater Sediment | ETGSQTTEYALIMVVSATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0222622_100203111 | 3300022756 | Groundwater Sediment | AATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0222622_106174911 | 3300022756 | Groundwater Sediment | RPFDPETGSQTTEYALIMVVSATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0207700_103190714 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VVSATIASLALAWARKGAIAGLLDVVMRQVRSLFGIG |
Ga0208708_1016452 | 3300026702 | Soil | LIAAVAATIASLALAWAREGAVADLLNGVLDHVRSLFGMG |
Ga0209861_10066713 | 3300027332 | Groundwater Sand | MRGRYYGPSLIAAVAATIAALALAWARNGAIAGLLDGVLDHVRALFGIA |
Ga0209795_102067062 | 3300027718 | Agave | MSSECGSQTTEYALIMVVAATIAALALAWARNGAIAGLLDGVLDHVRALFGIA |
Ga0209795_102263132 | 3300027718 | Agave | ALIMVVAATIASLALAWARNGAVAGLLDGVLDHVRSLFGMG |
Ga0209859_10068403 | 3300027954 | Groundwater Sand | VAATIAALALAWARNGAIAGLLDGVLEHVRALFGIA |
Ga0209853_11534382 | 3300027961 | Groundwater Sand | MIPPATIAALALAWARNGAVAGLLSGVLDHVRELFGIG |
Ga0307321_10883771 | 3300028704 | Soil | LAAENCSQTTEYALIMVVAATIASLALAWARNGAIADLLDGVMDHVRTLFGIG |
Ga0307276_100341013 | 3300028705 | Soil | AAENGSQTTEYALIMVVAATIASLALAWARNGAIADLLDGVLDHVRTLFGVG |
Ga0307295_101005833 | 3300028708 | Soil | TGDRYYGPSLMAAVAATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0307293_101219561 | 3300028711 | Soil | VPNLEPPYALIMVVAATIASLALAWAHNGAIADLLDGVLDHVRTLFGVG |
Ga0307298_101416502 | 3300028717 | Soil | QTTEYALIMVVAATIASLALAWARNGAIADLLDGVMDHVRTLFGIG |
Ga0307317_1000089411 | 3300028720 | Soil | MVVAATIASLALAWARNGAIAGLLDGVLDHVRSLFGMG |
Ga0307320_100845963 | 3300028771 | Soil | IMVVAATIASLALAWARNGAIDDLLTGVLDHVRSLFGIG |
Ga0307287_102954841 | 3300028796 | Soil | IMVVSATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0307286_103401881 | 3300028876 | Soil | AVAATIASLALAWARNGAIADLLDGVLDHVRTLFGIG |
Ga0307277_102086203 | 3300028881 | Soil | LIAAVAATIASLALAWARKGAVADLLNGVLDHVRSLFGMG |
Ga0247827_108397401 | 3300028889 | Soil | YALLMIVAATLAMLALAWARQGAIKALLDAVMDKVLALFGIGRG |
Ga0247826_115248792 | 3300030336 | Soil | QTTEYALIMVVAATIASLALAWARNGAIADLLDGVLDHVRSLFGMG |
Ga0268243_11585312 | 3300030510 | Soil | GTSPNYHPSLTAAVAATIASLALAWARQGAIADLLDGVLDHVRSLFGIG |
Ga0307408_1000286686 | 3300031548 | Rhizosphere | LMAVVAATIASLALAWARQGAIADLLDGVLDHVRSLFGIG |
Ga0307408_1014467282 | 3300031548 | Rhizosphere | LIAAVAATIASLALAWARQGAIAELLDGVLDHVRSLFGIG |
Ga0307405_100163895 | 3300031731 | Rhizosphere | LIAAVAATIASLALAWARNGAVAELLDGVLDHVRALFGIG |
Ga0307405_100209886 | 3300031731 | Rhizosphere | LIAAVAATIASLALAWARQGAIADLLDGVLDHVRSLFGIG |
Ga0307405_101330981 | 3300031731 | Rhizosphere | LIAAVAATIASLALAWARNGAVADLLNGVLDHVRSLFGMG |
Ga0307405_102327423 | 3300031731 | Rhizosphere | LIAAVSATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0307405_107409461 | 3300031731 | Rhizosphere | LIAAVAATIASLALAWARKGAVAGLLDGVLDQVRSLFGIG |
Ga0307405_116337262 | 3300031731 | Rhizosphere | LIAAVAATIASLALAWARNGAIGDLLDGVLDHVRSLFGMG |
Ga0307413_104660991 | 3300031824 | Rhizosphere | LIMVVSATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0307413_105342603 | 3300031824 | Rhizosphere | LIAAVAATIASLALAWARQGAIAELLDGVLDHVRALFGIG |
Ga0307410_100374891 | 3300031852 | Rhizosphere | ALIMVVAATIASLALAWARNGAVADLLNGVLDHVRSLFGMG |
Ga0307410_100814131 | 3300031852 | Rhizosphere | RTGDRYYGPSLMAAVAATIASLALAWARQGAIADLLDGVLDHVRSLFGIG |
Ga0307410_103027013 | 3300031852 | Rhizosphere | IMVVAATIASLALAWARNGAVAGLLDGVLDHVRSLFGMG |
Ga0307406_100024572 | 3300031901 | Rhizosphere | MAVVAATIASLALAWARQGAIADLLDGVLDHVRSLFGIG |
Ga0307407_100747052 | 3300031903 | Rhizosphere | MAAVAATIASLALAWARQGAIADLLDGVLDHVRSLFGIG |
Ga0307407_104332261 | 3300031903 | Rhizosphere | RERYYGLSLIAAVAATIASLALAWARQGAIAELLDGVLDHVRSLFGIG |
Ga0307407_108872533 | 3300031903 | Rhizosphere | RYYRPSLIAAVSATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0307407_112159351 | 3300031903 | Rhizosphere | MAVVAATIASLALAWARNGAIGDLLDGVLDHVRSLFGMG |
Ga0308175_1008626042 | 3300031938 | Soil | LIAAVAATIASLALAWARNGAIADLLDGVLDHVRTLFGIG |
Ga0307409_1001648381 | 3300031995 | Rhizosphere | LIAAVAATIASLALAWARQGAIAELLDGVLDHVQSLSGSAEP |
Ga0308176_109077293 | 3300031996 | Soil | ALIMVVAATIASLALAWARNGAIADLLDGVLDHVRTLFGIG |
Ga0307416_1028804931 | 3300032002 | Rhizosphere | GPSLMAVVAATIASLALAWARQGAIADLLDGVLDHVRSLFGIG |
Ga0307414_122734812 | 3300032004 | Rhizosphere | LIAAVAATIASLALAWARNGAIADLLTGVLDHVRSLFGMG |
Ga0307411_104603391 | 3300032005 | Rhizosphere | SASSKVARYYRPSLIAAVSATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0307411_111774561 | 3300032005 | Rhizosphere | LVAETGSQTTEYALILVVAATIASLALAWARQGAIAELLDGVLDHVRSLFGIG |
Ga0307411_112001451 | 3300032005 | Rhizosphere | GDRYYGPSLMAAVAATIASLALAWARNGAIGDLLDGVLDHVRSLFGMG |
Ga0307415_1001375922 | 3300032126 | Rhizosphere | MLAVAATIASLALAWARQGAIAELLDGVLDHVQSLFGIG |
Ga0307415_1001738461 | 3300032126 | Rhizosphere | AAVSATIASLALAWARNGAIADLLTGVLDHVRSLFGIG |
Ga0268251_100429261 | 3300032159 | Agave | TTEYALIMVVAATIASLALAWARNGAVADLLNGVLDHVRSLFGMG |
Ga0268251_100563273 | 3300032159 | Agave | MSSECGSQTTEYALIMVVAATIAALALAWARNGAIAGLLDGVLDHVRALFGIG |
Ga0268251_101395141 | 3300032159 | Agave | ETGPQTTEYALIMVVAATIASLALAWARNGAIADLLNGVLDHVRSLFGMG |
⦗Top⦘ |